1FP5A

Crystal structure analysis of the human ige-fc cepsilon3-cepsilon4 fragment.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IGE HEAVY CHAIN EPSILON-1
publication title Structure of the human IgE-Fc C epsilon 3-C epsilon 4 reveals conformational flexibility in the antibody effector domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2000-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fp5A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fp5A02
2A83B 3N85L 2N7AA 2AQ3A 3C8KB 3V6OA 4YHZH 3WHE1 1KLGA 1HI6B 5FGBA 3NACL 5E1AA 1Z5LA 4BZ2L 4C54A 4NO2A 1MF2H 3DXAE 2D31B 3VXMB 1F02I 3ARVA 1KTRL 3TBTB 4YDVA 4QF1B 1KPUB 5SWZD 2EEDA 4OZGA 1SQ2N 4NWUH 1IAKA 3QCTH 3ZKXC 3QXAB 4L8BB 4EUPB 2Y25A 1K8DB 1SMOA 5BXFB 1JZ5A 2R0ZL 2VISB 1I7RB 3QCVL 4V1DA 2DLTA 4OGXL 5DRNB 1XR8B 3IFPA 1CD8A 3A67H 5EOCJ 5GS3A 1FVDB 4QXWA 3L3GA 2ATPB 4ZUTB 4Y1AB 4EBQH 4Y16C 2ZJSH 2XNAB 3MLRL 5HHOD 1A5FL 5D1ZB 1BEYH 1EXUA 1U91B 2VDRL 2F74B 2GTZB 4JCMA 2DS4A 3OXSA 5C1MB 1GZQB 2JJUA 5GSRB 4Q9BA 1MNUH 2DLFL 3BPOB 4JFHD 4PJDA 1MHHB 4BH7A 4NN6B 1AGEA 4KVNL 1VESA 3RWHB 4LPTA 3QFDB 4DVBB 4XMKL 3IS1X 1EAJA 3ARFC 3QWOA 5HDBE 1AXSA 1P7QD 3CK0L 3HRZB 3U4BL 1NGWA 4HC1A 3S4SG 3GHBL 3HUJB 3BQUC 5TF0A 4IHOA 2HJKA 5D7LB 1SBBA 4NM8H 3CIQA 1PQZA 4NQXA 3E2HC 1B9ZA 1WC7A 2G2RA 5C0EA 1GAFH 5IT2H 4NO3B 1P4IL 1JNLH 1YQVL 4F7CB 3FFCB 5DURB 3IS0X 4TULL 3ARDA 4HWEH 4CVZA 2J8HA 1I7TB 2CR3A 3MJ9H 1AIFA 3CU7A 3H6JA 4JN2A 4QHNA 3ROLB 4Z7VA 1P1ZA 3HTLX 4OCLC 4X4MA 3PDOB 3O3AA 2R8SH 4FQCH 4HZLA 1I85A 1F90H 4P5KB 4LP4A 3E1F1 2IAMD 4L8SC 5IHUL 4OB5L 4QHMA 1SEBB 3WUZA 3D9AH 5CP7B 3FB6B 3VFPA 1ULVA 1ZT1B 3CPLB 2ZUTA 3LSOA 4O2EB 5HYJD 3C5JB 3DGGA 5CJOH 4X6CE 5EIIA 3TO4D 4OKVA 2APXA 4OI9A 2D3VA 3QUKB 1YEGL 4AEHL 3WD5L 5ENWA 2HN7A 3GKWL 5CHNA 3RX7A 2I60H 2W0PA 1KCKA 1UZ6E 3PIQB 4PRHA 4UNTA 5KSVB 3MCG1 1HSAB 1YEHL 3IJYA 4F57H 4M5YL 5I71B 4K8RC 1RULH 4WY7H 3P0VH 2AV7A 1ZVYA 4LQ1A 5JW3L 4JJHA 2VDNH 4KAQH 4R2GB 4I13B 1H8NA 5E6IA 3V5HA 5H94B 3O2VH 4BFEA 3EO1B 1KFAH 4N0UB 3U4AA 1R3JA 1YDPA 1X5XA 3SDCB 1ZHNB 7FABL 5F1NB 2F53A 1J87A 5CS7A 4LARL 7CGTA 1W0YT 4OFVA 3GIZH 3LHPL 4ENEC 5GS0D 1CLOH 4I77L 4U6HA 4G6ML 3QUXC 4Y8AA 4V1DD 5BJTB 3W11D 1FZOA 1NDGB 4Y2OA 2WNGA 2VQTA 1TJIH 4HXAL 4F7PB 2R29L 1Z3GL 5HPOA 1X5GA 5J3HD 1BIIB 5ETUA 1J1OH 1ZT4B 3W39A 5D5MF 3FT2B 5DD5L 1F4YH 1CE6A 4BUHA 3LKRA 1CXIA 4LGPB 1EAPA 3C9NB 1J5OL 4HX1A 1XMWA 5C70A 1RZ7L 1QO3A 1X4XA 3EJZC 4EIGB 3K81A 1A21A 4ZAKC 4XWGH 3BYYA 2EYRB 1A1NA 4ZD3H 3KPRB 1KIQA 4PJIA 2Q8AH 2PTVA 1A6ZB 3RGVA 3DVNB 3QIWC 3V7AG 3N9GL 3WFDH 1N4XH 2WANA 1OTTD 5GHWL 4TVPH 3V4PH 2QKIB 4MYWB 2W0LA 4U6YA 3LPWA 1VSCA 3V4UH 3SQOL 2DQGH 3DX9B 2ED8A 1OTSD 2D0FA 5B21A 2Q6WA 3RWEB 1GJIA 5F1KC 1KPVA 1DQLH 3VWJC 4XAWL 1G7QB 3K8KA 4G8EB 5F9DC 2B39A 5FKAB 4OCNC 3DVIA 1ZHKA 2ZSVA 4XNMB 5A2JH 2X4PA 2APWA 5I1LB 1UWGL 3L3DA 3FN0H 3ARDD 3H7BB 5BO1H 4JZOA 2QSVA 5DA4A 4HSQA 5JXEA 3O3BB 2P5WB 4UBDC 3GDBA 2FNBA 3WHXA 2ENSA 4PV9B 4CN4A 2CGRL 4MB4A 4ZNEA 3G5VA 5IBLD 5BV7C 1IARB 1KCRH 4PP1C 4K3DL 2PTTA 4FXKB 3CFJB 5BZWA 1JTTA 2NY2B 1X5HA 4LCYB 2R4SL 1TIUA 3C5ZC 4KGJA 3RZCD 1RUKH 1U8HA 2GEEA 2WBWB 3LKQA 5HPMA 2GJZA 2H2SC 4AEEA 4F9LC 2WWMC 3FQRB 2A9NH 5AYUH 1JGUL 3FB7A 2D0HA 4NZRH 4KC3B 4APQC 1KCUL 3VRJA 4Y5YA 1CDCA 5DJ2A 2FLBT 3E3QE 5E5UB 3T77A 1QR1A 3CFDB 2DQUL 3DXAA 4K23H 3NPZB 1HDMB 4PRHD 4NNPH 1KJ2L 2HT3D 3RJDA 4M6NH 1YA5A 2MCPL 1YYMH 2C1OA 2CLRB 5F7UA 5I1DA 4WDIB 3VD7A 4MDJA 3JBG7 2C1PB 5E2WH 1RY7B 5L9DH 1A4KB 5HI4C 5FGCE 1UM6H 5T1DH 2X41A 3BZ4A 1PSKL 4FQXA 1U36A 4HGWA 5E6ID 2DLEA 4WWKA 5DQDH 1AHWC 4R0LA 2F53D 1KNOB 3EDJA 2A9MH 5I74B 3CLFL 1MJ8L 2CXKA 4GAGL 5EB9A 1VADB 5ADOH 1LQSR 1BFSA 1IC1A 4UV4H 2FDBP 2XQBH 1W0WB 5FK9A 1N2RA 3WFZA 3ULUD 5DO2D 3OAUH 1AGFB 2V7HB 2QADD 5JIIA 5ITBL 1OAXH 3K74B 5E4EB 3UTTE 5IOPA 4AMKH 3WN5C 2G5BB 1NJ9A 1T5XA 2XN9D 1IEHA 1Q9KA 3L1OH 2IJ0C 4AH2B 5E9DE 3FQWA 5C0CB 3FRUA 3QA3B 5EFIA 3WV0A 3IGAB 2BRRH 1NBYA 4Y2DC 2PYFA 4NFBA 1CIUA 1NUNB 1WEJL 2A6KB 5J0BA 1MOEA 3RGVD 2X4QB 5C0RL 1DQQB 5ESAB 1DEDA 1EH9A 2OR8A 4RGNC 1MCFA 1P7KA 4JVUA 4AENB 5D72L 2ZUWA 3E8UH 3OBAA 1ZVSB 4C55A 4PV8A 1BPVA 2P8MA 5LQBL 4DJMA 4HULB 5T3ZH 3PP3K 1BJ1H 2APTA 4XPTH 4RA0C 1ND0B 2H6PB 3W0WE 3IFOA 3DMMB 3ARTA 5DUMH 1MWAL 3V52H 5HD8D 4RMSA 2HFEA 1OAZL 5J6GB 2OP4H 3H9HB 3MJ7B 1K85A 1R3KB 1TJGL 5FGBC 4ZUWB 5JXED 4JO3L 3GNML 4Z0XA 3ORJA 2GSIA 5KSAA 5A43C 2PF6A 3EFDH 1H5BB 2MNUA 3DV4B 4HLJA 1NCCH 4WI5A 5EUOB 5GGRB 2X10A 4X6CA 1PGRB 2A77L 2NY0D 1FYHB 3CZFA 1YUHB 4G5ZL 