1FP5A

Crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGE HEAVY CHAIN EPSILON-1
publication title Structure of the human IgE-Fc C epsilon 3-C epsilon 4 reveals conformational flexibility in the antibody effector domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2000-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fp5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fp5A02
1BJ1H 3HMXH 2ZPKL 4NQDA 3VFUA 1KG0A 1CU4H 3L3DB 3WDJA 4YBQC 4C56A 3M17A 1DEDA 3MV7B 5D7KD 5TJWK 3ZMRA 1CD8A 3GK8H 4I0PB 2UY7A 1GZPB 4X5XA 3MZTA 1AIFB 2ITCB 3QEGH 1QQDB 2XTJB 4QRRD 4RFEA 4G8EB 3SE9L 3B8YA 3HI1B 4NQCE 3IJHA 2Q1EA 2EYSA 4K3JL 2VQUA 3MROA 1OTSD 1MREH 3MRLA 4OKDA 2ZSVA 4MAUL 5I73B 1JPFA 2IBZX 2O26U 4IS6B 2MPAH 4EVNA 4JDVB 3GSVA 3FFCA 4R26H 3WD5L 3G6JB 4L3EA 4MQ7A 3G5XB 2VDNH 1KTRL 1CFTA 5L6YL 1YY8B 1UGNA 4JRXA 4M48H 5JW4R 1QBAA 4HT1L 4HJ0D 1A7OL 2K7QA 2P8PB 4OFKA 5LGJB 4LSPL 1KCVH 1A7RL 5DHVH 1T5WA 4TSCL 4XAKD 1IQWL 3GRWL 3MUGB 4WI9A 3GMLA 1RZ8A 3T1FA 3GSNL 1C8PA 5JW4N 4YPGB 4RAVA 2FZ3A 5C09A 1OCWL 2XA3A 5EUOF 2R29H 4B50A 3DO7B 3P0YH 1OAYL 4KKNA 2VDRH 1NGXB 3QUXC 1SY6H 2EE2A 2WMPA 3BXNA 2YA2A 3TN0B 1Z5LB 1MHHB 4ZUSA 3FQWB 5HGHB 4LLVA 1YMHA 1C7SA 4L4TD 4DGYH 2YUXA 4JKPL 1QR1B 1SMOA 4YXKH 1KFAH 4NM8L 5HVWA 4JM2F 2YK1L 5DF0A 3HCVB 2Q7YA 3LD8C 1F11A 3UPRA 5HHVL 1W2KT 4P4KD 4XBPB 5MENA 5E2WH 3RX7A 3CLEL 3KYAA 5C2BH 1MCDA 43CAA 1PVHA 4RFNC 3LN4B 3KLAB 4WY7L 1L7IL 4NO3A 2X7LA 1U8OA 1Z0NA 2J4WH 3NTCH 4FQLH 5IQ9B 2DLHA 5BOPA 2J1KA 4RGOH 4Q2ZA 4MD4B 3GBNL 1A4JA 1UKSA 4ZDHA 3VFNA 2R0LH 1KPUA 4O51A 3RZCB 3WKML 1TZIA 4O2FB 5C0DA 1FZOB 1OSZA 1OD9A 1BVLB 2ESVA 1IT9L 5EU5A 3VW3L 4J3SA 2DMKA 4HAFA 5I18L 1IM9B 5GGRA 2B4CL 3AUVA 4M61B 5E6ID 5MI0B 3VFWB 2AJYL 3EZJB 1FNLA 2DOCA 1IM3B 3HR5B 4O4YL 3HI6H 5EORL 3PWLA 5IJVB 1OAKH 2J12B 3BEVB 4N0UE 1GH7A 2MKWA 5D1ZB 4GKSA 4HIXL 5C0BB 3HNVH 2PO6A 5BOZG 1HOCA 4NN5B 2Y72A 3MLWH 3K74B 1RJLB 4G9FE 4YUEL 2E7MA 4F7MB 3U36A 1QSZA 3QDGB 2YMXH 4NRZB 2DWDB 1RIVH 3VFOA 4HIIB 2PKDA 3EOBB 5HGBA 1FDLH 4XVSL 1VFOA 3QHZL 4PP2A 5T5FL 3QUMA 4J7RA 5SWSA 3LIZL 4S1SH 3BW9B 1ZK9A 1XIWB 5DVOA 4ZUTA 2J88L 5J06A 4MJID 1A3LH 4P3CL 1Z6JT 2FEDD 2IPTH 2LFGA 1JHKH 3EYOB 1QVOB 3L95A 3TVMC 1MCPH 2VDLH 4Y4KB 5BQ7B 4CVUA 5IG7A 4P2OA 3SPVA 1IGFL 4KHXL 4QXUL 2BVUA 3GBLA 1RUQL 3BHBB 4AENA 1YEFH 3L5XL 2CQVA 4FA8A 1K5NB 1FP5A 4RRPG 4I3GA 5TGBA 5I75B 2HVJA 5JW3L 4WHTB 5EBLA 3VGAC 4JZJB 5GGTL 1R5VB 2ZCKL 1KXTB 3FQUA 1DE4A 3KYMB 3RDTA 2A83A 4R0LC 1CE1H 3FB5B 3NIFE 1WZ1H 3QFJD 4P57B 2XPGB 5CP3A 1I9JH 4H20H 3ZDYF 3SQOL 3U7YH 5F1SA 4IRSA 2BRRH 4JPVH 3MRNB 3EOTH 4XC3L 2DI8A 1ZLSL 1UACH 4LLQB 4Z7QF 3MV9D 2FX8L 2B5IB 2AEPH 1UM6L 3RZWA 5GSRA 1CGYA 2CXKA 1SEBB 3RWEB 3VXPB 5GRYA 1REIA 4PJ5D 1YY9D 3O41A 3QXVA 1UWXK 3ZE2F 4AEEA 1MRCH 1OTUC 4XMLL 5IBLD 3GSOB 3RJQB 4LBEB 2NY1B 2ADIB 2C1OA 4FTVA 5ACLA 1T22B 4D0CB 4YIQB 1S78C 2NY0C 4L8SB 3EOAB 4XP4L 2MWCA 2ZUQC 2XN9D 1A2YA 3MJ7A 4BQBA 4JR9H 5FYJU 3H7BA 2AKRB 1T7YA 4G5ZH 3BP4A 3RTQB 3WFHA 1G7HA 4MA3B 2EEDA 4PRDA 1K9TA 2BVOA 1FORH 4XX1G 2YPKB 4FQXD 1MHEB 5FECB 2AJ3A 1JFQH 5HGGS 1JYWA 4J3VA 4R96A 1X5KA 4R8WL 1A4KA 1IGCH 4IDJL 1FVCB 4KXZH 3BWAB 1C08A 1L4IA 1J7VR 3G6DH 3GO1L 4LKCB 1NC4B 2VXSL 4MJ4A 5IB4A 4YXLH 2IMMA 1T83A 1QFWH 2NW3A 3WUWB 1ND0A 3KPSE 1P53A 3QNZA 1BQLH 4HKXB 4ZOAA 2DM4A 4LIQE 3ULUL 4NWUH 1NFKA 3QO1A 2Y23A 3EKCA 3T0ED 1QSED 4YDJA 2VXTL 4PJ9B 4OCMC 3CDCA 1J8HB 3MRRA 2NX5E 2D0GA 3OR7B 5H2BB 2X4RB 2OMBA 4ODWA 5JHLL 1J5OL 5BXFA 3OKLB 4Y16D 1MCSA 2X4OB 1F4WL 3I6KA 3GSUB 2APXA 2XKNB 3DRQA 3W9DB 4BZYA 3MYZA 3LHPL 1YMMA 5C7XL 5FYKD 5C08D 3VG0L 4KKLD 3SDAB 4PTTA 3V9FA 2ZOKB 3SN6N 4WEBL 4JLRB 2JCCA 3ILQD 5AYQA 1H5BC 4HHAB 2V5RA 4NJAL 3BISA 4CN6A 3OTTA 1G7QA 2YPLE 1LO2L 3QUKB 3DYMA 1YEIL 2CK2A 2G2RA 3BIKA 5HGAB 5FM4A 1HWHB 3QQ3A 4KRLB 3QXAA 1UM4H 3I75A 2BVQB 4AEIL 2J5LB 2VABB 1EO8L 3MTRA 3OQ3B 5E99L 3ROLB 3IDYB 5TDPB 2DLEA 3A6OA 5AD0B 2H6PB 5D7JD 5CEYA 1NAML 3KJ4B 5DJXB 4YO0B 4HGMA 3OZ9L 3OB0K 1WBXB 1QD0A 3MSPA 4MNQE 5J11C 3E6FA 1U3HB 4LVOC 4TUJB 3ISWA 1KIPA 3LPWA 1R6VA 3HI5H 5D7LB 4HXBL 1I9IL 3CFJA 1XR8B 2HKHH 4P59L 2CLZA 1IGYA 1RZGB 2FX9H 3EUUA 1EEQA 3ARVA 3RQ3A 1DBKL 3NFSL 4EI6B 4RIRB 1FC1A 4WUUE 5DURD 4U6VL 2XWTB 2DLFH 3D3VA 3V2AR 4FN0A 1I8KA 1S7UB 1MJUL 2VLRE 4CJ0A 3O2WH 2HLAA 4OFPA 1AD0B 2IPKA 5GRUL 2DM3A 3C8KB 3W9EB 1QSVA 5DO2D 1YQVL 3BIBX 4AZ8A 5TFSH 4LP5A 1HH6B 5JO5A 1OF2A 4NQEE 1HYSD 1M7IB 3RVWC 3MNZB 5EO0B 4ZAKD 4LF3B 5CZXD 3D25A 4UT7H 2CD0A 5DDHA 2B1HH 1Q9WB 4KK9D 1BHGA 5C2UB 1AO7A 3EYSH 5DC0A 3GSQB 3VXSB 3FMGH 4OIBA 5DRZA 3BDYL 3WHE1 1TVHB 2VLJE 2HT3C 2NY5H 1DSFH 4PJIF 1EEZA 3BPOB 3D6GA 4RA0C 3QEUB 3MXWL 5LVEA 3VXUE 3QG7H 4V1DE 1UM5L 3BZEA 2ORBH 3U9PH 1MWAB 4ETQA 5E2VL 5KS9E 1F3DJ 1KCRH 1VFAA 2NZ9C 2GJ6A 2DJ4A 4XWGH 4UAOC 1T66D 1GGYA 1I9RH 3AM8C 1KC5H 3OKEA 4PPTA 4FQ1L 3QEHA 5ENWA 1YEGL 5BVJB 4KZEL 3VFGH 1F90L 3MLPA 4NWTH 4ODUA 2R8SL 1U0QA 3V4PL 3C09B 4DN4L 2HTLD 2V5YA 1XGYH 1EUTA 1TCMA 3EO9H 3X3FH 35C8H 5ESAB 1YN7A 1RUAH 2QKIA 1T7WA 4X9HA 4IOFC 2HFTA 3HC3L 3ARPA 4JHWH 3V6FB 5TDOB 