1XR9B 5AYQA 5CD3B 4OSUH 4OD1H 3VG9C 1A3QA 2EDDA 5C07E 1A2YA 5EUKB 5D2LF 1A6UH 2DQDL 3QHZL 4MJ6A 3UJTH 1TXKA 1QBMH 3MRIA 3VFUB 3VMOA 4LOUD 4IRSC 4HWZA 1QRKA 2DQJL 2MQCA 1BECA 4I0PA 4Z95L 3DXAD 5JA8B 4TRPL 3I75A 5D1QB 1X6NA 4K07A 1ZT7A 4M93C 1CT8A 1KIPB 1SYSB 5GGVH 1BOGA 4QEGA 4NHUA 3MYZA 4N8CH 3JWNC 4A6YA 3EDFA 1FDLL 1QFWH 4PR5B 3AREB 4FQXD 4J12A 2P8LA 1RJLB 2V9RA 1GZPB 4WWKD 4XMPH 2NY5H 2ZUUA 4IOIB 3KAAA 4U1JA 4OCYL 2GITB 3FT4A 3TVMB 1B4JH 1J0KA 4JFQB 3HZMB 1U3JA 4PTTA 5A2KH 3WYRA 2CK0L 5DHXB 5FHAH 1BD2B 4OM0H 4PD4J 2FO4B 1ITCA 3U4EB 4QY8B 2DD8H 3WNNA 1IGYA 4HJGA 2VWEE 2W92A 5ANMB 4P57A 1R5IA 1LEIB 4P23A 4HKZB 5BZDB 4Y5VA 4IMKA 3GM0A 1CLYH 4OQTH 3CX2A 5FUZL 5EBWB 5D2LB 3CC5A 4CW1A 4ZFFB 4DKEH 5CSZA 1IAOA 4IRJA 4YWGL 5BRZB 1U8MA 1BM3H 4LIQL 4ZTOH 3VRIB 4FZEL 2E27H 4LQFL 2EDKA 1EEZB 4MXWL 3GGWB 3GSXB 4LLAA 3TNMA 5K9KB 3SEPA 3BN3B 1T21B 5F6HJ 3MRFB 1BVLB 1GOGA 5H37H 4QRTB 3THML 4Z77A 1IQWH 4P3DA 2AQ2A 1EGJA 2CIIA 4Y19E 1DUYA 2LVCA 5HGAB 1E28B 2AEPL 4KUCF 4YX2L 1QSEE 2FCBA 1OGTB 2HKFH 2BC4A 3MUGB 2HH0L 3MYJB 4JO1H 5K9OB 4G8GE 3CXDL 3O3EA 1OW0A 4DGYH 2Q3ZA 1OP3H 5IBUB 2LTQC 2H8PB 5KVFL 1MI5E 3T1WA 4XNZC 1VKXB 4NQDB 3BO8A 3NCYP 4KZEL 4QOKB 3QWQB 3Q3GA 1CLCA 1A02N 4KGLA 1IKFH 2YXMA 2M2DA 4XPHL 4GO6B 4GRWH 1MCWM 2MWCA 3H0TB 5I1CL 1AC6A 2V6HA 2RHEA 5GQBA 2FGWL 1Q94B 4HXBH 4QHKI 2VR5A 2CJUH 4O5LH 4UV7L 4XRCA 2G60H 1RUQL 1TCRB 1A7PL 4G6FB 4R4FL 1E6OL 1EERB 4U6VL 3G04B 5SX5H 4OLVL 1T4KB 1IAIL 1JGLL 5EN2B 1UWEL 2ATKA 2W9DH 4PGCA 4OD3H 4WFHE 3VA2C 4DN4H 1TQCC 3WFCL 3JWOL 5D4QA 5C0FA 3GB7A 1INEL 3CUPA 3U7WL 4BZ1H 1LE5A 1NGQH 4QRQA 4I0PD 1MLCA 4X9FA 1U6AL 3QISA 3VGBA 3B3IA 5JQ6L 4X7CC 3IXAA 1XF4A 4M7KH 3B9AA 3D69B 1HILB 4L9LC 5DMIH 4HWUA 3RL2A 1FORH 2IANB 4WHYH 5KTEL 1F11A 4XWOD 2F8OA 2BY2A 4J3XA 3RUGB 4DEPB 5KANI 5EU3A 5HDOA 3IU3B 3D85B 1WBZB 4LLUA 3WKML 2J88H 2PTUA 4K3HA 4K9EH 1JPTL 4GS7C 43C9B 4HBCH 2ADIB 2YA1A 4CVXA 1A9BB 1NAKL 4PG9A 4DZBB 4IS6A 1B6DA 1FCCA 3V79C 1OLZA 3UTTA 1CIDA 1QACA 2Z0BA 1AO7E 3MV9E 4WI3A 3ZSTA 1VEMA 4XVJL 3HPLA 3EJYD 4C56E 4MD4A 4LRIA 3MLYH 5E9DA 5TQ2H 1Q9OB 5CJXC 3IDYB 1MUJB 4KJPC 4KUZL 3L3HB 4K3EH 1N6VA 2JCCE 3QYCA 3BDYH 1ZMYA 3FOLB 3MRRA 2DM7A 4HGKC 4PBVC 5JHDE 3VMNA 5JQHC 4IRJD 1TDQA 4F2MA 3TN0A 4FQLL 3EO0A 1J10A 3RKPA 3L7FB 1NGZA 3ZHLA 4XP4H 3M07A 1R24A 3HR5A 2E7HA 3F7QA 5INDA 2OTUB 3WJJA 3B2VH 3N06B 1IEAB 2EC9T 3ZSSA 1RFDH 3I84A 5EU4B 5AWNH 3IDXL 3MZGB 5CZXC 2APFA 2YEZB 3ZMRA 3W0WA 3OGOE 1TVHB 1X5LA 4L29B 4IOFC 2A0LD 4F80A 3LH2H 1RUML 2WIIB 3RDTA 2APBA 3IDJB 3IF1A 1UFUA 3CNKA 5B3NA 4PIRF 3P73B 2X42A 1S9XA 1HHHB 5IQ7H 1HQ4A 3O2DL 4HHAA 1FSKC 3WO4B 1FPTH 1F4XH 3KYOA 5GGRY 3ARQA 3IKKA 4ONFH 3ILQD 1UH3A 2R0KL 4H5SA 5ICXB 4YDIH 1F4WH 2J4WL 3IU4H 4FFZL 1XF3A 5C07A 2NY5C 3WEXA 4C57C 1MH5B 3NCBB 1GYAA 2XOTA 5D5ME 2AAVA 4BSWB 1L7TL 4NRYA 2AJ3A 3SBWC 43CAB 3BHBB 1KB5A 4F58H 5BVJA 1T2QH 4ZQKA 2QHRL 4BFIB 2H1PL 1RIVL 2A38A 1DN2A 4KZDH 4NN5B 1M7IA 1JRHL 3SKNA 4WW1A 1KLUA 1LO2L 1DBJH 1HH6A 4HD9A 4ZTPH 3RWDA 5HHXL 3CFIC 3G08A 1BQSA 3KPMB 4Q74A 5C0ND 4B7LA 1PG7H 3U48A 5HGBB 1JPGB 3VH8A 4KPHH 3EHBC 3QDHA 4MB5A 4UQ3A 5E95B 3EYSL 3MLSH 1XF2A 1CR9L 3ULVH 1A3LL 2AKRB 2L4OA 5TQ0H 4MGXA 4WI9A 4K3JH 3JZ7A 2V5SA 4UIMB 2HLFC 3UTTD 4JDTL 2ZKHH 1S9WA 1MVUB 2X9YA 3MBEA 4WI6A 3VWKB 3X12A 4ZSOB 4FFYH 4LHUA 5E9DD 1FFQA 4GAYB 3RQ3A 3AY4A 3BJ91 2YBRA 5B39A 4KQ3L 5LJYH 2C5DC 4HPYL 2FJFA 3S96B 1MFCH 4P5MA 1QLRA 5SWQA 4CL7A 1OCWL 4OJFL 4X7TA 4R8WH 3MV8B 3PHQA 3DRQB 6CGTA 1A7NH 2BSSB 3X3GL 3FN9A 4Y19A 3U7YL 3ILPB 1G7JA 5KSAC 4RA3A 5KSBF 2X1WL 3G5YB 1QSEA 2AK1H 1OLLA 3PNWB 5F88B 3WJLA 4MAUH 4G8GA 2QTEA 3MCLH 3IFNH 5TPWL 1GH7A 3W0WD 5EO9B 1D5BA 1MI5A 5MENE 4JDZA 3QT2A 1JWSB 2HTKC 5DQ9B 3RVUD 3QG7L 5DC9B 3RDTD 5I1HL 1NFKA 1J0ZA 4OBRA 3EOTH 3ARBA 4XCEB 4U1MB 2VTFA 4ZO7A 4Z0BL 4ELKB 5ISZB 4HBQA 4NPYA 4QHUA 4ZUVA 4NUGH 5EORL 3HRPA 2IF7A 4XP9L 5E1HB 2VZOA 5C07D 4HLZG 1MWAB 3GJEA 2DMBA 4YHPB 2OL3L 4PRAA 3U7AA 1IGIL 4OGZA 4L1HA 4M6OH 3M17B 3STZA 3GBNH 3PWNB 5I8KH 3LKPB 3P30L 1CGVA 4KTYA 2VXVH 2X4RA 1HKFA 2G9HB 4GG8A 4XNYH 4TVPE 4UT9H 5D2NE 1AGDA 4WTWA 5EPMA 4HPOH 4A2MA 2J1KA 5IUSA 3MRQB 5DHVB 1MFDH 3RNQA 3WFEL 3S3PA 5F7YC 5KVEL 2KPNA 4P23C 4YHLL 1E4XH 1T3FB 3QJHB 4K94L 2H45A 4IMKC 4PJEF 2GY7B 3BP6B 5EO0A 4H1LA 2OLDA 1W2KT 4RISL 1FLRL 4PLJC 3ZL4H 1YEEL 2BOBB 1WUNT 1F3DH 5SV4A 5J1AB 3T1FA 4BQBA 1U8NB 1S7XB 2XQYK 1AO7A 1WFOA 3MV9A 3I6KA 3DUUA 3EYUL 1A47A 3ZDZF 4N0CD 1DLFH 1Q1JL 3LAFA 4C56A 2H2PC 1OAYH 5DK2B 4EUPH 3B9KB 4L8CB 1LEGA 3HNVH 3RVVC 