1CIDA 3I3EA 3ARBD 4YGVA 3FFDA 3MXVL 5EBGA 3MV8E 2NPLX 3RFZC 2XWJB 1WAAE 3WUZA 3ULVH 4GQ9H 1FAIH 4OCWH 2FIRT 1RZFL 2D7PA 3VRJA 5IT2L 3HMXA 5FUCE 4BM7A 3WYRA 3D9AL 5TQ0H 3LMJH 3W0WA 5F1OB 5ID0A 4HG4J 1X5YA 4OB5H 1UA6L 4MHHG 4CW1A 2C7UB 2HMIC 3RI5F 5E2TH 1LD9A 1KN4L 1Y6NR 5I2IB 1BWMA 3B5HA 1BLNA 1SJEA 4KK6C 3TVMA 3DV6A 3KPMB 3BMWA 5MP6L 3NABH 4IBLT 4S1QH 3RAJH 3PWNA 5IVXE 4WI6A 4DJMA 5D9SA 5DJ2A 2Q8BH 4ZD3H 2ZP0T 3LSOA 3OAYK 4QRTA 1KNOA 1BBJB 1INQB 5ACZB 1S7SA 3I02B 3O45B 4JB9L 5DRWA 5D2NE 4X5WA 1ZGLM 2CK0L 4Z0BH 1HDMB 1J1PL 1U92B 4FQHA 5E0QA 3VWJC 4MCYB 5DHVA 5FA4A 1FPTL 2OJEA 4NHUB 1BD2B 4R0LA 3OF6A 2VDPL 1FV1B 1GOGA 1E6OH 1EAPB 5F7WC 5GHWL 4YFLF 1FL5A 3L5WB 4FG6C 4PJGB 1G6VK 4QOKB 2APWA 1QLEL 4JG1H 2VE6A 1YNTA 2R1WB 3O3AB 2PW1A 4TULH 3PWVB 3GMRA 1SY6A 2NTSP 3I50H 5ALBL 2P24B 2AK4B 1T03L 4MAYC 2DMCA 3S37L 1ZXQA 2BXYA 5T3XE 1RJCA 4ZPVB 1K2DB 3BZ4B 2C26A 1IEHA 1MCCA 3L7EA 4OF3A 4WFFE 3BUYB 4CMHC 2IH3B 5CMAA 3SKOA 4FXKA 5C07D 1QFUH 1ZHKB 1NBYA 3CU7A 1FNSH 5JW5A 3QUYB 3T65A 5C0FA 5D6CB 4JFEB 1I7RA 4UNTA 3IF1B 4I4WB 1MJJB 4EDWH 4L4VE 4HJGA 4YDLC 4M00A 4OLZH 4Y5YB 2AJSH 25C8H 4Y19B 4AJ0A 3IJSA 3GJFB 3H0TA 4I0PC 3MBXL 4UQ3B 1BOYA 3UXFA 1SMAA 3CDGB 1C5CL 2XTJC 4GW1B 4D0BB 1QLFB 5DEFA 4HK3J 2F9BT 1E0OB 4G42B 3BH9B 4L8CA 5E9DD 4GAFB 5SWZB 5DJAB 4K3EH 4R7NA 5IV2A 2H1PL 1GGUA 3WS6C 5I73C 2NY5C 5HSFA 3PV7A 4DVBA 4U6YA 1XT5A 4YHNA 4DZ8A 4OTXH 4PJAE 5L2JB 1E4KC 1LILA 4JFPB 1WWBX 1MCOL 3QXDA 2KBGA 1B88A 3TH3T 2QADB 3NFPA 1UH3A 3BP6B 1BFOA 5EZOL 4Z6AT 4HIHA 2VKWA 4WFGD 1OAUL 3MMEB 1B4JL 1K8IA 1N3NA 1RIUL 2QL1A 5C6WH 1ZHBA 3B3IB 4S0TD 5IFAH 2Z8SA 3TZVB 5E8PA 4UU9B 3BN9D 1WWCA 1WIUA 4JPKL 5I1KH 3V0VB 4C4KT 2DYPB 1HCVA 2PN5A 3MOBL 1Y0LB 2HRPL 1HHKB 4I2XE 5T3ZE 1X3DA 2DQIH 3U46B 1FE8L 1JWSB 1LEKA 4XHJD 3SDCB 4OZFG 3RWFA 4MS8D 3T4AA 1Z3GL 3PGFL 3QQ4B 4PJXB 1AE6H 4ZSOB 5HHXH 2R1XA 4HKJA 4PRPD 5F7UA 1H5BA 1WT5C 4JKMA 5ADPH 3F7QA 2O5YH 4UQ2A 4GRLD 3U9UA 3ZLQC 4DQOL 4OZFH 3VD3A 4XXCC 1NBVH 3PABB 3FQNA 3RHWK 4OLXL 3KDMA 1N6QH 3TH4T 6FABH 3GI8H 1YPZB 4LEXH 4Y4HB 4OD3L 4NKOA 2AV7B 4JFXB 1O7VA 2EH8H 1NAKL 1PSKH 3QJFB 1CZ8L 1TPXB 4WW2F 3MRFA 1KLGB 2OL3L 3FQRA 1KCUL 1JPST 1NGWA 4ORGA 3WUWG 3GZKA 1ZANH 2VXVH 4F37K 2PXYD 2DAVA 5IB2A 3JUYA 2YD8A 3OXSB 5DHYB 4UV4H 3RZCC 3LQMA 4MSWB 1IGMH 4JM2D 1ZLWK 3C6SB 4Z95L 3EJZC 3JZ7A 4IJ3C 2WLYA 2X4UA 2X40A 1F8TL 1T2QH 3FONB 4R97B 1NKRA 3TJHC 1DQDH 5MI0C 3FCTB 3FQXA 4NGHL 1X5LA 4H5SA 4KUZL 3MRIA 1Z0MA 1T7VA 2YUZA 1YECL 3DLQR 2VR9A 3HG1A 5I76B 5TPWL 5JPNA 2FSEA 3L3KB 4I77L 3QCUH 4ISVB 3EYFA 3SKJL 4DCQB 4L8DA 4Z7WA 1O5DT 5D1ZC 4PGCB 4PJDB 5FF6A 4TTGA 1A6VH 4HFWA 4AQOA 1X4XA 4MX7A 1MRDH 2AVGA 4OZ4A 5EO9B 1VFBB 2IAMB 4NN5C 2A74A 3QQ9D 3QULB 2ENSA 2WWMD 4Z7UE 3D0LB 4ONFL 4ODHL 4TSAL 3MOQA 2P8LB 4L4TB 2G9HB 4X6DF 1XF5B 3E8UH 4MA8L 4Z18A 1TZGL 4WU5A 2JJWA 5KG9B 3O9WD 2O61A 5TF1H 1UYWL 4GW4A 1K4DB 1VADA 5B3JF 4I48B 1CXKA 1X5XA 3NPSC 3DURA 2ITDB 3SE8H 1ZT1B 3U4EB 2ZSWB 3P4NA 4Q58C 3MUHL 2I60L 2YRPA 1DTUA 5DD1L 2ZUSA 4Y4KC 3AM8A 3MREA 4YHZL 3AXLB 1CT8A 4U1LA 4JM4L 5TE6L 4IRJC 5HHOE 2A9NL 3MUZ1 5LBSL 1JZ3A 2FYYA 4TQEH 5E7FA 5KANG 1AXTL 4JPIB 3D69A 3U48A 4LAJH 3O4OB 4JZJC 2R69L 4AL8L 4Y4FD 2BX5A 1D6VL 4WHDA 3NCFB 5F7NC 5ALCL 3ETBF 2BNRA 3JWOL 4GKZB 1B3JA 5IB3B 4BSWA 4M9PA 3UO1H 2R4SL 3LAFA 2AI0H 5DD3L 1I3GH 3RIFK 1EDQA 4G8FA 1N59B 4LASH 4IOSD 1B6DA 2GFBA 1EA9C 2JB6B 4KKAD 4PR5B 5EC1B 3NIDE 4LKXA 4G6AC 4AM0A 2B5IC 4X6CB 1ES0B 3BJLA 3DGGB 4N0CC 4Y5XC 3WFDL 5JIPA 5JXED 1AR2A 3V0WH 3MC0A 4LLYA 1MRFH 3MFFA 4R2GB 5KW9L 2GI7A 4DWHA 3VXMA 4XXDA 3OX8B 3Q6FA 1WBYA 1F6LL 1U58B 2BVEA 3NAAH 3HNTL 4OCRL 4PJFF 2NY1C 2FJFB 3QIBB 4OAWB 5EOCL 5A16A 1X9QA 5ANMB 3CD4A 3RP1A 2WNGA 4L8SC 3DBXA 4N0RA 3QCTH 4PGEA 3ARRA 4L8BA 4P46A 4QTIH 1MWAH 1XF4A 2OR9H 3UTPD 1MLCB 4U0RB 2GY5A 2VDKL 5B8CB 4IHOB 4HGWA 5ITBH 2R0ZH 5DK2B 3UTTE 1MJ8H 1OVZA 3VWJA 3RHWF 4U1MB 3ZDXF 2VC2L 5BRZA 2CDEB 4OGAD 4XVUC 3TM6A 4PRHE 3TV3H 4BZ2H 1KSRA 4ZODA 5JDSA 4Z77B 1AGEA 4MNHB 3V6ZB 4X9FA 1TLKA 4S2SA 3QNYA 3GM8A 2OTUA 3P73A 5T5NF 5DQDH 3NIDF 3C60D 3EAKA 2Q87A 4M7LT 1DVFD 3T0XA 4ZFZA 4WJ5A 3AS1A 2J8UB 3Q5TA 2BK8A 4MAYA 4UNUA 4F37F 4RMRA 4OLUL 4PJ9C 1BMGA 3CXHJ 4P3DA 4NZJA 3E6HA 4TVPE 2LAGB 5FV1L 2VZUA 5HDOA 5DJYB 1OPGL 3FT4A 5EUKB 5EBMA 4OM0H 4KHTH 3FO1B 2M8XA 1HWGB 5BS0B 2W0KA 3L3DA 4PJ7E 1IC4H 3HPJB 3SDAC 1D9KB 2Y07H 3MV7A 3ES6B 4I0PA 1P4IL 3P11H 1GZPA 5IESH 1J05B 1DLFL 1HSBB 1JZ2A 4P5TB 1AIFA 2ITCA 1QR4A 1QQDA 4JY4B 3UDWC 1W72L 2YRLA 4G8EA 2RIKA 3HI1A 4PJ5B 1JRHL 1RI8A 2AJUH 3F7VB 2DWEB 5AWNL 3WS6A 5BO1L 1XF3B 4IS6A 3WCYA 3CZFA 4JDVA 4NZDA 5C92A 3G6JA 4KDTC 4N90E 4OF5A 1FBIL 3G5XA 4QRQB 1A14L 4X6FB 5DMKB 3OJ2C 4UV7L 2J5LC 2XN9B 1YY8A 2VIRB 1E4KA 4PJHE 32C2B 3WNLA 4WENB 3IU3B 5T1DL 5LGJA 1RJYA 3SKMB 1JHTB 2OI9B 5J8OA 4XVTH 3GSNB 3MUGA 3UMTA 1NSNL 5F7EL 1WZKA 4FQXB 4EN3B 4LVNB 1NUGA 4M6AA 5ILTL 1J8KA 2DIAA 4Q9RH 3WL9B 3ARFD 3DO7A 4K3DH 2IALB 1U3HC 4Z9KB 5FDWA 5JW4Q 4HUNB 5ERWB 1NGXA 5ADOH 4PLJC 5CZKA 5IBUB 1MHHA 4LRIC 1SBBA 4X8XA 2AJXH 3FQWA 2NYYC 3BKML 1CL7L 2KL6A 5HGHA 3RWHB 3O4LE 5C0AE 1EV2E 3BPCB 4XC1L 1QSEB 2IAND 4M1DL 3KS0J 2IFFH 1TQBB 1P6FA 1WT5A 1QR1A 1QSFE 4NNXB 3WIIH 1XGRA 1VGKB 5ICXB 3AB0C 3RPIB 2NX5D 4MVBC 4Y16B 4XXCA 4H0IA 1R0AH 5SWQB 3GJFH 1CLZH 4XBPA 1PBYA 1QA9B 1EMTL 1CXEA 4F58L 2HKFH 3RIFF 1GOHA 4PJHF 3LN4A 3KLAA 2AEQL 4ALAL 3L9RB 1TJHH 4K7FA 4QHUB 3OXRB 1BQSA 5IQ9A 4J3OC 5DT1H 3HLAB 1PD6A 3LS4H 1OAZH 5T3XL 1WIPA 1NFIB 1GPOH 4OT1H 5I19L 3RZCA 4O2FA 2X4PB 1FZOA 3QDME 4KAQL 1N2RB 2PW2B 2XZCH 1DP0A 3ZHKA 4ZO9A 4P5MA 4KV5E 1BVLA 2NLJB 1NEZB 1HZHL 2VH5L 4UDUB 5I1AA 3JWDL 1IM9A 5FGBC 4PBXA 5D7JB 3M8OH 3VFWA 4BSJA 1VENA 4XRCA 3C09C 3QG6B 4O9HH 1IM3A 3HR5A 5IJVA 3V5DB 5F7DB 1FFNB 5KAQG 3B2UC 4YDKH 5D1ZA 1AC6A 3CUPB 5D7IE 1U2HA 4K2UH 4MNGB 1N7ML 3FO0L 4MNQD 4YPJA 4JFYB 1RJLA 5ISZE 4NN6B 4DN3H 4ENEC 5AZ2H 4LQFL 3PNWB 3QDGA 4NRZA 1Q94B 3BSZL 1J0ZA 2QSVA 4HIIA 1DBJH 4NBYB 5DURB 3BVNA 2LABA 5LXGH 4OKVA 3VE0A 4Q9QH 1CICC 2FCBA 3KG5A 4XX1E 1CG9B 3BW9A 2APFA 5D96B 3UBXB 3O0RH 1MFAH 3M1BB 3CXDL 3DX7B 4ZAKB 4APQD 2DQDL 3S88H 4NBXB 3EYOA 1QVOA 3MLTB 1KYOK 2BNRE 5JOFB 3BQUD 4Y4KA 3VG9B 5BQ7A 4WO4D 2A0LC 2CJUL 4YX2H 3FO9B 4H26B 1YEEL 3BHBA 5EZLB 1N5AA 1QEWB 1DQQB 3BAEL 3P3YA 1H3PL 2GHWB 4Y2DD 5T1KD 1AQKH 3TBYB 4LHUB 5ETUB 2CO6B 4HIEB 4M7KL 4M6ML 3CMOH 3FB8A 2OK0H 3WXVL 4WHTA 4FS0A 4JZJA 4PY8I 3VXUD 3KYMA 1ZKAA 3FB5A 5E7BA 2H32B 2P5WA 4P57A 5KSAB 2XPGA 3QWQB 2Q6WB 3LY6A 5I1GH 3C2AL 1DBAL 4HS3B 4OFYD 4X0KB 5JR1L 3MRNA 3B83A 1PG7W 3NCJH 2IG2L 3WIHH 4LLQA 2YD3A 4KQ3L 5D1XD 3RVVC 4WWKD 3S96B 1AR1C 2HH0H 4WHYG 1GIGL 4Y5XA 5HYJD 5DVKA 5BZWB 1MHPL 4QXGH 1DDHB 4LHQB 1OGAE 2OP4L 5IP4A 5DJ8B 1V7ML 3RWEA 3VXPA 1OP3K 3ARBB 4WHYH 1NFDE 3QUYC 3R8QA 2ZG1A 4O02L 1RK0B 1HSAB 3GSOA 4JN2B 4LBEA 5IEHA 1R5WB 2E6JA 2ADIA 3QRGH 1T22A 4K7PH 4YIQA 4L8SA 1U8IB 2DF3A 3ZL4H 2WWKT 1QG3A 1ZEAH 4XBEL 4OF6A 1MFBL 3L3GB 2AKRA 1PQZB 3Q5OA 2EO9A 2MTPA 3RUGB 2Q20A 4MA3A 3DSFH 1F13A 2W60B 2HT2D 1T0PB 2HWZH 4M6OL 5I71C 3NMEA 4XCCL 4D3CL 3OJMB 3KWWB 1MHEA 1PG7L 1IFHL 1KN2H 3P9LA 5FECA 2DQUH 5F89B 1C7TA 1FH5L 4OZGB 2BOCA 3QUZC 1FVCA 3S36X 3BWAA 3DIFA 4TRPH 4DFHA 1NC4A 4PJEA 3WEXB 3LEVH 5GJSL 1BBDL 2QADC 3B9VA 4FZEH 3AVEA 1KTDB 1B0RA 4HKXA 2QQKH 4GUPB 3BPLB 1JZ7A 1I7TA 4TSBH 5KJRL 3AREB 2Q8AH 4HS8L 4KMLB 1CR9L 4PJ9A 1J8HA 2VLKD 3TZVC 2Y5TB 4UILH 1XEDA 5MEOA 1YYMH 5H2BA 2X4RA 1NFDF 4Z5RB 2WBWB 3ARTA 4NZUH 5IQ7L 1VACB 4GG6E 2W91A 2X4OA 3GSUA 5D8JL 2XKNA 4LPTA 1H3VA 4MA1B 2DQHH 3SDAA 3WFBL 2ZOKA 2NXZB 3TBVB 4ZFGH 3SDCC 4YHOL 1GHFL 4NOFA 1KGCE 4JLRA 4MD5B 1CFSB 4QYOB 4P4RB 5DC9B 1DN2A 3HMXL 3UDWA 4HHAA 1A64A 4DFIA 4XH2B 1KIUA 2XZQL 1O7SA 1QPXA 2FEEI 4NO0D 5ESQB 5C07B 2J7LA 5FKAB 3QUKA 3CH1B 3GK8L 1KCLA 5DUMH 4PJCE 5HGAA 3H7LA 3QEGL 4P2RD 4MQSB 3DMMB 4U7KA 4KDTA 2BVQA 2FB4L 2DTML 2VABA 4Y4HC 1MREL 2D03L 4KC3B 5HDLA 4ZNEA 4BELD 5TDPA 5I1CH 4HZLB 2YXMA 5K33A 1TPXC 5AD0A 2H6PA 3B2VH 3REVB 4R26L 3VXRB 2IEPA 4PJ8D 4YZFF 5DJXA 4YO0A 5E9DB 4PD4K 3ULVE 1SM3L 2I25N 2VAAB 1WBXA 2BMKB 4Y1AD 1ONQB 4TYUA 4CDGC 3DX9A 1U3HA 4IMLB 1ZLUH 4GG6F 3T3ME 1Z2KA 4TUJA 4LHJB 3QEQB 5D7LA 4CVXB 4U7SA 4LRIA 4P9HC 3Q3GB 5TDNB 1RZGA 3P0YL 2FGWH 2BFVH 4EI6A 4RIRA 1J0YA 2DDQH 2VDRL 5D93B 4GXVH 3IFNH 2RAMA 1YNLH 2XWTA 3VXTB 1P2CB 2VXUH 5I8KH 1S7UA 4TNWK 5L2KD 4KKCC 3TBWB 1AD0A 1QLRB 2VR5A 4PJCF 7FABL 1XGUB 1N0XL 3C8KA 3W9EA 2CIIB 4DGYL 2IAMC 2W0LA 4G7VH 4DEPC 5T33H 1HH6A 1M7IA 4NYLB 3MNZA 4LF3A 1P5VA 4YXKL 1KFAL 2VTFA 1T5XB 4K3JH 5T3ZD 3NCEB 2V9TA 3BX7C 1Q9WA 1HQ4A 1S7VB 3IDJB 5F9OH 3GSQA 2ARJA 4MAUH 4NC2B 3VXSA 4AYFA 2X1PA 2OTPA 1E4XH 5JHDA 3FTGA 4GRLB 5E2WL 5EU6B 3WD5H 1TVHA 1RIHH 3VI4F 3TLRA 2GK0B 4FQPA 1FNFA 5C2BL 5LKNA 4KJYB 2AXGB 3QEUA 3ULVF 4E0RB 5GRJH 4QKXB 3LDBB 5L6YH 2YWYA 2J4WL 3NZ8B 4HT1H 3NTCL 4TVPL 5EUOB 1P1ZA 1MWAA 2X9XA 1AH1A 3T3MF 5C0BE 2HP4A 5C3TA 5J6GB 1A7NL 4RGOL 3I2CL 2BC4B 1KJVB 4TSCH 1IQWH 1I4FB 4HV8B 1RZIB 3GSNH 3DVGB 4Z7OE 2R0LL 1EBPA 2DQGH 2HT4D 4BQCA 5BVJA 5FGBA 5HI4C 3HN3A 4L9LC 5BV7C 2LE9A 2EC9T 2GITB 3FB6B 4FQIH 4ZFFB 4L3AA 2VSCA 5IBUG 5KVDH 1T3FB 1CIUA 1H8NA 4NQCB 3SDXE 5ESAA 1S9YB 4JM2B 3O4OC 3TFKD 2BRQA 1V7NH 1C12A 1AI1L 3QO0A 4W81A 2ICWB 5HJ3B 1NCDH 1FVDB 4OSUH 5TDOA 5JNYA 1IAII 4RCAA 2JJSC 5EB9A 3QAZC 1T80A 1OAKL 5C8JB 2X5PA 1U8NB 3WNKA 5MEQB 1XGPB 2XWJA 3PL6B 2VDMH 4U6HB 3U0PB 3HNVL 4N1EA 3DXAA 4MWFB 5HHVH 3MLWL 3SO5A 3RL2B 4NP4H 3MBED 2PTUA 5FYKH 4NZRL 2YMXL 5FIEA 5CJXC 1RIVL 5K9JL 4R2GC 3O3BB 1FDLL 2BP3A 1H3TA 4JVUA 1OL0A 1D5XB 3ZYJA 3L3OB 4JE4B 4Z7OF 1TDQA 1OB1B 3QIBC 4S1SL 1IC1A 1A3LL 3WKMH 4XGZB 3STZB 2IPTL 5E94A 2WQ8A 3UJJH 1JHKL 1NEZG 3NA4A 1QTYT 4HWBA 1U9KA 3SDXF 4LDOB 4U0RC 3IKKA 2VDLL 1BBJA 1INQA 1TJIL 5ACZA 5B8CC 1OWWA 1ETZB 2FEDC 3I02A 3O45A 5T1LD 1HDMA 1U92A 5I18H 4NHUA 1BD2A 1ADQH 4B7LA 1FV1A 3KPLB 1SJHB 3D39E 1QFHA 3L5WA 3HUJE 5FEBA 4PJGA 4QOKA 2A1WH 3O3AA 3EIFA 4P23D 2J6EA 1FNAA 4F9PC 3GSXA 5CIPA 1CE1L 3PWVA 2PYEA 2VWEE 3C5SB 4QXTB 1AY1L 1Z9SA 2LAAA 3LKOB 1AJ7L 2P24A 4KTYA 2AK4A 3JTTA 4H20L 2MQ3A 1T2JA 4JFHE 3PJSB 3U7YL 1K2DA 3BZ4A 2BRRL 4W6WB 3HR6A 1A1MB 2IH3A 2XKSA 2XG4A 1FGNH 1UACL 4KJQC 5GIRB 2AEPL 3QUYA 2JIXB 