5JORA 2J5LB 3H9ZA 4N5EC 1M1SA 1FP5A 2OK0L 4HT1H 4NRZB 4QWWC 4OLUL 1VPOL 3LKOA 4XGZA 2JCCA 4G7YH 5JHDA 3FN3A 4LHUD 3B9VA 5CGYD 2ARWA 2LV4A 1PZUB 3JTTA 1IAII 4NQSB 2CRIA 3P0YL 4AL8H 3A6BL 1RZGA 1NKOA 3EO9H 3DIFB 4ZG1A 3ZT6A 1YPZB 3U9PH 1L0XA 4IEFB 4YHIB 1YYLH 1HN1A 3TNNB 1UACH 4Y19D 5GISL 3MMEA 2NZIA 2F58H 4K3GA 3HAEB 4I3SH 1G9NC 1QSED 2P24A 3JV4A 3WFBH 4UTAL 3NA9H 3PGDB 4LKXA 1I3RA 1LO3H 3LS4H 1JFQH 3MRCB 1FH5H 4G8GD 5IMKB 1QHOA 2NCMA 1XGTA 5DMKB 2M1KA 3BEWA 4J3OC 1MCJA 4FTVB 1MI5D 4PGDA 5F72S 2GI7A 3BH9B 4NO5A 2GJJA 2FD6H 3VFRB 2VQUA 4C58B 3PL6B 1PY4A 4L4VE 1ACZA 1OAKL 5I8CA 1S7VB 4KV5E 4OQ1A 3V7AE 3VG0L 1MCLA 3ARBD 1TZGH 1RURL 4UDTA 3NCFB 2EICA 1J1XL 5IB3A 2BSTB 2H26A 5DEGA 1JHTB 1XCTA 1GHFL 3C6SB 4GBXA 1UVQB 1ONQA 5D5MA 1ED3A 4Z6AT 5B38G 1YN6A 4PGZA 2VLRB 1J8HB 5DJ0A 1KELL 1DUZA 1FGNH 2YZ8A 5C7XL 4XC1H 4QXUH 3HFML 4M5ZL 4GW4A 3OR7A 4HK0A 4LNRA 3RKDD 2XWJB 4WFHD 4TPRH 1ORQB 1T1WB 3UTZB 3KJ6H 3EKCA 3QDME 4DW2H 2ZOKA 4LCWB 2PW1A 1TCMA 2B1AH 2CLVA 4Y4FA 4PJAB 2J3SA 4HIJA 2CR6A 4P9HC 3RPIB 3D0LB 1R6VA 4UZGA 1N59A 2B20A 4M7JL 3FQNB 3SO3C 1XIWC 5ERWB 5T3ZE 3HNSH 3MJ9A 1HINH 2MTPA 1DFBH 1DQMH 1RZ8B 4JFPB 3CLEH 4XNXH 2NX5E 2VXUH 3L9RA 3SY0A 1S9KC 1R0AL 2PN5A 5C9JB 3PWLA 4S0SD 3TN0C 4QYOB 5T1MB 5ESVB 4XX1G 1G9MH 2R2EA 3RTQA 2FSEA 5AZ2L 3VXPA 1FAIH 1ZV5A 3MRLA 2NXYC 1AO7D 4OV5B 3MV9D 1JYNA 4N9GA 3SDDA 4GFTB 3M8OL 4C56D 3MOAH 4ERSL 5EC2A 4KHXL 1HYSC 1HK6A 5FA3B 4RMVA 1UKQA 5E08H 1DBKH 1UG9A 1BQHB 3P4NA 3U0PA 1S8DA 3LZFH 5DDHA 5CJ8A 2GFBA 3MRGA 4RFOL 3S5LG 3DO7B 1RUPH 3TIEA 5JHDD 2R2BA 5GZNC 4IRZL 4JCLA 3LN9A 4KKCC 4JQXA 2ZZUT 1ZSDA 4HH9A 1TNNA 2DRUA 2LVEA 1CGSH 2GK0B 1UZ8A 5JMOC 5D1XA 3LEYH 3AROA 3UMTA 1A6AA 4UT6H 1FV1B 1IQDA 2OS7A 3QIUC 4XC3L 4FFWD 3GMLA 4GW1A 5MEPA 4YXLH 3T0VA 5CZVL 4MNHA 5CP3H 4Z78A 1XGPA 2XRAL 3TCLB 3QEQE 5MENA 5E56A 4HIHB 1NBZB 5EU7E 1QBBA 2ZCLL 3DRTB 1RU9H 3QUZA 3MA9H 2VLJB 5DEFB 1CXKA 3S4SA 4ODVL 3HZYA 5C0GB 3BAEH 1IM9A 1VFMA 5DJ6B 4X5WA 1AGCB 3MR9B 5D6CA 4YBLB 4N0FA 1FN4B 2A74B 2ZSWB 4KH2A 5DI8A 1KTKE 2W60B 2FX9L 1XEDA 4LSTL 3ROOA 1ROWA 2G5RA 4GBXD 5MP6L 1GGIL 3SDYL 1HH9A 1M7XA 4DAGH 4BQ9A 4TUOB 5CBAB 1BREA 1F4HA 1KXQE 4HIIA 4UIKH 2EO9A 4R4ND 3L5IA 1QNZH 5D2NA 4EQ3A 1URLA 3AS0A 3QJFB 4G9FB 4UTBL 2Z92B 3L3KA 4NFCA 3CU1A 4DGVH 1RJZB 5HYIA 4Y4FD 4KK9C 4HWBL 4C4KO 3DVGB 1FGVH 5FDWB 1BX2A 4NKOA 2AJSH 1D5IH 1ES0B 2YD1A 3H3BC 3OAZK 2BDNH 2GJ6B 1Z2KA 2OTWB 3MBEC 5CKGA 5I66B 1EV2E 1N7MH 3MFFA 4PJ7F 5D1ZC 4O9HL 3U30C 4DKFH 4X5XB 4U7KA 3DSFL 3GSQB 3QHFH 4MCYB 1CXEA 3GHEL 3U0TB 4Y4HB 4NN6C 4KRMB 2Z31A 1CK0H 5C2UB 3MV11 1X3DA 4KK5D 4N1HB 3HZKB 3O4OB 2AJZA 5ADPH 3QQ9C 4NJAL 3H42H 4WU5A 2B5IB 4Q0XH 4JFXA 3GSUB 2RQ8A 4TTGA 4G42B 1RD6A 3SDDD 1MHCB 2AXJA 3BP4A 3KLHC 1F6AB 2X1PA 1OQXA 4FQ2L 4JLRB 5H2BB 4D0BB 5E2UH 3VD5A 4M7LL 4M6ML 5C09B 4Z18A 1SY6H 1KEGL 5CJQL 2Z35B 1NLBH 3HE6A 5INCA 2WBJA 3WIIH 4NM4L 1SJEA 2R69L 5FA4B 4UB0H 1OD9A 4LCCA 3BZEA 1YEIL 3V6ZB 3TV3H 4G80A 3WXVL 4NOBA 2LAAA 5D1XD 4JFEB 4X6EA 1TLKA 5IB2B 1LGVA 1QRNB 3D0VB 3HNTH 1I7UA 3MXVH 1NL0L 4LFHD 5E2VH 2YMXH 4YNYB 1WCBA 4ZDHA 4XXCC 1I4FB 4WO4B 3CFEA 3STBA 3BT2H 3WLWD 1PY9A 3BGMB 5GSVB 1LE9A 5MEND 3UDWC 1NC2A 3FCTB 3V0WL 1I8MB 4YXKH 4JR9H 2D7PA 4OTXL 5LWYL 2P7TB 4L4VA 2JELL 4TQEH 2EEAA 3QUZD 2XICA 4WTXA 1CG9B 3PP4H 2JF1A 1KT2A 4U1SB 4PJ5D 2VABA 1U92A 1IM9D 4FS0A 3I9GL 1KBGL 2QQNL 3BKCH 5GRVL 2ZG2A 2OR9L 4X6DB 2N56A 3OKKA 1HHGA 5CIPH 4OZ4A 1N3NB 4NGHL 4RZCA 2Y36L 5TGBA 5DJZB 1IMHC 1XGQB 4OCWH 1HQRA 5IQ9A 4QCIB 1D5ZA 4R2GC 1G9MC 3QDMA 3GMQA 3C2AL 1NBVH 1TTGA 4LDLB 4MZ3A 1PJ9A 2FEDD 1GOHA 2NY3D 5FKPB 3SDCC 3BP5B 5K9JH 4TVPD 3G6AB 1RPQA 2X6MA 2MPAH 3GSNH 4L5FL 4CMHC 1ZEAH 3O9WB 4WI2A 3HI1A 4JFOB 3TEUA 1TZHB 4FNLH 4JO4H 2O5YL 4DVRH 5EG6C 4K8RL 3DPBA 5DUPL 1SBSH 1PKOA 4GW5A 2A1WH 2IALB 2NX5A 4I0KA 4DGIL 4P4KA 5KSBE 3N50A 1YNLH 2OL3B 4YR6A 1CL7L 4U1NB 3MACH 2OSLB 3KPQB 2ESVB 3RY5A 3SE8H 4KFZC 5JIPA 1F13A 1C16B 5JPNB 4R3SB 3JV5A 4U33A 5LGJB 2Y06L 4JREC 2Z31D 5ID1B 1C5DA 3QBTB 5EO1B 4AJ0A 4XZUB 5KVDL 2LABA 3NCEB 5E8NA 5LBSH 3N85H 4TSAL 5EBMB 4ODUA 1MREL 3QXDB 5FB8A 4OUUB 3C6LA 5IG7B 2XZZA 4XCFL 4BZ2H 2BNRD 3OKNA 3RIFK 4YIQA 3BPNB 1K9TA 1P4LB 3REWB 4PB9H 4R7DB 3DTXB 3D48R 4PRNA 4G43B 3TBWA 1VGEH 1WFTA 3HE6D 1V3KA 2WBJD 2WQ8A 1XGYL 1FL6A 2R2HA 3FRPA 3ZE2F 5E5MA 4PJXB 1JV5B 2KDGA 2DJ4A 1RHHA 2YSSA 3PF2A 2YRZA 3SGKA 5EBLB 5JDSB 4MS8C 3AXLB 4Y4KA 2DOCA 4DOHB 2R0ZH 1CXFA 2EDBA 2HYMA 3UXFA 1JL8A 3QEQA 2YKLL 3O3DB 1QFHA 1T0NA 5T3XL 2D7NA 4Q58C 2YN3A 5HGHB 1B6UA 4UNVA 3KPPB 4JG0H 3MLRH 4CADB 4H8WL 1A5FH 4U0QB 4U0RB 3EYFB 4ZS7H 2VDRH 2AJUL 3OGCA 1NC2D 4OF7A 4HFWA 4KI1A 2IMMA 4YDLB 1IM3B 3BVNB 3QULB 4FQ1H 2DLFH 4KI5F 4L4VD 1CFTA 3ULVE 3ZDYF 5F3HB 4KVNH 4R96A 4HIEB 4LLMA 4JRXB 1G0XA 5I76A 4HUUA 3FO1A 1N5AB 4XMKH 3QQ4B 2GIYA 4KKAD 3CK0H 1X5AA 3U4BH 4OF3A 5DJXA 5ACZA 2CSPA 4YE4L 2F9BT 5BV7L 1C5BL 3GHBH 9CGTA 3SCMA 4OQTA 5CCKL 3G5ZA 1OGAE 2YOCA 5DF0A 5F9OL 4F7MA 1JIBA 2GHWB 4WEBL 5SWSB 2VSDA 3MTRA 5DK0B 2GT9A 2Y5TA 3U79A 2ZP0T 3OB0K 1C8PA 5HJ3B 2OCFD 2AXFA 1F3JA 2AXHA 3UPRA 4UU9B 4QRPE 1B0GA 4YGVA 1S7SB 3QDMD 1MCKA 4ZXBA 5IEKB 5F6IB 4QTHA 3DUSB 2NYYC 3T0EC 1OPGL 4XH2A 2XZCL 4S1DD 4TULH 3RTQC 1IC4L 5BOPA 2NTFB 4HDIA 4NC2B 5I74C 3HKFA 1S7RB 1ZS8A 2VL5B 3BIKA 2HFFA 3I02A 2PW2A 2MJWA 2BFVL 5IEHA 2CIKA 3CCHA 5AUMA 5T3ZD 3HB3C 1CDIA 4LEOA 2A6IA 4PGEB 4P4KD 1EO8L 1P2CA 5E4EC 3VRLE 4S1QL 1MCQA 4CRPA 5DJDB 5IHUH 4OB5H 5D8JL 1ZA6B 5ICZA 5CD5C 4P2QB 3D5OF 2EIZB 2R15A 3OSKA 4QNPE 5D93B 5DMJB 1YEGH 2X2YA 2XZAL 5K9QG 1RZFL 3WD5H 2ARJB 3GKWH 1WBXA 1Z9OA 4X8XA 3MNWB 1YEHH 5FYKE 1JGDA 3C6LD 4M5YH 4TNVK 3WLWC 1QPXA 4FFVD 1QP1A 4YO0A 1JUFB 2NY4D 5J9PB 3D3VB 1JN6A 5JW3H 4W4OC 4PJBB 5IW6B 4M62L 3TJHC 4ZFZA 3OB8A 1B0RB 1T04A 4UQ2B 1I8KB 3VFNA 2PO6B 3ETBF 3GRWA 4Q6IA 4M61B 7FABH 4E41E 3BESR 3DMMC 2V2XA 4LARH 5I1KL 1MCSA 4UDUB 4Y4KD 5D7IB 3LHPH 3W9EB 4I77H 4G6MH 3QI9B 2B8OT 3OKDA 3QEQD 5C9KA 4GKSA 1H3UA 1VFUA 2NY6B 1JHKH 4HXAH 1AJ7H 5GRZA 1N6QL 1Z3GH 3NCJL 3UJIL 5EOTB 3HPJB 5HHME 4RNRA 3OX8B 1W72H 5L8LB 2JKXA 5I16B 4I48B 1G7IB 3MJ8A 4ODWA 5DD5H 4WV1B 5GJTL 4YDKL 4P3CL 1J5OH 3E6HA 4FHBD 3QO1A 1RZ7H 1DZBA 2IGFL 5DR5L 2E8YA 5C08B 4JRYD 4ZODA 2DI8A 4UUJA 5I1EL 1PAMA 4JKMA 3D25A 3G6JF 1C12A 1SYVA 3FOMB 3WKNA 3N9GH 5GHWH 5D1QC 3N1PC 4CDHA 4RWYL 3OKLA 3QFJB 3SQOH 5JW4R 2X70A 1Q9WB 2I24N 1Q9LA 4POYA 4ODSL 3AREC 2LE9A 5F7EL 1CFQB 4KTDL 1EO5A 4ZXBD 3QUYD 2Q86B 1PEZA 5IROA 1P9MC 2H32H 1UWGH 1ZLWH 5C92A 4FXLA 1ZANL 4CMMA 2UZIL 4P2OA 3TVMC 4BSJA 2X1OA 5HY9A 5KSBA 2CGRH 3HUJE 1FCGA 3FQTB 4K3DH 4ZFGL 3MRJB 2W9LA 2Y07L 4NKIL 3DX7B 2R4SH 3SDAA 4X99B 3LV3A 4U1HB 4YC2B 3UPCA 35C8L 3IT8D 4OKDA 3MO1A 3B9EA 3O6ML 3FFCE 1BVKB 1KCUH 4GKZB 4QRRE 3LKSA 1T1YA 2BVEA 2HAZA 4KKBC 2DQUH 3QG6B 1KJ2H 3KWWA 2R2CA 2ITDA 2MCPH 2HJFB 5EZJB 1JNNL 4EI5A 4MQ7B 3RWIA 5E99L 4AG4L 4PJGE 4WJ5A 5IM7B 3UROR 2Z91A 5M94B 4JY5H 1PSKH 5T1KD 4CVUA 4F37K 4MDIA 2VDPL 3AU1A 1OP5H 4LLQB 5DVKA 2B7DT 3CLFH 3WE6B 4HKXA 1MJ8H 4GAGH 4F7EB 2C3XA 1OOAA 1OF2A 5GZOC 1A4JB 2E9JA 4NQCD 4PY7A 1U3HB 2D2OA 4HEME 1FVEA 5HYSG 2BVTA 3GKZA 5ITBH 2FJGB 1A6PA 4M1DL 4NO0A 1RAMA 1MRDL 1T1XA 1I8IB 4D8PA 2KQNA 1S9YA 4PJ7E 4L3EB 4X4XA 1T7YA 5E6ZA 2FATL 4R26L 3L6FA 4PJFF 3VU2A 4AEIL 4P5TA 5K9QI 1A1MA 1S7TA 3LN4A 2XQYG 1QQDA 3PWVA 3P9WB 1XGUA 2UVEA 1OGAA 5J11B 4NSKA 5DRZA 2JK5A 3LEVL 2WMPA 3KDMA 5TE4L 3VFWB 4JQVC 1WEJH 2X9WA 4LLDB 1OB1A 5MEQB 2YD3A 4NKDB 1RI8A 4QRPA 4WW2F 2XWTB 3V8CA 2D7TH 5IMLA 5D72H 3S88L 3RAJH 3RVTC 3IDUA 1F45A 3O8XA 3E6FB 5LQBH 3AS2A 4ELMF 1D7FA 4BFBD 5EU5B 1YY9C 3OAYK 4LBEA 2IH1A 2VXSL 4GXVH 1SVCP 4Q6YA 1WIOA 1UXSA 3NZ8B 4LSQL 3DETC 4MWFB 1BFOB 3KLAA 4HJ0D 4YAQA 2OBGA 3P4OA 1MWAH 1RK1B 1ZVHA 5GS2H 1OAZH 1TVDA 2FO1A 1I1FA 3ULUL 3SPVB 4P2OD 3KPRE 1TJGH 1KEML 4JO3H 2Z93B 4LVOB 5DTFB 4JPKL 2VE6A 4XBPB 3EGSA 2HLAA 3BISA 3X11B 1NAML 5C0BB 1U58A 3SDAD 1UB6B 2NY1D 3TT1L 3TJEL 2A77H 5DHVH 3C09B 1S5IL 4G5ZH 2E7CA 5DJ8B 3F62A 2DQDH 2E9BA 4B41A 4PTUB 4JDVB 4NCDA 4R7NB 3BD4A 1I1AB 3WUWG 2DQJH 3BN9C 3EDDA 4Z95H 2P5WE 1CVSC 5EU7C 4GKNB 5IJVA 5A2FA 2Y7QB 3TH4T 4TRPH 1RZKL 3P77B 3BPLB 4JFZL 3ZYIA 1JPFB 3EDEA 3MQIA 4ODBD 5FO7B 3LB6C 4ELMB 2W65B 2O61B 1Z0NA 1FDLH 4E41A 4WU7A 2NW2A 3QUXB 2YPKB 1UXWB 5F3BA 4BH8B 4MAYA 1I1YB 4L1DA 1AC0A 2A83A 2ARJQ 3U83A 3QEHB 2ICWJ 2XA8L 1WZLA 4OCYH 4F9PA 3DI2B 1GOFA 3SCMC 5IK3B 2CK0H 4NOFA 5DC4B 4KU1A 1ZOXA 5D6DC 4H0IA 2APVA 2Q7YB 4XBGA 3O45A 5I2IA 1PLGL 3UP1A 5FECA 1D9KC 1EJ6A 1FL5B 1Z9LA 1MJJB 4CU6A 1T22B 4QF1A 3DJ9A 1KPUA 3ES6B 4M8QB 3ULVD 5DVLA 1AXTL 3HAEH 5FUZH 3QXAA 3QIWB 4PLKC 3MLWL 1QFWM 4P5TD 2Y9RT 4GAJL 4LIQH 2BVOA 2PYEB 2NQCA 2P4AB 4FZEH 5DRNA 1XR8A 1OGAD 3FB5B 5DMGC 4MXWH 4LRNL 4ZUTA 3UTPE 3VXTB 4MSWB 1E4KA 2FBOJ 3VWJB 4NUJB 4OLZL 1UCTA 3THMH 1IGJA 4HUVB 4NN5C 4AIZB 1WTLA 1I9JL 4YDJB 4L3CA 1EPFA 4QRPD 2F74A 4XHJC 3VXSE 1N8ZB 3CFCL 5JDJA 3OR6B 2VZ3A 3HI5L 3O8XD 3RU8L 1WAAF 5KVMC 2HH0H 5C6WH 3QFDA 4DVBA 3CXDH 1VFAB 5BV7B 3ZE2E 2QQLL 3OJDB 5KVFH 3QSKB 3IJHB 3HUJA 4KZEH 5B8CA 4NC1E 1U8JB 3C5ZB 1NFIB 4HS6B 4NRXA 5SWZB 4XPHH 2UYLB 5B3JF 2CKBB 