3QHZH 5D6CA 5GGSA 4I0KA 4JFEA 2NXYD 3UBXG 4JO3L 1HNGA 1MJJA 3B9AA 4YC2B 3RWDB 5DD5H 2ZOLB 2Y6SC 1A9EA 1D9KC 4Y19A 1T1WB 5C9JB 2J88H 4LCWA 5C0JB 4P5TC 1MRCL 3TO4D 5CLTA 3T2QA 2RFXB 2Z31D 1I1AC 2O93L 2GSGB 4TNWF 5A2IH 4S11A 3V7AE 3GB7B 4G42A 1B4RA 5SWZA 1IGFH 5DJAA 5GS3A 4LHUG 3BKJL 4U1SA 3BT2H 3MA7B 1FVEB 3HUJF 4G5ZL 1JPTH 2VRAA 1A6WL 4JFPA 2ZCKH 5B4MD 2XNAB 1KJMB 3BP6A 4PGBB 1JFQL 1N5YH 2OI9C 1U93B 1RULH 1IGCL 3SQBA 2E3VA 4M03A 1UFUA 3ARDB 4F9LC 2H32H 3G6DL 4JRYE 3PWPA 4EN3C 3B3IA 3O2VL 5GISH 4H0HB 2L4OA 4LVNC 4HS6B 1QFWL 3TZVA 4UU9A 3CSGA 5I9QC 3V0VA 2DYPA 4HUVA 4NWUL 2IPUG 1M7DB 3U7WL 1HHKA 1QO3B 1UM6H 3C60B 3VMNA 1SEQH 1DVFB 1JWSA 3CFDA 1I7UA 5CHNB 1FYTD 1LNUB 3SDCA 2R4RL 2P5ED 3QQ4A 4PJXA 4ZSOA 2F74B 1U8JB 2Z92B 4Z7NF 4NPYB 5BJTB 1SVCP 4XP4H 3BE1H 4KXZI 3KXFD 2D2OA 3C5ZD 3ELAT 3SOBH 2R1YB 4MXQD 1NGYB 2DQTH 1YPZA 3CX5J 3L3HB 1YJDH 2R0KL 1VSCA 4Y4HA 3MRDB 4HIJB 3VDBA 5DRNB 3CFBB 5EU4B 2AV7A 4JFXA 1DN0B 2X9WA 4LSSH 4ZNCD 1NMBL 3QJFA 3KPRD 4WTZG 1UM4L 4G8IB 1KLGA 4QTHB 1BVKA 4IDJH 4IIQC 4QT5B 1S9WB 1EUUA 3OXSA 2D7MA 5FXCH 1S9VB 1S5IH 4Z8FH 2ZKHH 4M4RA 4D0DA 5EFIB 2GJZB 5C0ND 3MRQB 1J0HA 5EU7E 1LEGB 4I5BA 3QA3B 1A7QH 4BFGA 1J0IA 5F3HB 4DZBB 2B4CC 4A2MA 3FONA 1MELA 5T1MB 3FCTA 3H42L 4JY5L 3VFTB 5CSZB 1J1OH 3O8XC 4W4OA 4PB0H 4IOIB 3LPFA 3L3JB 3O6FB 3VDAA 5CINL 3L3KA 1F3JB 3LHPH 4ISVA 4DCQA 3J8F7 5CEXB 3Q6GH 4PGCA 4PJDA 3D2UB 3WIHA 5K9OB 2ZCLH 2FX9L 1CE6B 2VUYA 4AH2B 3SDDD 2B2XH 1VFBA 2IAMA 3FT3B 3FZUD 5JZ7D 3QULA 2DLFL 3ZE1F 4NN6C 4NJAH 3GM0A 3D0LA 4V2BA 3O2WL 4L4TA 1FIEA 1ZTXH 2G9HA 2EKSB 3T3PE 4LDEB 5C0CA 1NCBH 5DS8B 5TFSL 4PRIE 5KG9A 4AT6B 2X44D 2I07B 3LKPA 5HI3D 3V52H 2CIKB 5DA4A 4JZNB 4AEIH 2NX5B 1K4DA 2EDWA 1LE9B 4I48A 2B1HL 3UYOD 3BFOA 1U8HB 1WZLA 4PRAB 5E99H 2B8OT 2ITDA 3U4EA 5LGKA 2RCSH 2ZSWA 4ZAKC 4H8WH 1JGVH 3FMGL 4YHPB 2DLGA 4RMUA 2BSSB 1D6EB 2KH2B 2NY5L 1HI6B 1P84J 1C5DB 2YA1A 3T0WA 3RWCB 4KK9C 4RAUB 2DJUA 3QG7L 3AXLA 1X4ZA 2R23B 1RURH 4ZPTB 2ORBL 3U9PL 4L9LA 1A6ZB 2P45B 1D3CA 2FWOA 4MCZA 3ZYOA 3HNSH 1KCRL 3UJIH 1DFBH 1KC5L 2YPLB 3QR2A 3ZT7A 1FZMB 3VFGL 4NWTL 4XPHL 5I1DB 5EO1B 4PS4H 1DBKH 3NFSH 4GKZA 1TQCB 2JJSA 3QDMD 5KSAC 1XGYL 1E6JH 5IB3A 5HVGB 2EH7H 5IVOA 4BUGA 1WWWX 4U6VH 1F3RB 3LRHA 2BDNH 4PY7B 1MJUH 1DCLA 3L3IB 1N59A 2D3VA 4AQ1B 4JHWL 3T3PF 3EYVB 5F21B 3T4YB 3H9SD 3HS0B 5HPMB 5JPMB 4FQJH 2E27L 3C2SA 1ES0A 3NCCB 3T04D 3DGGA 1JI2A 3KNBB 5KSBE 4LCYB 3KJ6H 2A73B 4G8GE 4JFFD 4PV8B 4JO2H 4UB0H 5CJXA 3ULVL 4GQ9L 1FAIL 4MNQB 4OCWL 5B39B 3MCKB 3OX8A 5CKGA 1P6AB 1KJ2B 2AJZB 5EA0H 1FG9C 1U58A 5TQ0L 3LMJL 3BDYH 2VISB 3V5HB 4KJWC 2FJFA 3QIBA 5ISZD 4OB5L 3PDDA 5ANMA 1Y6MR 3TJEH 5E2TL 1KTKE 4XNZB 3ESUF 1KUMA 1L7TH 4WUUB 1IAOB 3ZSSA 1MLCA 3MZGB 5B8CA 2EDDA 2VLRB 4IHOA 5DJDB 43C9B 3VDCA 4YHML 1DUYA 4FP8H 3RAJL 1MEXH 5GS1B 4ZD3L 4LPWA 2R8SH 4OF8A 5HYEA 3BQUB 1ZGLA 1A47A 4BFEA 3RWGB 3TGXA 4WFEE 4Z77A 4MNHA 3WLBB 3V6ZA 4PGZA 4Z0BL 4X4ME 1S9XB 5I66B 1I8IB 3S35X 4Y2DB 3NA9H 4U05A 5T1KB 2ENYA 5D5ME 1IAMA 3HC3H 3NVQA 4RA3A 4F9PA 3ULUC 3LPGA 1MI5D 1E6OL 1EHLH 2VLJB 3BPLC 3AREC 4XAWH 3MLSL 1FSKB 2C4FU 5KSBF 3VXUB 4JG1L 1BJ8A 4MJ5B 4LLMB 5GZOD 1XGTB 4V1DB 1A1NA 5SX4I 5D2LE 2BCKB 3JV5A 3HAEB 5DJYA 3PP4H 1X7QB 5IT2H 5FUZH 2DD8L 1FGVH 2MCG1 4P3WA 3FO1A 5EIIB 5BS0A 1T04B 3VGBA 5E1AB 3QZWB 4MA1C 1DEEB 3P4LA 4MLSA 3HPJA 5JXAL 1D9KA 4LGPB 4KKBC 1LP9E 1UA6H 2NXZC 3ES6A 3T0DA 1QFUL 3A67L 1J05A 1HSBA 4HUMB 4P5TA 4XT1C 5DLML 4OCXH 4OCYH 4JY4A 3K81A 1I1AA 1UEMA 2WQRA 4EDWL 3RVUC 1N26A 3IT8D 4OLZL 3UTSE 2AJSL 25C8L 4PJ5A 3DROA 5CEZD 3SY0B 3PDOB 3T1WA 2NR6C 2DWEA 3D18B 1F4YH 4E9LA 4LSTH 3QIUB 4NRXB 3DMMC 1A7PL 2CGRH 4QRQA 4X4ZA 4X6FA 3TYGH 3MV8B 5DUBB 2B20A 1UEYA 2XN9A 2VIRA 5DTFB 32C2A 4K3EL 2B0SH 2AGJH 5D5MF 3IU3A 3P4MA 3WDIA 4ZQKA 3GRWA 5HY9B 2VDPH 3GSNA 1FFPB 3EO1A 3NBNA 1VEMA 4OTXL 1I1CA 1IC5H 4NFCA 4YHKH 4NQVB 1KJ3H 4ERSH 4F9LA 5DSCB 4EN3A 5LGHL 1QLEH 4M1CD 3TBSB 5D2LF 3EDFA 4LLWA 4X6BB 5IKCB 2LU7A 3WL9A 4RISL 3PQYE 4JGUA 2IALA 3LV3B 4EIGB 2P46B 4JGJA 5ALBH 1MFCH 1YNKH 5ERWA 1U8QB 5D7KE 2F54D 4Q0XH 5IVXB 2AQ3A 4P5KB 4NNYB 3RWHA 5IB1A 1FC2D 4JKWA 4QRRE 1F2XK 3JV4A 4PV9B 3QIWD 3VFVB 3EYQD 2DQIL 5D2NB 1KELH 3GJEB 2YUWA 1VGKA 2KKQA 5ICXA 3HHRB 4TN9A 1UT9A 3HZMB 3PHQB 4NDMA 1AE6L 5SWQA 4OGYH 3LKSA 4LSQL 3QHFH 1QA9A 2V2WB 2EKJA 5ADPL 1JPSH 3THMH 2O5YL 4BFBD 4EBQH 2XI9A 4X9IA 1NBVL 5F7HA 4QHUA 4O00A 2HFEB 3TA3C 3QH3B 4PG9B 3WMSA 4NO0B 3JV6A 1KGCD 3HLAA 4LEXL 3MR9B 4ODBD 2EE3A 4K23L 3LDBC 3PHSA 4YE4H 1PSKL 4P2RB 3OAZK 2X89D 2X4PA 1K8DB 3J7HA 3MO1A 1N2RA 5EZOH 2PW2A 1OAUH 3ZKQD 1B4JH 1UH4A 2D7OA 2FRGP 2P43B 1ZANL 2VXVL 1SYSB 2NLJA 1NEZA 4PLOB 4UV4L 4UDUA 4KK8C 4UOW0 3ZTJG 1IGML 5GGSY 2WK2A 4PJ8B 2EDYA 3GHEH 4WFHD 5CJQH 1WFNA 4X7TB 1JTPA 2DKSA 3O8XA 2X10A 3QG6A 1G7PB 4QHNB 5GS0L 3MOBH 3E2HB 4NT6B 2R2BB 4EIZC 4C57C 1T2QL 3ZTJH 5F7DA 1FFNA 3DECA 1DQDL 2C1PB 1JZ6A 4DKFL 1Z3GH 4MNGA 4JFYA 1UJ3B 1G9ML 3BO8B 2HFGH 2Z8VC 1ZA6B 1P9MC 3QCUL 3U2SB 1OM3L 3MRJB 4DQOH 3PL6C 4JAMB 3LZFH 1A6VL 4HWZB 5HPOA 4NQDD 3WO3B 3V7MA 1MRDL 3OSKA 4WW2B 3H9HB 4WV1C 2R15A 