3L3OA 3QEUB 4U6XA 1FVCA 4XBEL 4PREA 5I1CH 4KK8D 4JFFE 5C6TL 2PCPA 1SVZA 2FGWH 2XTJE 4JPWL 1T83A 4PJ8A 1FE8L 4KJWC 4NO3A 1LEKA 1I75A 1V3MA 2X4OB 3FFCA 2BOCB 4QRRA 4UV7H 1BZQK 1RUQH 3D2UD 4QRSB 1A7PH 1KC5L 1E6OH 2EIEA 4U6VH 1K5NB 3TO2B 4OLVH 3ZDYE 5HHOB 1IAIH 3EOYG 1JGLH 1VFOA 6FABH 5IKCA 3ZE1E 3WFCH 3JWOH 1INEH 3U7WH 2IFFH 5T33L 4PJGA 5DVNA 1A6WL 3I50L 1GGCL 1Y18B 5F9AC 1B4RA 1Q38A 3VFTB 4P5KA 4NFDA 1H3GA 5E2JA 1AHWB 3O6KL 1P5UA 4RFEB 1SEBA 4JKLA 2CDGB 3FB6A 3P9LB 4RDQG 5L7XL 4O2EA 2E7MA 4E41D 5KTEH 4GMTL 4S11A 5JNYB 4U3CA 3K46A 4MAYD 4NKQB 4RAUB 1INDL 1T1ZB 3LQAC 3EYQD 4MCZB 3RY6A 1NBQA 4PRDB 4MA8L 1JPTH 4RIRA 3RVWC 4F7TA 4OIIL 2AEWA 2HTLC 4YHOL 5HI3C 3HLAA 2EH7L 2XV6B 5I8OL 4H26B 1J9CT 4ODTH 3BI9X 3WN5B 1GGUA 1MHPL 5HHMD 2EKJA 2X4SA 2P48B 4XVJH 2IPKB 4GH7B 4PJ7A 1MIEL 1MCEA 4OCRL 2FH6A 4YPJA 4OZGF 5EIQA 4ZUSA 1NFDB 1JWMA 5F1OB 3IVKA 2ICES 4Y2DB 1LP9B 1S7UA 4UT7L 3F7YB 4KUZH 3IFLL 3QEGL 3QO0A 2YPVL 1HXMB 4LK4A 5IROC 3UBXG 4DZ8B 4LU5L 4FQLH 3FZUD 4P2YA 1EHLL 1NDGA 2IAMB 4KTEL 5J4MA 2IMNA 5FF6A 2NW3B 4Y1AD 5HYJB 3AM8A 3TYFA 1JF1A 3WXWL 5C0DB 2WLZA 4A6YL 2DWEA 1ODAA 5D7JA 1ZT4A 2BZDA 2R1YA 4PJDF 3MLPA 2RJMA 3SKUD 4ZNCD 2VSCA 3IDXH 3CVHL 1CD0A 5ANME 3Q5TA 3OJMB 4OD2A 1FJ1A 3KPLA 4DUWA 3DWTA 5E1AB 1Z5LB 1RUMH 1YC8A 5MEOA 3KPRA 4NO2B 2GSGA 4GT7A 5GRWA 4HCRA 3WMSA 1QFPA 3MLVL 1YNKL 2KZWA 2FH8A 1HWGB 3O2DH 5B38A 3NAAL 4NZUL 2QKIA 3WLBB 1KF9B 4YDVB 3B9KC 1NC4B 4OZGB 4EI5C 4M00A 2J5LC 1JP5A 3LRHA 3ESUF 1BWWA 3JUYA 2R0KH 4LF3B 3VG9B 1ZGLM 2BP3A 4JZJA 5JXAL 4EDXA 1WWBX 3PE9A 5FKAA 4OLWL 2J4WH 4FFZH 4PJ8D 4Z7NE 4V1DB 3IFPB 3FFCD 1VEPA 4QRRD 3L3GB 1ZAGA 3H7BA 1CF8H 1J88A 1L7TH 1NSNL 4JM2F 4Z7VF 3NVQA 2P5WA 4M93B 2HMID 2F19L 2WLYA 1EXUB 1PD6A 5GGSA 1HNFA 1KACB 3QDAA 4QOKE 4YHML 3OXSB 2QHRH 2H1PH 3DBXA 2FX8L 3G6JE 3GK8L 5C86A 4BH7B 1JRHH 4RWHA 1AGEB 1X5ZA 4RAHA 1LO2H 3RBGA 2YHGA 1I3UA 5CINL 5HHXH 3QWOB 1AP2A 1GPOL 3P4LA 1NGWB 4XPFL 1MEXL 5CBEA 4IHOB 1CXLA 1LVEA 4BSVA 1MFAL 3PL6C 3VXNA 2F5BL 3EYSH 1CR9H 1PQZB 3CH1A 4NQXB 4P48A 5FXCH 1A3LH 1WC7B 1WWWX 4XPBL 5B22A 8FABA 5C0EB 5DZOA 4X9HA 2CLRA 3S5LA 4HMEA 1RUAL 1U93A 2BXYA 3PABB 5C0JA 2YA0A 5D70L 1OM3L 5L2KE 4R90L 4JDTH 2UUDH 4ONGH 4X7DC 4CVZB 4JG1H 4X7EC 1KIRB 2ID5A 1AIFB 2E3VA 4XTRD 2YD5A 4JN2B 2FYYA 1P1ZB 3QRGL 5IBTL 4HPYH 2HT2D 4CN1A 1OCWH 4OJFH 5MERA 4WGVB 1Q0YH 1SY6A 5E24E 5HHNA 1WWAX 2UWEF 4QT5A 3FO0L 2EDNA 1W0WA 2VIRB 4QHMB 1T03L 3X3GH 4FMKA 3U7YH 3F12B 3VXSA 3VFPB 4L9DA 2CUHA 2FEEL 3WS3A 3LSOB 3C60C 1WVZA 3DGGB 5EIIB 1M6OA 4OKVB 4E0RA 4CVWA 5D7JD 1V5JA 2V17H 1CD1B 3MLXL 3FONB 4DCQB 5K59F 2ORBL 5ENWB 2HN7B 5CHNB 1DBAL 4PRHB 1M4KA 2BVQA 3IJYB 4Y7MA 5CEZL 3QG7H 5J56B 2BNQE 5I1HH 3HCVA 2BY3A 5FYJU 3KPRD 3O0RL 2AV7B 5HSFA 5ESAA 4JFFA 4XCNA 3QUMH 5E6IB 2BNUA 4Z0BH 3RVXC 5ALBL 1OTUD 1R3JB 1WBYA 1YDPB 4RDQF 1QLFA 4OLYL 1W8OA 3BMVA 3P40A 1F42A 1ZXQA 5IHBA 3P4MA 5EORH 1YMHB 2DM3A 4U6HB 4XP9H 4TTDD 3W2DL 1ND0A 2H6PA 5C71A 3Q6FA 4GRLA 2OL3H 4YFLI 2X05A 5CIPA 1IGIH 1AY1L 1EVUA 2VOTA 3ZTJG 3H7LA 5J6GA 3WIFA 2XKSA 3MJ7A 3OPZL 3P30H 5I9QB 1A8JH 2P5WD 5ETUB 3HE7A 1IBGH 3MJ6A 2KKQA 2BHZA 4LPCA 4L9LB 1NAMB 3L95A 1H5BA 2NR6D 5ALCL 5ILTL 1CE6B 3LKRB 1EAPB 2NY2D 4XP1L 4HX1B 4JKPL 4WUUE 3WFEH 3HC0A 5KVEH 1IVLA 4YHLH 4K94H 3GSNA 4OZIF 1A1NB 4WHTA 1KIQB 4C4KT 4PJIB 1JZ3A 3OKEA 4ONOA 2EEBA 4RISH 3WIHA 5AD0A 1ETZA 1FLRH 1YEEH 2F8VA 3ULSA 4OF5A 2EECA 2FJHB 4U6YB 2MFNA 5DD3L 4KRPC 2Q6WB 4YBLC 5I8EA 1KPVB 3EYUH 4OT1L 5IP4A 2YPLE 1Q1JH 5HVHB 5HI5C 1ZHKB 1T66C 1JYXA 1Y0LA 1JI1A 5GRXG 4FP8L 2X4PB 2OK0H 4OLUH 4DN3L 3MLUH 2E8ZA 2EDYA 4UILL 2AJXL 3LRSA 1ZHLA 1CS6A 1TTFA 3FQUA 1J7VR 2V5MA 3WHXB 5HHQB 1A0QL 2V2WA 3G5VB 3SGJC 3M1BB 4RBPH 3LEXA 2PTTB 4QTIH 3UJJL 5BZWB 4B53A 1YQ2A 3P0YH 3UTPD 5A16A 1OSZB 1U8HB 2JIXA 2FHCA 3LKQB 2NY0B 3RA7L 4P46A 3GUTB 4X6FB 3NCYS 2GJZB 3ARGA 3VXSD 5ANMA 1MHEA 3CDCA 4HKZA 4UTAH 3QHTC 4NBZB 4Y5YB 1WLHA 1EHXA 5DJ2B 5HDBF 2AABL 3ZO0A 3T77B 1QR1B 1VFBB 3DXAB 2OTPA 3NIFE 3ECBA 4Z7QE 3HN3A 3SOBL 3EYOA 3BH8A 4OCSL 2C1OB 4LSSL 4S1SL 1EEZA 5BMFL 1A7RL 5L88H 3BP7B 3IRPX 2JJSA 4MDJB 3GGWA 3TZVA 3DX8A 4G6AD 1OAKH 2JJTC 1YN7A 4G3YL 4U1LB 1CFBA 4PRPB 3O4OC 3VG0H 4QRTA 3UAJD 5J1SC 5BVPL 4FQXB 4HGWB 5KVGL 2E7LA 5DMYA 5HVWA 4WWKB 2XTJD 1E28A 5HGAA 4R0LB 3OB0H 4B7IA 1GHFH 2NZ9C 1ZLUK 4HUNB 3ZKMC 4MA3A 3F5WB 5EC1B 2V9TA 5K9OA 2N1KA 2WW8A 5J13B 5FGRA 2I26N 3EYVA 5C7XH 4LGSB 2FB4H 4GRLD 4M5ZH 3ZDXF 1FLTX 4QKXB 1K2DA 4P9ML 5FK9B 1N2RB 4QOKA 4KROC 4NQEB 3T65A 2HFTA 4JGMA 5DFVC 2VDKH 3G6JA 4H0GA 3HMXL 5I0ZA 3HE7D 4OGAC 5IOPB 2Z8RA 1NJ9B 1T5XB 2VYRE 1QFUL 4X6CF 3FQWB 4P4RB 3HS0A 3T4YA 4Y5XA 4WEUD 3CDGA 3EBAA 2DBLL 1L0QA 2UY7A 1EUUA 4EEEA 1AH1A 3T04D 4KK6D 1A6VH 1NBYB 1OP3K 4LAQL 1HIMH 1R0AH 2CDFA 3C08L 4WUKL 3NFNB 2EC8A 5EN2A 1E4JA 3BX7C 1WAAE 3RIFF 4H25A 2ZPKH 4IOSD 2X1QA 5JW5A 4KVCL 5AZ2H 4PYHA 1BHGA 4PV8B 5L2KA 1X5JA 2J6EL 5I18L 3RHWK 4X6BB 4Z7OE 5B3JE 4BUGA 3IFOB 5DFTA 2L0DA 5D96B 1GSMA 4RFOH 5GRJL 1X4ZA 5IFHL 2NNAA 4LPYA 1HHJA 5SX5K 1J8KA 5KS9F 4IRZH 1N64H 3STLB 4Z0XB 5EA0L 2GSIB 3WS6A 5KSAB 1H0DA 1R3HA 2NMSA 1H9VA 3ZKNC 1XCQA 4GMSL 2LQRA 3O9WC 4WRLA 2JIXD 4XC3H 1U2CA 3CSGA 3GSOA 4P46D 1DJSA 3CXHJ 5F1SA 4NNYB 5CZVH 1A2YB 4MJ6B 2XRAH 4W6XB 3U36A 3GMPB 3BDBA 3CDFA 3L5XL 3MRIB 3MUHL 3L3HA 4HWZB 5F7LB 2ZCLH 5FM5O 2BNQA 1L7IL 4XI5D 2EDRA 4I0PB 2ZNWA 4U2YA 1BGXL 1CDJA 5IVXF 1SMAA 3L7FA 4ODVH 1ZT7B 5IESH 1CT8B 1BOGB 3TZVD 4NHUB 1AQDB 5LXGH 1W72A 3CSPA 4A6YB 2EXWD 1FFOB 2OTUA 4I9WE 5EZIL 4E42B 2FX9H 2XXCB 4LSTH 3CXHK 4U1JB 1YEDA 2K9UA 1GGIH 5MP6H 3SDYH 4LHUG 2AGJL 4PTTB 1MCPL 5I1GL 2WIIA 4LIQE 2CRZA 2AJYH 5B39G 2DKUA 4LLYA 2A6DA 1ERNA 4QOKD 1XT5A 4HJGB 3KYNA 1R5IB 4P23B 4JY4A 4WUUA 1WZ1L 4Y5VB 4JM4H 3PWJA 1A1OA 1LO4H 3QNZA 4HWBH 2R23A 4WW2A 3PJSA 4CW1B 1FQ9C 1JE6A 4GQPH 4IRJB 1U8MB 1CGYA 4PP2A 2H32A 32C2B 5CILL 5E6YA 3A67L 4U0RC 1LDSA 4FG6C 4IDLA 4O9HH 3KG5A 3TNMB 4WNQA 3UC0L 2V5YA 4YDLC 1J1PL 3DYOA 1EX0A 4TNVF 4Z77B 4WIQA 3FT3A 3GHEH 4M1CC 3BHBA 4P3DB 5DYOA 1BEYL 1CGWA 3GSWA 2CIIB 3GJFH 2YPLA 4MQXD 4BFIA 5DRXB 4G9DA 1P7HL 5TDPA 4NJAH 5L2KD 2BC4B 4PJAE 5A3ID 4XHQA 3G6DL 4BA8A 3O3EB 1FAKT 4FQ2H 4M7LH 3DROA 3LPFA 1KEGH 4MMZC 1C7SA 5CJQH 3BO8B 3MNZA 2WUBL 2I9TA 1MLBA 3VFMB 1A3RL 3Q3GB 1K3IA 2DQTL 4NM4H 1F6FB 2R69H 1KJ2A 4JY6A 5F6IC 4NCC2 2LU3A 1YEIH 1YMMB 2AKRA 1G0DA 4HMDA 2DYPA 3IDMA 3WXVH 5IT2L 1JNLL 4UIMA 4M7LT 1NL0H 1IAMA 2HVKA 3K80A 4XRCB 1MVUA 5LGKA 1NEZB 4J6RL 3VWKA 4DKAA 4J8RA 1MCNA 5IWLA 4R6UA 1K8IA 4CU8A 2P1YA 1E27A 2ATKB 4PGCB 4KI5C 5IB1A 2A2QT 5C0FB 3GB7B 4NWTL 4H1LG 3REVA 3CUPB 4OTXH 2BNQD 5LWYH 2DTML 2JELH 1LE5B 2GCYA 3AFLA 5FGCB 3IXAB 1KLFA 3DYMA 4JB9H 1XF4B 3CH8A 3VGDA 3I9GH 3UEZA 2QQNH 5ITFA 1IEBA 3ZYJA 4NQTA 1XGRB 3PNWA 2VDQL 4NJ9L 5F88A 1F11B 3T2PA 4NGHH 1TFHA 5HHVL 5ID0A 2Y36H 3Q2CA 5EU3B 3QQ3B 4JFDE 4U4BA 4Q7DA 3ARYA 4LLUB 5L8KB 4YJZL 4CVXB 4KY1H 5DQ9A 2CD0A 4PG9B 1VEOA 4X0KB 1RULL 4IS6B 1EMTL 3C2AH 3IDGA 3BEVA 2PO6C 1FC2D 3HPLB 4L5FH 4MD4B 1XIWB 4XVUD 4NP4L 5E9DB 3O2VL 5IVOA 1G7HB 1D6EA 2VZTA 4MQTB 3CSYA 2O5YH 3QI9C 5TH2A 2UWEE 4CU7A 4I18A 1KXVC 4K8RH 5DUPH 1HZHL 3GIZL 5EZOL 2NY6C 5EZLA 4DGIH 5JR1L 4F2MB 1CLOL 3TN0B 1IC7H 2XN9E 1CL7H 3EO0B 1MWAA 1NGZB 3QXUA 1WAAA 3U2SA 5CAYB 5H35A 2NXYB 1TJIL 3M17A 5DD0L 1R24B 3GMNA 3PV6B 3PWNA 3HR5B 2J2ZA 1KN4L 4URTB 5E8OA 3VGGA 5INDB 2D7OA 4LMQE 3TT3H 2YPLD 5DWUH 1MCBA 3OF6A 4TSAH 1BZ7B 1MREH 2EZ0C 3W0WB 3ARGC 4QRUA 5DD1H 1QR4A 3R06A 2W0KA 4F37F 4YBQC 3C5SA 3RDTB 3KHOA 3PDDA 1F3DJ 1DDHA 4D9LL 3HR6A 3IF1B 1SJXA 2R1XB 1S9XB 3WFDL 3BGFB 1N4XL 2VNCA 1HQ4B 5CWSA 4TVPL 3KPTA 1MY7A 4HHAB 4KJQC 3IDNA 1XGYH 1OQOA 3QIUB 1CLZL 3KYOB 3TBVA 3WDJA 5IB4A 5CEYA 1YJDL 5IJKA 3MV7B 5C8JA 2DYPD 4HGMA 2X4UA 5DK2A 5HYSA 4NZTH 1XF3B 5C07B 3WEXB 5A2IH 4GG6B 2VMFA 4NRZA 5T3XH 3RNKA 1MQKH 4HF5L 3BKYL 4MLIA 3Q48A 4NRYB 3TO4A 3VWKD 4H8WH 3DNKA 3PXJA 2A73A 3MBXL 4EN3A 5M7QA 5HGGS 1FL3A 2AJUH 4XPGL 4U1IA 5BVJB 4ZQKB 2I5YL 4OZIE 5KOVC 1U8KA 4YC2C 4WI7A 3R1GL 3VW3L 1M7IB 1RUKL 1SEQL 3SKNB 4FQIL 2BVYA 4KJYA 2DLIA 1HH6B 5LGHL 4ZS6C 3RWDB 4O4YL 3TNNA 5GJSL 2HWZL 4YE4H 3G08B 5AYUL 1FNEA 5BV7H 2VITA 5CCKH 4OZHF 4NBXB 4Y5XC 3VH8B 4M9PA 4U05A 4UQ3B 4WEBH 3NFPB 1G6VK 1XF2B 1AKJB 1NMBL 5DMKA 2AV1A 3SKOA 1W0VB 4OI7A 2VR4A 4GQ9H 3DURA 1UA6H 2QSQA 5DSCA 2FBJL 1OPGH 3GI9L 2XZCH 1S9WB 1IC4H 2B2XL 3X3FH 3MBEB 3ZTNL 4LSDA 4WFFE 3X12B 3ARXA 4LHUB 4MB3A 2BSTA 4LFHG 5E0QA 5B4MD 4YFEA 5JW4N 5DQDL 3U30B 3IJSA 4BQCA 2YBRB 4X6DE 3C6SA 1XF5A 5GGTH 4JFYA 1S5HA 2CQVA 2FJFB 5IIEA 3O4LE 4QLRA 1U3HC 4P5MB 3VFOA 1QLRB 5SWQB 4X7TB 4MD5A 4ZPTA 1EO8H 4R4BA 3PHQB 3QPQC 2P8PA 1F97A 2C3WA 5GS2D 5HYFA 2ICEA 4M4RA 1OHQA 3WUWA 4Y19B 1UCBL 2HT4D 1G7JB 1MAJA 5D8JH 3F58L 3K4DA 1QSEB 1I3GL 3LMJH 1OAXL 3V6FA 3UTSE 5FOJA 5DT1L 3TBSA 5GGQH 2XZAH 4AMKL 4PJAA 5J11C 3D39E 2LAGB 1RZFH 2PXYA 3OKOA 4G8GB 4IDJL 3Q1SL 3OF6D 3L1OL 3RPIA 2EDTA 1TQBB 1P53A 3QXWA 2IBGA 1D5BB 4JJ5A 4OLEA 2BJML 4JDZB 1AR1C 5BQ7A 4MX7A 1HOCA 2BRRL 1RZ8A 1QHPA 3X13A 3BDXA 3ARBB 4P2RB 5C9JA 4M62H 4DQOL 4XVTL 2X1XR 4QYOA 1MELA 3MGOA 4KMTL 4JM2A 3E8UL 3V0VA 4H20L 4H88L 