1KULA 2Z93B 4G3YH 4XCYA 2VLMD 3FO2B 4NBZB 5EDXA 2EXWD 5F1IA 3SGEH 3M1BA 3GHBH 1LGVA 4ODSH 2F58H 2I9LA 3DX7A 3E8UL 4ZAKA 4POZD 3MLTA 3OKMB 4X7CC 5TF1L 1UKTA 2Y36H 5JOFA 5CD5D 5DGQA 1AGFB 3FFCD 3DUHA 4H26A 4L3ED 5E00B 5EZLA 1QEWA 1DQQA 3QBTB 4ZS6C 4BQ9A 4Q97A 4Z95H 4XNQB 4YDVB 1I9EA 3TBYA 4X6CE 4LHUA 4HIEA 3SCMC 5HD8C 5BZDB 3JWNC 3B9KB 1C5BH 2GUOB 1UG9A 2XXMB 3QT2A 2H32A 5D72H 2JJVA 2F8VA 5KSAA 3MFGB 3QSKB 3KVQA 2Q6WA 2DRUA 5TPWH 4HS3A 4HJJH 4I77H 1DZBA 1HHIB 3SKJH 4X0KA 2P4AB 4KI5E 5GZND 2E9JA 3VXOB 1W0YT 4KROC 2UUDK 4WI5A 4OLYH 3S96A 2YHGA 2R9HD 5DVMA 1WCBB 3UO1L 1BX2B 5BZWA 2AI0L 2G5RA 1I3GL 1D5ZB 3RGVB 1DDHA 4MJIE 2OXGA 5CKAA 3SBWC 3B5GA 4LASL 5FYJE 1G9NH 15C8H 4ODHH 3CFEB 4KI1A 3V4VH 4NRYB 1T6WA 4Y8DC 1YYLH 4UI2A 1KEMH 3C8HA 1TZGH 1RK0A 1UCBH 1HSAA 4JN2A 4LIQH 1G6RB 5IJKC 1UH2A 1R5WA 4YC2C 1OP9A 1H3WM 4FABH 1MRFL 1U8IA 5MEND 5CGMA 3U4BH 5HHPB 3EDDA 3T8XB 3MBEB 2F5AL 1UZ6E 4NO5A 3NAAL 4DVRH 4D94A 4KFZC 2GAZB 3U30B 2BSED 3BGFB 1AXIB 2J8UE 3DJ9A 1PQZA 1RJZB 1AGBB 3RUGA 4OQ1A 1VFMA 1P7KB 4LOUC 3KYNB 2KZ1B 4Z7WF 1QYGH 2A9NH 3DX8A 3KWWA 3QFJE 4QTIL 3P40A 4M7LH 4OCSH 5D6DC 4F7PB 5F89A 1IL1B 1MF2L 2C3WA 2EIDA 4N8VB 1PJ9A 1DL7L 4Z7UB 3VXNB 5C0IB 2R0ZL 4HX1B 3WEXA 3ARWA 1T1XB 1MJ8L 5F1KC 4KI5F 4AL8H 4KJPD 3MV9E 1KTDA 2ESVD 4R4FL 1QFWM 2H45A 4WIQA 5AAWA 3JWOH 4GUPA 3TV3L 5T1LB 4BZ2L 1U41A 3AREA 3BPNB 3ARDC 1U8PB 4DK3A 2R4SH 3IGAB 5DQDL 1MVFA 3CAFA 1B90A 1Z9OA 3N85H 4Z5RA 3ZHLA 2X1OA 4CL7A 4RQQB 1VACA 4MXWH 1WVZA 4PJFB 3X12B 3JV0A 1CFQB 5B39G 5ITFB 4N8PA 2FO4A 4ELKA 5H94B 4JO1H 5KW9H 3MRKB 1UZ6F 1V3LA 2C3XA 4U4BA 4MD5A 1CFSA 4QYOA 4P4RA 4LPXA 1TVBB 4OV5B 1UWXH 2G60H 4OCRH 1KJ2H 4HCRL 4XH2A 1Y18B 1BQUA 1ZOXA 2F8XC 5C07A 1F4AA 2Y07L 2NY3D 4JFHD 5FKAA 1CVRA 3CH1A 3DETD 5FO7B 1TENA 5IESL 5SWSD 2ZUXA 2Z8WC 3DMMA 3LRSA 5EC2B 1EHAA 4GMTH 5KVGH 2VDKH 2R0WL 3C6LC 3NACH 2AJUL 3TO4B 4YEEA 8FABB 4MQXC 1NAMA 5EOQH 3T0VA 3REVA 3KHOA 3T0EE 3VXRA 2VC2H 5I0DA 1QSEE 4P2OD 1DLHB 5E9DA 4KRMB 1I8MB 2DKUA 1FHGA 2VAAA 2BMKA 2Q3ZA 3CFIC 4ZOEA 1ONQA 5IFJB 3UX9B 3VCLB 5I17B 4IMLA 4XVTL 3QFDB 1WC7B 1LE5B 3QEQA 1HN1A 2P7TB 5C08E 4QHMB 3L7FB 4IEFB 4CVXA 1R5IB 3HAEG 4OLUH 3NFNA 2FLBT 3WNNA 4Q9RL 4K3DL 3Q3GA 5TDNA 3ABZA 1OPGH 3QZWG 4IRSD 1CQYA 2FEEL 3HAEH 4J4PC 1FIGH 5IEKB 3O6FC 3SGDI 1NGPH 3VXTA 1P2CA 3HPLB 2FATH 4PG2C 3RGHA 1GRWA 4WRLA 4JRYD 2IH1B 3TBWA 1QLRA 1NCAH 2IPUK 1VKXB 1H15B 1DLFH 2CIIA 4J3XA 5DXWA 1R3JB 2ZNXA 2DQFB 3WIIL 4ZTPL 3TYFB 1T5XA 1JF1B 4RMQA 5B38A 1B0GA 1JRHH 1PZUB 3MJ8B 5DMGD 1S7VA 2OR7A 3IDJA 1R0AL 1I1YB 2O5XL 4OUUA 3LQAH 4K8RD 3TA3A 3IJYB 1CLZL 4FTVD 3RNQB 4GRLA 5EU6A 4F7CA 5E5MB 2FLRT 2H26A 2GK0A 3KR3H 4KJYA 2AXGA 4UV7H 1A02N 4E0RA 4K9EL 3KXFB 1FLTX 5C6TH 2PTTB 3NZ8A 3MQIA 4GRMB 1KPRB 1MCRA 4XCNB 5EU3B 5J6GA 2F19H 2WBJD 2BC4A 1KJVA 3ECBB 3LS4L 1I4FA 4HV8A 1RZIA 1JN6A 1RD6A 4XPFL 4YEFA 5IIEA 2D31B 2CRIA 5C0GB 1GPOL 4OT1L 1ZT4B 3OB0H 1CS6A 5ILTH 5A3IC 4XNUH 1ORQB 2GITA 3FB6A 4H0GA 4Z76B 2XZCL 1GAFH 5LG1A 2AABH 3RKDD 1KB5B 1T3FA 3AAZB 1YN6A 4NQCA 3BWUC 3OKOB 2GIYA 4DKDC 3IDNB 1S9YA 5GGVH 1F5WA 4JM2A 4JO4H 3IDUA 1Z9MA 3M8OL 5J6HB 2ICWA 4RZCB 4QWWC 3BKMH 1CL7H 3JWOC 4R4ND 1FVDA 4O9HL 2FBOJ 1TQCC 4PREB 3K0WA 2YD7A 2HRLA 5KVEH 1P9MA 3G6JF 4XWOD 2YBRB 5C8JA 1U8NA 4PJHB 3VD4A 4YDKL 3PL6A 3BEWB 4U6HA 5FB8B 1HXMB 3U0PA 5JOPD 1K85A 3W5MA 1YMMD 4MWFA 3RL2A 1EMTH 1R3KB 2VR4A 2AEQH 4ALAH 3ARGB 3OKNA 3O3BA 1DBJL 3IFOB 3IXTB 5LXGL 5E24E 2MHAA 1D5XA 3WNPA 3DTXB 5FM8A 1I3RA 3M07A 3CFCH 3FRPA 3O0RL 1MFAL 4PYHA 4FQCL 5I19H 4XGZA 5C0AB 3STZA 3S3PA 5JOEA 1H0DB 3S88L 4KAQH 1QSFB 3SCMA 1ETZA 1HZHH 1TCRA 4YX2L 5KOVC 5J9PA 1S7XA 4MZ2A 4NKDB 1F45A 3CGTA 2JK5A 2ED7A 3KPLA 4O58H 1SJHA 3Q1SH 4OI7A 4RSVA 1QRKA 3L5IA 3SEPA 1MCHA 3CPLA 1OARH 2OK0L 4PP1C 1X4YA 4YNYA 2BHUA 1UXWB 4U6XB 2BNQE 1PKQE 4CMMB 4Y2DC 2HJFB 3NGBB 5DQ9A 3QUXD 2CLVB 3STLB 2X70B 4QXTA 3LKOA 5HYSA 1CGUA 2AV1A 1FSKC 4KQ4L 4CU8A 4NCC2 3PJSA 1RSFA 4AIOA 1X5FA 4L1HA 5TE7H 3SBWA 1FLRH 5IM7A 3NCJL 1E27B 3QDMB 3G5VB 5IW1A 5HGDB 2PO6C 5GIRA 2EXYC 1CTNA 3K3QA 4YK4B 2JIXA 2HH0L 3V6OE 4OZGE 4IRZH 3RWDA 2ZOLA 1DQJB 5DVNA 1T1WA 1GXEA 5C9JA 2DI9A 2LQRA 2BXZA 5B22A 3CIQA 5I8CB 2RFXA 2DQDH 3GMPA 1RZJH 4JHZA 4HMCA 2GSGA 1AO7D 5FHAH 5C86A 3QRGL 4K7PL 5T3ZH 2FJGB 4X83A 3GB7A 3SDYL 4G8GD 5FAAA 3ZL4L 1ZEAL 2M2DA 5D6DA 5HBBA 3QIUC 3BAEH 3MA7A 4PTUB 4G9FA 5ISZB 1FVEA 3OAYH 2Y7QA 4HXAH 4M7KH 3DSFL 3MRGB 5E4EB 2UYLA 1MCWM 1KACB 2XNAA 3C8DA 3MNWB 3N50A 1CD1B 1KJMA 4UT9H 5FUCC 1JJUA 4PGBA 2Z35A 2QQLH 1PZ5B 4LQ1A 1G0DA 2HT2C 3ARDA 2NY6C 4TRPL 2RQ8A 4JQVC 4HS6A 2QSCH 4FZEL 5H35B 1VFUA 4G6MH 2H41A 1T4KB 2QQKL 4KVNH 4M8QA 4TSBL 1M7DA 2Q8AL 2WP3O 1T1ZB 4UILL 1DVFA 3U0WL 5CHNA 5BW7C 1LNUA 4NZUL 3WNMA 3TBTB 3TNMB 5GSVB 1U8JA 3CLFH 5GGQH 2Z92A 1G6RH 2EIBA 3AROA 4NPYA 4ZFGL 5BJTA 4ODTL 2XXCB 4P9MH 3W0WD 4D8PB 2V7NB 3IAQA 1AC0A 3GMOA 5EOTB 4ONGH 1M7XA 5LWYH 1JV5B 3MRCA 5JA8B 2BVPB 4W6XB 4AIZA 3BH8B 2R39A 3C6LA 3MRDA 4HIJA 5DRNA 3CFBA 5EU4A 4WFGE 5CJ5A 4N8VG 4O2EB 5E2UH 4D3CH 1RAMA 4G8IA 1HINL 5MHSE 2JKXA 3EFDL 5J13B 4JFDE 1OGAB 