3ZDXE 4NPYB 4K71C 2P42B 5I1KH 1LO5A 4ZUVB 3RZCA 5T3ZL 1CDBA 3NFSL 2BVPB 3C8HA 1LK2A 3GJEB 1BQHA 5E8PA 4YHYB 2JCCF 4PRAB 4LVOC 5FCSH 5DUML 4PBWD 4FQQA 1N6QH 3NPSB 3UJIH 3W81A 3BPCA 1NKRA 4POZD 2X4RB 4NC0B 3S98A 4WFEE 5I73B 4GG8B 4EN3D 4PRBA 3SKJL 1V3LA 3GSVA 2EXYC 5TFSL 1NEUA 1AGDB 5GJTH 3C09C 4ZOBA 5EPMB 4YDKH 3B83A 4P3CH 5JZ7C 5DQJA 4PJXE 4I4WA 2KUTA 1C5CL 1C7TA 2IGFH 3RNQB 4I9WD 4JVPA 2VN4A 1I1AC 5I1EH 5EO0B 4JFDA 4WW2C 3NN8A 4HV8A 1QBML 3BPLC 1AR2A 2Q3AA 4N90E 4O00A 3T1FB 5DEFA 1JMZA 2CDEA 4CMHB 1AO7B 2Y1VA 3MV9B 3I6KB 3DUUB 3T8XA 4ZMAT 4ODSH 4C56B 5F7EH 4KTDH 1DVFA 5KS9E 1LEGB 1AI1L 5JORB 1MFNA 1AGCA 3H3KA 3MR9A 2UWEA 3N1QC 1SJHA 1WICA 4CJ0A 5F9JA 3SE4C 1FN4A 2DKMA 2WQRA 4G6KH 3TFKC 1E0OB 1ZANH 2JCCB 5JHDB 2UZIH 5T5NG 1CCZA 1RK0A 2XN9A 5JOFB 4XMPL 1KTDA 5FUCC 2NLJA 3JTTB 2Y07H 1AFVL 4NKIH 4JREB 5SWSE 4TUOA 3QRFM 4OZFB 1K4CB 3O2DA 1FRGL 4LEXL 3JWDC 2IADA 35C8H 1S78D 2XFXA 3MMEB 2DLHA 5CEXA 4HKBA 1V8HA 4TUKL 3O6MH 5IVXE 3JV4B 4OI8A 4PS4L 4LKXB 1I3RB 4KDWA 4EVNA 1LHZA 1RJZA 1ORSA 5FDWA 4XNQA 1QVOB 2D9CA 2PXYD 2R0WL 2VAJA 4H8WC 3MRPA 1XGTB 2W59A 3BEWB 4ZTOL 4PGDB 4NO5B 1JNNH 3F7PC 1TENA 5I8CB 3GSQA 2DQHL 4MCYA 3VXUE 1QG3A 4UDTB 3T3MF 2VZUA 3SHSA 2DWDA 3WNLA 5IB3B 15C8H 2VDPH 4IBLT 2Y4SA 4JM2D 4I3GA 5DEGB 1XCTB 4ONHA 1L9NA 4GBXB 1F3RB 1ONQB 5D5MB 1ED3B 2Q87A 1WV7T 1YN6B 2JB5H 3RWCA 5LKNA 4G42A 1MHCA 5DJ0B 2H9GA 1DUZB 5H2BA 1RV6X 4PGBA 4D0BA 5I1IH 5AAMA 3OR7B 4HK0B 3QNXA 4LNRB 4OZIA 1JTOA 1AD9A 1YEFL 2EDOA 3AUVA 3UBXA 2ZOKB 1QZ1A 2WWKO 4J3VA 1U8IA 1MRDH 2PW1B 5FA4A 4QXGL 4C83A 5GGUA 2CLVB 1F8TL 2QQKL 4Y4FB 3O41B 3HMWH 2FATH 4HIJB 2I9LA 4AEIH 3VDCA 2YC1A 4S2SA 1J05A 1N59B 1NMCB 1LILA 3LEVH 5D7IE 2IPUK 1IFHL 3L9RB 3SY0B 3EFFB 3M45A 4NQVA 1BFVL 3JVGA 4JFDD 4JPVL 5EU6B 5F1IA 4PB0L 4DTGL 1JZ2A 2W9DL 3T0EB 4Z76A 3EUUA 4F3FA 3S88H 2R2EB 3RTQB 3UYRL 4BZ1L 3HA0A 3MRLB 1NGQL 3RWGA 3RX8A 2YK1L 3GRWL 4U1SA 3FRPG 3SDDB 2VXSH 2RB8A 1DVFD 4YPGA 5EC2B 1T5WA 4LSQH 3P4NB 3U0PB 1S8DB 5KN5A 4X6DA 4XXDA 4ZYKA 2K1MA 5DDHB 2GFBB 1FORL 3MRGB 3TIEB 4CAGA 3O4LA 3RZWA 2R2BB 1KEMH 5DJZA 3TWCH 3QIBA 5F96L 1ZSDB 4HH9B 4JPKH 4KDTA 4LSUL 1UZ8B 4OAWB 4D94A 1G0YR 5D1XB 1NAMH 1Q72H 5FCUL 3DSNA 4NT6A 2HG5B 4BKLA 4PG2C 1OAUL 3UTSA 1A6AB 1K3ZA 3TJEH 1IQDB 2LU4A 3QUMA 3D39A 3IRZA 4LSRL 3LQAL 2NTSP 4GW1B 2OZ4H 5MEPB 5IV2A 1X5KA 2KL6A 4Z78B 1UQSA 1XH3B 2C4XA 2ZCKL 2IAMC 4K3EL 3BDYL 4ODHL 5IW1A 3EDKA 3QUZB 1T0MA 4EXKA 3S4SB 1EBPA 4HKJA 3TO4C 4JFZH 5IHZA 3HZYB 3T3PF 1RIUL 2OSLA 3KPQA 3HC4L 3O6FA 4X5WB 1L9MA 1FNSL 4JGUA 5D6CB 5F7KC 1G84A 1WT5A 1A6TA 3V6OC 5LGJA 4Y4HD 5DI8B 1FFPA 5IMOB 1KJMA 5H37G 2L7JA 4J4PA 2XPGA 5ICYA 3BXNB 3QAZB 5HBBA 3VI4E 3O6LL 3FTGA 3C2SA 3QXDA 2XA8H 1WF5A 3TA3A 1HH9B 3S35L 1IILE 2GKIA 3MPCA 2WUCH 3TYGH 3MODL 4W4NA 4HIIB 2KZ1B 5ACMA 1PLGH 3ALWA 4OUOA 3L3JA 2ADJA 5GS0C 4JHAL 5EWIL 3MGTB 5LAXA 3L3KB 4PJXA 1LWRA 2VKWA 1JV5A 1Z9SA 3VXQA 1KJ3L 4FABL 3W11C 4ODXA 5BS0B 4ONFL 3AXLA 3MLWH 3OXRB 4NKOB 5T5NF 5TDOA 5JUEH 4MQSB 4GAJH 3T4AB 5J3HC 3IXTA 3MFFB 3PG2A 2XACC 5I17A 3T0AA 4IIQA 1M71A 4WO4D 2B1HL 1S7QB 4OLZH 3KPPA 4CBPA 5FYLE 4CADA 5E00B 1INQA 3L5HA 4JN1L 1I9JH 2Z31B 5ESQA 4KV5F 1RIHL 1KJVA 1YEKL 3CFCH 5KS9A 2VJXA 3QULA 4NCC1 3MCKA 3HI5H 5EOQL 1FIEA 4WU5B 3RU8H 2YRPA 3MA7A 4JFXB 1F6LL 1OTTC 3BP4B 4CDGC 2CPCA 4ZTPL 3PWUA 4WFFD 2QQLH 1G7PA 5F89A 3SKMB 3U9UA 4OF0A 2BCKA 3BUYA 1OTSC 1JI2A 4EZMA 1G7LB 3HE6B 1F2XK 5INCB 3TBYA 2WBJB 1IE5A 3O4LD 2FR4A 1SJEB 5FHBL 4WHYG 5SWSA 4XBEH 1MAMH 3QIBD 1ZLUH 3BZEB 4F8TA 1MCRA 5TQ0L 1PFCA 5C6TH 4G80B 3ARDC 3WO3B 1S7SA 2PKDA 2V5TA 1IL1B 1CU4H 3B6SA 4X6EB 5IEKA 1UJ3A 5IVXA 2IFGA 1I7UB 3UTSD 4D0DB 2UZXB 5IBLC 2P44B 2P5EE 3DHJA 2NTFA 4ZDHB 5KAQG 1KC5H 3D39D 3VDBA 3CFEB 1ADQA 1S7RA 3VE0A 1I85C 4RX4A 1QLEL 1BBJB 3RZCC 3VFSB 1II4E 4J3TA 4A2LA 1LE9B 4I3RL 3K8MA 4L4VB 5T33H 1A6WH 4HIXL 3I50H 1GGCH 3SN6N 3B2UD 2D4DA 3VXUA 1MFBH 4OZHE 1KT2B 1DL7H 1ZLSL 2VABB 3O6KH 1U92B 1ITBB 1NCBL 4YHKL 3VJ6A 5L7XH 3O6FD 4CUCA 2AK1L 2G75B 2HT3C 4KKLD 1I9RL 2NPLX 3OJVC 4LVHC 3OKKB 4Z7UF 1U8LA 5GS1A 1CN4A 5J7CC 4OZ4B 3PQYE 4RZCB 2ZUVA 1INDH 4J4PD 5TGBB 1QFWI 3MCLL 3S35X 3N1GC 1HQRB 2VH5L 3GIVA 5IQ9B 4D9RE 4MA8H 5HHPA 2ITCB 1RMFL 4OIIH 4QGYA 2EH7H 3TA3D 5I8OH 3QDMB 4G6JH 5E6IC 3GMQB 5IGXH 1MHPH 4L4TE 2HRPL 4WFED 1MIEH 1GGTA 4JQIH 1KYOK 3OMZA 1B0RA 5KBNC 3HI1B 1GGBL 4S0TD 2VDML 4WCYL 1V3JA 2QL1A 3QNYA 2EDEA 5FYKL 3IFLH 5IFJA 3QEGH 2ADFL 3U0WL 3ULUC 2YPVH 5DO2C 5D7IA 4GW5B 4I2XE 2NX5B 3MOBL 4NUGL 4P4KB 2QADC 1S3KL 4YR6B 4BK5A 5I9QC 3EOAA 