4J6RH 1S9WA 4J3UA 5I1CL 1BBDH 1MOEA 1NFDB 3QWRD 1WBZB 3B2VL 1EEUA 5EFIA 3TP4A 1JGDB 2GJZA 3MRQA 1GGCH 5F7KC 4P49A 3U1SL 3QA3A 3PGDB 5M95B 1C16B 1XFPA 3JWDC 1CR9H 5F3HA 4DZBA 3ZKNC 3G6AB 1A6UH 1T83C 5T1MA 4JY6B 4PRPE 1JTOA 5CSZA 4DOHE 1TNMA 3KPTA 3F7YA 3WHXA 4IOIA 3UTQB 5IQ7H 4J4PA 3E2HC 3L3JA 1CXIA 3O6FA 2HLFC 1F4HA 1CQKA 4PG2A 5L88L 2BERA 5CEXA 1INDL 3D2UA 1Q0XH 1FFOB 5F7FA 4M7JH 5EUOE 2YXFA 2A6DB 1CE6A 2FGWL 2XA8L 3IKCA 4RMTA 5E1HB 4EEEA 1M05A 4AH2A 2DDQL 3PQYD 3N06B 2F54B 2FH8A 4R4BB 3FT3A 4GXVL 3IFNL 1U42A 5C1MB 1L0XA 1YNLL 1PFCA 2EDTA 2VXUL 5I8KL 4LEOB 2XZQH 3BP7A 4DTGH 2CUIA 4QRUA 2M1KA 3KPSA 2V9QA 4PJEF 2EKSA 1S3KH 3QIWB 4WW2C 5I8OH 5DS8A 1T0MB 4G7VL 5T33L 1V3JA 1DBMH 5CJ8A 5T5NG 2JLLA 2NY0D 4AT6A 2I07A 3NN8A 1EJ6A 4R3SB 3R1GL 2CIKA 3MCG1 2FB4H 2NX5A 1T0NB 2DTMH 3BGMB 1LE9A 3QJHB 2D03H 5F9OL 4PRAA 1WFUA 4YHIB 3SKNB 1E4XL 1HKFA 2ED8A 3QI9B 4GG6B 4YHPA 5FDYA 2BSSA 1RIHL 3DUUB 1D6EA 4RDQF 1HI6A 1C5DA 3B5TA 3RWCA 5HI5C 1N8ZA 5AZEH 5GRJL 4RAUA 4N5UA 2R23A 2YZ8A 1A1OB 1A6AB 1SM3H 4ZPTA 4IMKC 1A6ZA 5BCAA 4JCMA 1ZLWH 3CC5B 4Z0XB 2E6QA 2AJVL 4FZ8H 1A9BB 3B4NA 1I3VA 4OBRA 4ZXBC 4ZG1A 2YPLA 2DM7A 5DZNA 3NCBB 4LCUB 4XI5C 4G80B 1FZMA 2DQGL 3MJ9H 4ZFOL 3B9KC 4PJCB 2XG5A 4FQIL 5I1DA 3GIZL 4ZUVB 1KIRA 5EO1A 5KVDL 3SJVE 3HRZB 3RRQA 1NEUA 3MJ6A 2VXQL 1B6UA 5HHMD 3DARA 1JWMB 4M02A 1V7NL 4Q7DA 4PY7A 1C1EL 4HH9B 4M5ZL 3L3IA 5DJ6B 1NCDL 2V7HB 2FHBA 4OSUL 3EYVA 7FABH 1N0XH 3T4YA 3HS0A 1U36A 2C4XA 4K55A 3MLUH 2WLZA 1IRAY 2NY7H 3KNBA 2FECL 4LCYA 3RGVC 4PV8A 4OFVA 2VDML 1N6UA 4AY0A 4MNQA 2W65B 1NDMA 3IFLH 5B39A 3MCKA 1JZ4A 2AJZA 4MQTB 2Q3AA 4JDTH 4NP4L 2YD4A 4IDLA 3P4OB 3WO4B 2VISA 1BF2A 3V5HA 5FYKL 2CXGA 4NQDB 3VFUB 3T2NH 1KG0B 2KDGA 4G6FD 3BZFA 4TVPH 1ZT7B 4JDZB 4O5LL 3BRFA 3U30C 1FNHA 1WISA 3JBG7 4WUUA 1IAOA 1A7NH 3I2CH 5I6XB 3PHOB 4RFEB 2VLRA 4U1GC 5DJDA 5IFHH 43C9A 3IJHB 1A0QL 3OPZH 4N68A 2VZVA 3MRLB 3UJJL 4NQEA 1JPFB 3HZYB 1U3ZA 2OX5A 1GZQA 2Y9RT 1HK6A 1KB5H 4KTDH 1S9XA 1XF2B 1AI1H 1UB6A 1I8IA 3G04A 4Y2DA 5C3LD 5DA0B 5I1EL 1ADQL 2VLJA 4OQTH 2AXFB 3BPNC 3VMOA 1JZ5A 1OSPH 3KPPB 1ZVYA 2A1WL 4MJ6B 3VXUA 4MJ5A 3GMLB 1RZ8B 3T1FB 1XGTA 2ERJB 4V1DA 3C08H 3C9NB 1EPFA 2H2PC 3HTLX 2BCKA 3HAEA 5KS9A 1X7QA 4M7ZB 2VZTA 5ID1A 3GGWB 5LCVH 4F15B 5EIIA 5J3HC 1T04A 3OKDB 5E1AA 1ZVHA 3QZWA 3ZDYE 2FHFA 1DEEA 3N9GH 4PJBE 3N1GC 1IVLA 4NZRH 1ED3B 1FGNL 5K9JH 3RVWD 3X3GL 4KMTH 4KI5D 3UTPE 1W72A 4Z7QE 1QACA 3SDXB 4ZYKB 3H6JA 5DD5L 1RZKL 1CFBA 2A2QT 4Y5VB 3SY0A 1B0WA 3LEYH 2AEIT 4R7DB 2HT3D 3D18A 3N1MC 5FYJD 1D5BB 3QIUA 4NRXA 3UPRB 3ZE2E 3O3EB 4P99A 1X44A 3MV8A 3S35L 3HFMH 1P4BL 1TJIH 2QBWA 4DK6A 1WAAA 4OF7A 2LU4A 2D9QB 2N7BA 5DTFA 4YHYB 2NZ9D 3NCMA 3G5ZB 3BT2L 4BA8A 4F57H 5HY9A 5KTEH 2EDRA 1FFPA 1JPTL 1P5UA 3OKYA 4NQVA 4RNRB 3PE9A 4JQVA 4EUPB 3I84A 3TBSA 1A4JB 5IKCA 1KOAA 2WW8A 3EYUH 4UDTB 2UWEE 4X6BA 4ZDHB 4UZGA 1KPUB 3RY6A 1N5YL 1AKJB 2BY1A 1T20B 3LV3A 4FMKA 4Y8AA 5C0DB 1AY1H 1RULL 2ADGB 1AJ7H 2FBJH 4IOFD 1U8QA 5DJ0B 1OSZB 2ARJQ 1CDGA 1EK3A 3CX2A 4PJBF 5EBWB 5GISL 5LAXB 3HB3C 2AERT 5EU5B 5IVXA 4P5KA 1VERA 5BW7A 4NNYA 3VFRA 2OSLA 3NCYP 4JO3H 4I3RH 2BJML 2DIJA 5D2NA 1SEQL 3GJEA 4LVHC 3WDHA 4Q6YA 5E5UB 4YQXL 1S7QA 4HUKB 3HZMA 1A3RH 3PHQA 2MMXA 3D39B 4X4XA 4R90H 1CFVH 3HUJB 1HOCB 4OZFB 1OP5K 3OHXB 5J12B 4GBXB 3S4SB 2X2YA 1EVUA 3BE1L 4KK6D 4NKIH 2K9UA 3BKJH 2HFEA 2EO1A 3MRBB 3QH3A 4PG9A 3SOBL 4NO0A 2KUTA 2DQTL 2NY3B 1YC7A 1YJDL 2DQEH 3U0TB 2QHRH 3QUMB 1G7JA 1A6WH 4FQQA 2UWEF 1JGEA 1T2XA 4LSSL 2WINA 1K8DA 2XY1A 4J1UB 1MFEH 3UYPA 3CCHB 4L4VA 4HG4K 3VWJD 2QV2A 2G5BA 1SYSA 4KY1H 5I15H 3O2VH 1S5IL 1RQ5A 3WFZA 5EN2B 4Z8FL 2ZKHL 2IC2A 5IG7B 2IANE 4WGVB 5DWUH 2UZXB 4FG6D 4P2OB 3SPVB 4A2LA 4X7TA 4J3WA 4X9BA 5JIKA 3WE6A 1G7PA 1IEAB 4QHNA 2YKLL 1A7QL 4UMGA 3U7WH 4NT6A 2R2BA 1PDKA 4RX4A 2COQA 2HVJB 1P7QA 4AMKL 4OM1H 5EBLB 2C1PA 1J1OL 2R4RH 1DE4B 3D1MC 4PB0L 3RI5K 2A83B 1JVKA 1UJ3A 2LVCA 3BO8A 4PJAA 1ZA6A 3W81A 5KVMC 3VMPA 2R56H 3U2SA 3Q6GL 4JAMA 4WW1B 4HWZA 2ZCLL 3IS1X 4GG8A 1DQMH 3ZHDA 4WW2A 2B2XL 4LCCB 3H9HA 3NZHH 4AEFA 3MV7D 4JRYB 3L1OH 4I0PD 2YN3A 1MIEL 5F6HJ 4LARH 2AP2A 3FO2A 2R0KH 3P0GB 4HPOH 3ARGC 4JZOA 1ZTXL 2XTJD 5GSRB 5DFVD 5I16B 1NMBH 1NCBL 2WIMA 3GSRB 5AEAA 3OKMA 3O41B 4I2XA 3V52L 3RVXC 4NKMB 4N9GB 2MCPH 3QPQC 5CEZH 4W4NA 1AGFA 1WTGT 1F6AB 2RCSL 4IMKA 5E00A 1BVZA 4H8WL 2GT9A 1JGVL 2E9BA 4TTDD 3EJYC 2FL5A 4XNQA 1A2YB 1A22B 1VHPA 3MJ7B 1LDPH 4JFZL 4ZXBA 4PJIE 3H7BB 4WEUD 5BZDA 4GXUN 3P77A 3TNNB 1RURL 1E4WH 3B9KA 1UKQA 4M93B 4PRDB 2CO7B 2GUOA 2WBJB 2BVOB 3H42H 4JY5H 4LFHD 3HNSL 3KHQA 4OZHE 3H3PH 3UJIL 3I9GH 5D1QB 1DFBL 4H25A 3IDGA 5HVFB 2F53E 2DMBA 4JJHA 1ZAGA 4JGMA 5CINH 1EGJH 5GRZA 4UIKH 3K80A 3NGBC 1U6AH 2ICES 4PS4L 1ND0B 3RPKA 1M71B 2Q7NA 5E8DH 1E6JL 2EH7L 4S1DC 1BX2A 3INUH 1D5ZA 3RGVA 2BDNL 2CRMA 4YDJB 1MY5A 3CFEA 4NRYA 2FD6H 2GJJA 5CUSH 4FQJL 1BREA 3IETA 4YK4C 3W39B 3S7GA 1G6RA 3KJ6L 1UWGL 4OJFH 4JO2L 4LRNH 4UB0L 1BGXL 1HXYB 2D4FA 1ACZA 2EEAA 5HHPA 5EA0L 3T8XA 3MBEA 1BJMA 1AHWB 2GAZA 3X17A 2BSRB 2QR0B 4FHBD 3TT1H 4XP1H 5E6ZA 4ZUWB 3DYPA 1RJZA 1AGBA 1TXKA 1P7KA 5CGTA 4D9RE 3TJEL 3EOYG 4OZHF 1L7TL 1JYVA 4F7PA 1IL1A 1EXUB 2JE8A 3RZCD 4N8VA 4Z7UA 2W1NA 5DEGB 3VXNA 5I74B 5C0IA 3K46A 3EJZD 2J2ZA 4HX1A 3OL2A 4FP8L 1T1XA 5F6IC 5KN5B 1MEXL 4XPHH 1ORSB 5FO9A 2IMNA 3H8NA 4N0YL 4PRIB 4Q6IB 5HYJE 3HE7B 5T1LA 3TJHD 1IM9D 2HJLB 3HA0A 4Y89A 5IMOB 1JNLL 5IUSA 1S7RB 3IGAA 3JTSA 2VERN 3OAUH 5ICZB 4KK5C 3NA9L 2E8ZA 4KU1A 3D87B 1EHLL 4RQQA 1IGTB 4XAWL 5D1ZD 2E27H 2EE9A 2XOTA 3X12A 3LKQB 1CBVH 1CFQA 1MAJA 5ITFA 4JPWH 3WKNA 3QUXB 2PYFA 2DN7A 3PUCA 5HDQH 5HHOA 5H94A 3MRKA 3PP4L 2BNQD 1OP3H 5FUZL 1FGVL 1TVBA 3KLDA 3QDGD 2Z4QB 1Y18A 4HMDA 4ESKA 2GTWB 3I3DA 4JQIH 3D85B 1ZE3C 3KLHC 2BHYA 5FO7A 1J1XH 1MPAL 2YPVL 4LVEA 2HLAB 4OCXL 1QNZH 3CVIH 3LD8B 4OCYL 1CLCA 4JN1H 5AYUH 5IK3B 5EC2A 3IDXH 3DRTB 4QGYA 3DVNB 3ALWA 4KRPC 4F8TA 3R8BB 4YHMH 3TO4A 1ZA3B 4RFNB 3D25B 1F4YL 2VZSA 8FABA 1Q8MA 2YOCA 4XPTL 5JDJA 4LSTL 4P46C 1F4XH 4Y4KD 1GJIA 4CVZB 4NJ9H 1OT2A 2CGRL 5F93C 3TYGL 4IRJD 5KSBB 2VLKE 4G8GB 1DLHA 5DFTA 4U1KB 2D7NA 5IR1B 1B9ZA 2CDFB 3MV11 4B0MM 2B0SL 1JF5A 2AGJL 4RMWA 4UUJB 3R0MA 5IFJA 1PLGL 5I17A 2C3VB 3BZEB 4A6YB 3LB6C 3QFDA 2YA0A 1WC7A 1LE5A 1TTUA 2P7TA 5TH2B 1IC5L 4YHKL 4QHMA 1KJ3L 2EDFA 3MLSH 4ERSL 3L7FA 1R5IA 5DQJB 1OOAA 4EXKA 5DUPL 3UAJD 2P5WD 1HIMH 5E8EB 4JKLA 5ENWB 3L6FA 1ZLVK 4PBVC 2ZJSH 1ITBB 1MFCL 4J2XA 1YNKL 2DD8H 5IEKA 3O6LH 2XRAH 3HPLA 4Q0XL 2GEEA 4G6AD 3UTTA 4X4YA 3ORJA 5DGRA 4GKOA 5JXAH 1BWWA 4P2RE 1BIHA 4N0CD 1H15A 3A67H 1LO4H 5AG8A 5FOBB 1JL8A 4PRHA 4PB9H 5DLMH 1R3JA 4OLWL 3BYYA 1MCIA 1KELL 2DQFA 3FFDB 3TYFA 4XB7A 2NY2D 4KUCF 4LSUH 3MJ8A 5D5MB 1I1YA 4AG4H 4OGYL 4MDJB 2NY1D 3QIWC 3IJYA 1F58L 3QHFL 3RNQA 5HVHB 1JPSL 3THML 2E7HA 1A7PH 3RL1B 5GGRY 1NUNB 4EBQL 4Y1AE 5D2LB 2PTTA 3S37X 3MLXH 4L29B 4GRMA 1KPRA 3QI9C 4OI8A 4U0QB 5EU3A 1GSMA 4EUPG 3ECBA 4FXLA 4FMFA 4PJ7A 4BQ6A 5FGCE 4YE4L 1LP9B 4QCIB 5C0GA 5LGHH 4ORZC 1ZT4A 4EUPH 1ORQA 4RISH 1NKOA 3PWNB 1KB5A 3AAZA 1TITA 4X7FC 1IE5A 1G7IB 3UTSB 5L2KE 3OKOA 3IDNA 5MHSD 1IC7H 3WXWL 4JFDD 4ETYA 5J6HA 3GHEL 1AGCB 4JVWA 4X5WB 5CJQL 3U82B 1U8LB 4PJ9D 1J8HD 2OJEB 1FJ1A 3TN0C 5FKPB 2YBRA 4PJHA 1D5MB 2A6IA 1CD0A 5CGYD 1VCAA 5FB8A 3WLWD 3V8OA 1ZSDB 1F42A 3S4SG 4LSQH 3GMRB 2HFGL 3UJTL 3O11A 4GAGL 4M5YH 3OKKB 2HFFB 3ULVC 4JRWA 4KZDH 2ADFL 1HH9B 3LZFL 2VDOH 3QPXL 3ARGA 5K59E 3PQYB 4WUKH 3IFOA 3IXTA 4FXKB 1NBYB 3L5HA 4G3YL 1N4XH 2EIZB 1KTLB 3CXHK 5IB5B 3T65B 3GMMB 4K23H 2RJMA 1GC1H 4CKVX 4HJGB 3GHBL 4ODSL 3QUMH 2F58L 3O4LA 5C0AA 2WBKA 2DL2A 4QRRB 1H0DA 1T1YA 4RFOH 4WI2A 4OCLC 4LNRA 4X6DE 5B3NA 4FFVC 2W0PA 1QSFA 4HF5H 2Y36L 2H2SC 5I6XC 3R06A 3BDBA 2RR3A 3TESA 1V8HA 5B3JE 3IYLW 3AS0A 5DEFB 4F7TB 4NKDA 3V7AG 3VFMB 5IV2B 2YEZB 4CU6A 4ZMAT 1G1YA 5TQ2L 3TT3H 2XWBB 1FRGH 5GS0H 4TOYH 1T7ZA 1U3HD 4U6XA 4RRPA 1C5BL 5GRXG 3VGHA 3A6CH 4CMMA 2HJFA 4WNQA 1NLBH 3STLA 5D7LD 2X70A 5I1LB 4DKFH 4UBDC 5D72L 5CJBA 4CN1A 2E5EA 1G9MH 2NYYD 3JVGC 4U1NB 3C5JB 4HJJL 3NH7H 1MCLA 2ERJC 1OM3H 3MPCA 5E8NB 1K4CA 5F9AC 5K59F 3WN5B 4P2QE 5CP3H 4CJ1A 1E27A 3QDMA 4WCYH 3G5VA 3SE4C 5HGDA 1NL0L 1GGIL 1QRNE 4M7ZC 4OLYL 2WUBH 1NGZB 3SJVD 4F15C 4MVBD 2NW2B 3AU1B 5F1NB 2CUHA 4RGNE 1DQJA 1G9NL 15C8L 3V4VL 2DL9A 2YUVA 5FO8B 1YYLL 1BEYL 1KEML 1IILE 2VSDA 1UCBL 4LIQL 1TFHA 1AXSB 4RBPK 3BN3B 3VXSD 4FABL 4XPAH 2FJGA 4Y5VC 5JHDD 1XIWC 3U4BL 2J3SA 4P4KB 5D7IA 1SJXA 3IU4H 4DVRL 5F9JB 1INEL 4PTUA 2DTSA 1QZ1A 3TIDA 5ISZA 4S1RH 4Z7VE 1KEGH 3GI9H 4G6FB 4TUOB 3S98A 4PJFE 1L0QA 3W2DH 3MRGA 4YHYC 1QYGL 1CD1A 4M7LL 4OCSL 1IAKA 1PZ5A 1X5GA 4LDLB 5I75C 3FQRB 1RHHB 1IEBB 1NGWB 1FFRA 2PETA 2X1XR 4QRPE 5IB2B 2ZUYA 3LN9A 3MA9L 1T4KA 3ZDXE 3B2UD 4X7EC 4MMXC 5E6IB 1KB9J 1T1ZA 1H3XA 2W07A 3N85L 2G75B 2CKNA 2DLIA 4ENED 4HPYH 4H5SB 4MXWL 5CSBA 1G7LB 3PP3K 3TNMA 3VGGA 5GSVA 3DXAD 3I6GA 2CSPA 5JPNB 1W0WB 4JO1L 4PBWD 4XTRC 4D8PA 4Z7WB 1CICD 2V7NA 5CLWA 2F5AH 2G60L 4HFWB 5E03A 5EOTA 4Z7VF 1JV5A 1KJ2L 1V05A 2A74B 1DQLH 1NH6A 4U2YA 4GBXC 3VFPB 4LL9A 3JXAA 2VWEC 4O2EA 4QF1A 3MUJA 2FJHA 2AS5M 2E7BA 3UYRH 2A0LD 4MMZC 2NY3C 1MF2H 3LKRB 4GMTL 5KVGL 3O2DH 4M6NL 2Q76B 4NO2A 3S34L 1DL7H 3RTQC 1S8DB 1OGAA 3NACL 4MJIB 2O61B 4GJTB 3OB8A 4GW4B 1VADB 1XH3B 3I6LE 4NNPH 1NFDA 1WBZA 5EOQL 4R4FH 1EIBA 1JGDA 3MLVL 3M45A 3PGDA 5IMKB 4N8CH 4UAOB 1BD2D 1FYTE 3G6AA 1OHQA 1BAFH 2P5EE 1RU9H 4JY6A 3KPNB 5GS0C 5DMJB 4QOKD 1N0LA 3UTQA 2WIIB 1A7BA 2CKBB 1R3HA 2QSTA 2PYED 2Y06H 2UZIH 3KXFE 3O6MH 3D69B 2AK4D 3RVVD 1AR1D 1FFOA 3QFJB 2A6DA 4L3CA 1G9MC 1ZMYA 3HZVB 5B21A 3ZKXB 4R4BA 1FIGL 4GAYB 1M1SA 4FFZH 4ZTOL 2Y25A 1NGPL 4HCRH 4URTB 2FATL 4LEOA 3FHQA 5F3BB 1W8OA 2NCMA 3DYOA 4KRNA 3OV6A 3KPRE 3MV9B 4NN7B 1NCAL 4JFED 2VL4A 5IW6B 3ARSA 3AS2A 5A1AA 1PY9A 3QIWA 4LCCC 1T0MA 2GFBB 3S36H 4WI8A 3ULUF 5DEZA 5DD6B 4R3SA 5CJOH 4LCWD 1T0NA 3BGMA 1TZHB 2R0WH 2X4QB 3QJHA 5F72S 1NCCL 1A5FH 3LQAL 2EDHA 4YHIA 3SKNA 4F2MB 4HC1H 3QI9A 4GG6A 2N56A 4XXDB 1VEOA 3CU1A 1WK0A 2PCPB 1CGTA 2OM5A 3KR3L 2XZAH 3MLZH 4G7YH 4N5EC 5C6TL 2B1AL 1A1OA 1A6AA 3RVTC 4E41E 6CGTA 5I30L 3IDYC 2P8PA 3QUZD 2W92A 3CC5A 4PGEB 4Z0XA 2F19L 3T2PA 1JMXA 2X6MA 3A6BH 4NSKB 1A9BA 3KJ4C 3QNXB 4RWHA 4A6YH 4I18B 2QADD 4ZFOB 1G84A 4LCUA 4G80A 4YPGA 1RUMH 2UV3A 2HTKC 3O81A 4PJCA 4XNUL 2WBJC 4MXVE 5HTSA 4ZUVA 4PYGA 1GAFL 3VWJB 2AABL 3PWPD 5JUEH 1JRHI 5IVZB 5D1QC 3S3JA 5JIHA 1IARB 1PAMA 5DK3A 3TN0A 1Z5LA 5GGVL 4ONOA 1JWMA 1PY4A 5JDSB 4JO4L 2IGFL 3MX0A 1BP3B 1KLUB 4HH9A 5DJ6A 2V7HA 1JTTA 4S10A 3T0EB 5FV2A 1CWVA 2DICA 4JHAL 3QCVH 1J11A 5KVEL 4ZTPH 2C3HA 5FCUH 5CS7A 1OTTC 3HCVA 4L1DA 2W65A 3E6HB 2MQCA 2O5XH 1NANI 4XWOC 5EU7C 3W11C 5C08B 4JFOB 4LSRL 3P4OA 4W6YB 2APBA 1IZJA 5GS2D 3PV6B 4K9EH 3TWCL 2GTZB 3WJLA 4YDLB 3G9AB 2BY0A 1CGWA 4HEPG 1ZT7A 1AHWC 4JDZA 4Y4HD 3OGCB 1LQSR 1CL7I 3BPOC 2JELH 3PHOA 4MD4A 3CFCL 5FGRA 4XPFH 3MRHB 4UT6H 4MXVF 1KBGL 2NMSA 1HHJB 2W9EL 3HZYA 3DUSB 2YSSB 3CZFB 1FO0L 4HUUB 5K9KB 3ZO0A 1MLBB 2IFGA 5I74C 4I9WD 3CSPA 1HHGB 3LVEA 5F9DC 1XF2A 3H9SE 4M61A 5L0QB 4Q6IC 3ZT5A 4O58L 3HE7C 3Q1SL 1RJYB 2AXFA 4ZS7H 1OARL 3KPPA 4JFFE 3JVGA 4MJ6A 1BFVH 3BEVA 3C9NA 5C0BA 3SE4A 1GCFA 2B7DT 5ELIA 3GGWA 5FDWB 2YR3A 4LAQH 4KKCD 1U3JA 2UZYB 3GUTB 3OKDA 2CR6A 2E9WA 4F7MA 4E42B 2F53D 5TE7L 1FLRL 2IAMD 2DWDA 5FCSH 1ED3A 1MQKH 3EOBA 1F6FB 1NUFA 1BFTA 3W5NA 3SDXA 3BGAA 4ZYKA 3V95A 4IRZL 5JORB 3HC4H 2IADB 5EIQA 4Y5VA 5C0CD 4MYWB 1XIWA 3E3QE 1IGIL 1XGRB 4R7DA 4UOW1 4FQCH 5F8RC 1D5BA 3IB4A 1QPPA 2GCYB 1RZJL 5DMYA 3O3EA 1ROWA 5FHAL 1JNNL 4OIAA 5T3ZL 4HBQA 1WLHA 2OTWB 4JKKA 1MI5E 2C5DC 1IAIH 3G5ZA 2ZUUA 4K7FB 1MJ7H 5L7XL 1K5NA 2RGSA 1J10A 2W38A 1OW0C 4HXAL 5HI4D 2ICWJ 3BP5B 4RNRA 4CBPA 4EUPA 4FFWC 2OBGA 1R5VA 4UDTA 3EW3B 4GLRH 4UT9L 4C54A 4ELME 3EJJX 1AKJA 3BD3A 4D9RD 1T20A 2QQLL 4XCFL 1UWEH 3OJVC 2ADGA 4PLKC 1JGLH 1LK3H 2ATPB 4P5MB 4O2CB 1Q1JH 4IJ3B 5ECJE 4KQ4H 5DJ0A 1NC2D 5LAXA 5EBWA 3UZVB 1FG2B 1FFQA 3ZKMC 4PIRF 2QSCL 4P48A 4G6ML 3GMQB 1G7MB 5I1AB 4H1LB 1S9KC 4KVNL 2OZ4L 3KPOB 4XRCB 5J1TC 5EG6C 3VH8B 5CEZE 4N9OB 4W70A 1XCTB 1WGOA 1MNUH 4UTBL 2P49B 1SEBA 1Q9KB 3BD4A 2XICA 4GXUM 1F02I 3D39A 1AP2B 3HUJA 4OZFA 4R2GD 1GOFA 3ESVF 3OR6B 2YZ1A 3CLFL 5GGQL 3OHXA 4YAQB 2BNQB 1G6RL 4GBXA 4Y5YC 4YHLH 1PKQB 3S4SA 4D0CA 4DW2H 1WFTA 3EOAA 1NQBA 4P9ML 3MODH 1HEZB 3SDYH 3QIBD 3MRBA 4WDIB 4ONGL 5HVHC 5LWYL 2W59A 3BVNB 4K9EC 5ESVB 1J0KA 4OKVB 1EJOH 3RTQA 3U0TA 1F97A 3VE0B 1EHNA 4OZIE 4X99B 4ELMF 4N1HB 1U95B 2V6HA 2YPKA 2VKXA 5E2UL 3NPSB 4J1UA 3GDBA 1BPVA 2V5TA 3OG6B 2F54E 3CCHA 1RUKH 1QKZH 2XQBH 4J6RL 3VGEA 4HWEL 4LKCA 5EN2A 5FFLA 4LLUB 4NUGH 3WUWA 4KUCD 4IRJB 3QDJE 1GGCL 1CD9B 5JMRA 1N5AB 1IEAA 3K8MA 1HQRB 1Q9LB 3MRPB 4YZFE 5HYFA 4GMSH 4CADB 3TCLB 4YXHH 4NQUA 1A6UL 3DV4B 3FB8B 2VITB 4QHKJ 2I5YH 4U3XA 5IW3A 3U0WH 3OR7A 3F58L 4JG0H 3WV0A 4F7EB 1CI5A 4BK5A 1DUZB 2YC1B 3OKLA 4J12A 3F12B 1VGEH 2HAZA 2OCFD 2I9TB 1KT2B 1O0VA 2P5WB 2VN4A 3W9DA 2VQTA 1PG7X 4KJQD 1Q0XL 4M7JL 4WW1A 5F88B 5BS0D 4ODTH 2YRZA 4LCCA 2QQQA 2Y6SD 1D9KD 4JREB 4JRYA 4BYHA 4DTGL 4Y5XB 2Y5EA 4P5TD 4OZIF 3RWJB 3WIFB 1I1AD 3PWJB 5I16A 1S3KL 5I8OL 4OLEA 1IKFH 3GSRA 3P30H 1DBML 3AFLA 2NY2B 4HAGA 1Q0YH 1HINH 4NKMA 2CH8A 1II4E 4N9GA 4BH7B 3EFDH 5IEHB 3EZ8A 4BSVB 4WFHE 5TE4L 3ROLA 4LMQI 1F6AA 5FYJH 3EBAA 3OAZH 5J57B 5DI8B 5JMOC 1OTSC 3U79A 3VI4E 5AZEL 3U1SH 4WWID 3U4AA 4CAGA 4N0FB 3IRZA 5FK9B 3TNNA 1UJTA 2EZ0D 2WBJA 3BJ91 5ACMA 1J87A 2DQJH 3CH8A 4EN3D 4WEMB 3PXHA 1BIIB 4FZ8L 3NIFF 5D1QA 5M7QA 3P9LB 1JNHB 2IF7A 4HJ0C 1XR8A 2BOCB 3MJ9L 4R97C 3DIFB 4NQDE 4LSDA 4POYA 5L88H 2CKBH 3VU2A 4X80H 4MD0B 1IKNC 1INDH 3DI2B 4PJEB 4C56E 1MIMH 5FYLE 2XA8H 3QXTA 4W4OC 3P0VH 1OAQH 1M71A 1B0RB 2VLME 5BMFH 4JFDB 5IOPB 1NGQL 1I7TB 4NM4H 1CN4A 3WN5C 3F5WB 12E8H 4DUXA 5MEOB 1FN4B 4C4KO 3W39A 3MLUL 2E7LC 1FL3B 2NY7L 5EO0A 1YQ2A 1I1FB 5FOJA 3R1GH 3FFCE 3GEWB 1UVQB 5C70A 4L3EE 2OJZL 3BDXA 5KBNC 1HXYA 3IFLL 4PRPB 2XKUA 4JRXE 4DOHB 4JDTL 2A6KB 3REWB 1AHWA 2BSRA 2QR0A 2ZZUT 5INDB 4ZUWA 4F3FB 4MB5A 3T2NL 3SGJC 5DK0B 4P4KC 3DWTA 4HFUH 3G08B 5E4IA 4B41A 1JIBA 5C09E 3BRGC 3O2DA 4HQQH 1EXUA 2AJVH 5E56A 1H8OA 1HCFX 5DEGA 5IFHL 2YD1A 4GH7B 4EZMA 5E2JA 1SQ2N 5KN5A 3OPZL 2X09A 2VLLB 4G6JH 3GIZH 1ORSA 4G6KH 4GRWE 4Q6IA 4PRIA 3EHBD 3HE7A 3CX5K 1Q9OB 2PXYB 4W68A 2HJLA 1KB5L 2VXQH 1MHCB 5IMOA 1S7RA 3O8XD 4KTDL 4PUBH 5ICZA 4U1JB 3NCYS 4C83B 1C1EH 4M5ZH 3V6FA 2UUDH 3DX9B 3IS0X 4OQTL 4XP9H 1IGTA 1OSPL 3LKQA 4XMKH 5E6IC 5MENE 3QUXA 5CCKL 3C08L 2ID5A 3EDKA 2D9CA 1I8LC 5SX5K 2J8OA 4L5FH 3CVHL 2A9MH 1R24B 2EYRB 4HCRA 5LCVL 3HE6D 2Z4QA 2K7PA 2GTWA 2X41A 3N9GL 3D85A 2C7UA 1GVIA 3TEUA 4KMTL 3AB0B 3SJVB 2Z91B 1UCTA 3FRUB 4P2QD 5FYKU 3VFSB 4TUKH 4O5LH 5IK3A 5I2IA 1CLOH 1QRND 2JTDA 3DRTA 3DVNA 1UADC 1Y6KR 3KPMA 3K2UH 4UOJA 3LEYL 4KI5C 4RMSA 4HC1A 5D4QA 1MUJB 2ESVE 1A0QH 1ZA3A 3MGAA 1K6QH 4RGND 4GQPH 4HKBB 1HQ4B 4GRWF 3O9WB 4CVZA 3EGSB 2ARJB 4UTAH 1CGSH 3R4DA 3MNVB 4DUWA 5JHDB 3FTGB 1F00I 4E5XB 1XR9B 5KSBA 1OW0A 4NHCH 4G8GA 3HFML 4U1KA 5IR1A 4D9QE 2CDFA 3S3SA 4UUJA 4MCYA 3VGFA 3KLSA 1JMZA 4LHUD 3BIAX 4F57L 2C3VA 1JGUH 4ONHB 5I1EH 5A2KH 1P1ZB 5KTEL 4A6YA 3ROOB 4TPRH 3UPCA 4F8QA 1EAPA 4LFHG 4NIKB 4LCIL 8CGTA 4X7SH 3LQZB 5TH2A 5DQJA 3EO0B 3D0VB 2R1WA 3EYUL 2UY6A 5FM5M 5F8QC 5KSAD 5E8EA 3CK0H 1P84K 1S7TB 2FBJL 5GRVK 4Y4FB 4ZPVA 3RBSA 3QDHA 2BNUB 4BZ1H