4NN7C 2FIKA 1FZKA 4OLXL 3QDGE 4QHKJ 4N90D 4M6AA 4BK4A 3RY4A 5EOTA 3WXWH 2VXVL 2R9HD 4A6YH 2Y6SD 3WDIA 1CICA 5E8NB 4WV1A 5C2BL 3CVHH 4HPOL 4ODUB 5E70A 4JKWA 1LK3L 3RGVC 1QYGH 1KPRB 3O2WL 5D9SB 2NY4B 3OKNB 1E4XL 4YIQB 4RFNB 5CLTA 1RZKC 2FRGP 3MROA 4PRNB 1FO0L 3MLVH 1A14L 2EE9A 4OCMC 1YNKH 1FNFA 3QDJE 3TC9A 3NAAH 4NZUH 1FL6B 2R2HB 5HVHC 1TITA 5E5MB 2OQJA 2YSSB 1RHHB 4KMQA 1M7DB 1I9IH 5SWSD 4K55A 5JO5A 5KZCD 1B3JA 1ACYH 4ZFOA 4PJ9A 2O5XL 3U6RA 4Y4KB 1HEZB 2XG4A 4U2ZA 5HD8C 5JXAH 3BRFA 3ALPA 3NABH 1REIA 4M1GL 4OLWH 3V8OA 5JXEC 1MIMH 1OARL 2IH3A 3QEQB 1T0NB 1LNUA 1HWHB 3GZKA 1NSNH 4WHDA 4HQQL 4RX4D 2F19H 2RIKA 1OT1A 1S9VA 5K33A 3OGCB 4YHMH 2NY0C 4HFWB 5JLZA 3DX7A 2FX8H 1CFTB 1LD9B 1KOAA 4LLMB 3VXUD 3U9PL 5I76B 2YD4A 4HUUB 1G6RH 4Y5YC 4LLVA 3FO1B 4GRWF 4LOUC 4G8FA 1PKQE 5ACZB 5GXBB 2XA3A 4JPIA 2F58L 4XPFH 1ZLWK 1MEXH 2GTWA 3KNBB 4I3SL 3SCMB 3G5ZB 2QV2A 1BVKA 3RHWF 4F7MB 5TE7L 1MFAH 1FH5L 1RJYB 2GT9B 1D9KB 2Y5TB 2DIAA 1FIGL 3QG6A 4XPBH 3RI5K 2AXFB 3NIGF 3UPRB 3V2AR 2HJFA 1B0GB 4YGVB 2FD6L 4MQ7A 4FQXC 2BSED 1C08A 1G9NH 1MY5A 4ZXBB 2I07A 1RZIA 4QTHB 4TN9A 4WWKC 5D70H 4R0LC 1XZ0A 2Z8VC 4MHHG 4XH2B 4R90H 1HCFX 2DQIH 2IC2A 3GJFA 2BXZA 4HDIB 4MD0A 1ZS8B 3BIKB 5HDQL 2HFFB 2CO7B 5DJYA 5EOCL 5HGDA 3SDXF 1EEYA 5J13C 3RWJA 2PW2B 1U0QA 4Y16A 2CIKB 3MRBA 3QRGH 1UYWL 5L2JA 2D7QA 2FHFA 5AUMB 4PJCF 1NGYB 4BZYA 4LEOB 3Q5OA 2A6IB 5TDNA 1P2CB 2R1WB 1WFUA 4NYLB 3FO0H 1T03H 5IHLB 4TPRL 4W6WB 1D6VL 3KJ6L 5ICZB 1WSST 2C7UB 3ARFA 1DBBL 1V05A 3WFHA 3O11A 3MLXH 1EK3A 5KAQF 4MVBD 2ORBH 1CICD 5KSUA 3BQUA 1WBXB 5C0IA 3W5MA 4K7PL 1OP5K 2PR4L 1JGDB 2H3NA 2HP4A 3T3ME 2ZNXA 4YFDB 4MNQE 3IETA 4X5LA 5CEZH 2FWOA 2XTLA 5DA0B 2FZ3A 3CLEL 1JN6B 2XZQH 4JHBA 5L6YL 2V9QA 4RGNE 4GJTB 5EH1A 4XB8A 2HA1A 4M48L 2CO6B 1BP3B 5MEQA 4P9HH 1NGXB 4QXTA 3OKMA 4ZFZB 1T04B 5ALBH 1BLNA 4YZFF 3JV6A 2D03L 4Q6IB 4OLYH 3L3IA 2XWBA 2P5EA 2NXZD 2V2XB 4PJ9D 5D96C 4GLRH 5DGQA 4WHCA 3V95A 3MOAL 1YNTA 3NZ8A 3OKDB 3OTTA 1DBKL 1BFOA 4EUPG 1MRFL 4MJ2A 4MA7H 4Z7WF 4GKSB 3C87A 1UM5L 2DB8A 3SPVA 4EJ1C 3OPZH 3RL1A 4RNRB 4Q9CA 4L8SA 3S3SA 2WSKA 4EQ2A 2IQAA 4OZHA 1HXYA 3GMOA 4PPTA 4ODWB 4MXQD 5ALCH 5ILTH 3I2CL 2W07A 4XP1H 4JKPH 3EZ8A 4DUXA 3QO1B 4B50A 5AG9A 2V2TA 1YEJL 2E5EA 2YUXA 5F8RC 4J1UA 2QSCL 2X89A 3PQYA 4UUJB 3D25B 3H9SB 4YXLL 1GVIA 1C12B 1SYVB 4PJ5E 1DQTA 2VLLA 1NLDL 4I0PC 1FYTE 4PTUA 4HCRL 1J0IA 3MSPA 1ZA3A 5IF0A 3OKLB 2CRMA 4L4TA 4TOYL 4GKNA 5HXMA 3A0OA 3P77A 4OT1H 1A9EA 4XWOC 2IG2L 3F7RA 4M43L 1H15A 5MI0B 4EDWL 3FJTA 3SGEI 4FP8H 3KYKL 3QUXA 4UILH 3T2NL 3VGFA 2AJXH 4RCAA 4BH8A 4P2OB 5DJCB 4I2XA 1AE6L 5HY9B 5KSBB 2B4CC 4LAJH 1A0QH 1V7NL 4HUXB 4Y16D 5JHLL 1N0XL 3QDGA 1Q8MA 3EJYC 4LPVA 3UJJH 2X4NB 3SDAB 2NY1B 1LDPL 5FYLD 2Q7YA 3RA7H 3JTSB 4Y5VC 4E5XA 1P6FA 3ULVF 3Q5YA 3KPSB 2DI7A 2W91A 4IRJC 4PJHF 4K7PX 4ZAKA 3V6BR 3ARFD 1VGKA 3T3PE 1OWRM 4OM1L 4L3ED 2QHLA 4QGTA 2B0SH 3LKSB 1T1YB 3QIWA 2ZCHL 4WEMB 2AJSL 4LSPH 3BQUD 1D5IL 3KWWB 2UZYB 3SOBH 1UH2A 1JGEA 2ITDB 2CK2A 3T2QA 4OCSH 4LSSH 4S1SH 4EI5B 3QDJA 5BMFH 1A7RH 3RWIB 3VXRB 4G3YH 3VWJA 4YUEL 4NUJA 2Z91B 2BNRE 3QHFL 3CAFA 4HUVA 2R39A 1P5VA 2A0LC 2Q8BL 4YDJA 2RCSL 2ADGA 4MDIB 1A7QL 1OW0C 4KMLB 1Z9MA 3H42L 5E2TL 4L8DB 2P5ED 2ICWA 4HKXB 1QTYT 2JJVA 5IB5B 1EHNA 5E2UL 1OF2B 3ILQC 4P9MH 4PY7B 3C5ZA 1FVEB 1NFIA 3LQZA 4NDMA 3WIIL 4PJEB 4UMGA 3VRLF 3FQXA 3MRMB 4NO0B 1N0LA 3HMXH 1T1XB 4D8PB 2OI9C 2F5AH 1S9YB 5C3LD 3UZQA 4X4XB 4F9LA 3BW9A 1VENA 3E3QC 1QFUH 4P5TB 4APQA 1PKQA 1DN0A 1S7TB 3LN4B 4QNPF 1JNHA 1QQDB 3PWVB 5CGMA 1XGUB 1MCCA 2DBLH 4JZNB 1SHMA 1OGAB 5HDLA 4U7SA 3MXVL 4NSKB 5DRZB 2JK5B 2YMXL 3O81A 4OFDA 1I7ZA 3QWRA 3KDMB 1DR9A 2X89D 3PQYD 1T6VN 3DX6A 4WUKH 1OB1B 2W9EH 5I0DA 5GGTA 4K8RD 1E4XI 5F7FA 4D9RD 3MLTA 3T0BA 3KPOA 4QRPB 4FQHA 1IGCL 1XF1A 2AQ1A 5IMLB 2VDLL 4KVCH 4JR9L 4BFGA 1QA9A 2ZUQC 4L4TD 2X40A 3K4AA 5C0NC 2J6EH 5I18H 4XCCH 1QUNA 1TTUA 4Z5RA 1CQYA 4LBEB 2IH1B 4X98A 2OXGA 1KB9J 1KN2H 1WZKA 1UXSB 3MJGX 2F54B 2J8UF 3KLAB 4Z9KB 3BKCL 4YAQB 4ENED 3P4OB 1Q0XL 5GRJH 5IFHH 3KXFB 3QUXD 4DFHA 5DD6A 1I1FB 1Z0MA 4RAUA 4YHNA 3BWUC 3TP4A 4AYFA 2Q76A 5EA0H 2VE6B 3C60B 3EGSB 3K3QA 2HLAB 1GIGH 3QDGD 1ZWIB 4LCUA 1U58B 3UPAA 4GMSH 4LRIC 3EZJB 3WN5A 3BRGC 3W9DA 2LFGA 5GRUL 5DLML 1CBVL 2MPAL 3OHXA 3GSNL 3QZWA 4K2UL 1F4AA 5D71L 1ZEAL 3HI6L 3EJZD 4YGAB 1PBYA 4ZAKD 2ZUSA 3L5XH 5JA9A 1BF8A 1WTGT 1KB9K 3F7YA 2DBJA 3WIHL 4MNQA 1CTOA 1SBSL 3QIWD 1IT9H 1D5MB 1MCOH 5IJVB 1BGXH 2DN7A 1H3XA 1FFNA 1TVBA 1DE4A 5T3XD 4Z7UE 3MACL 3WJJC 2YA2A 4P0DA 5DRWB 3QDJD 5FFLA 5I75B 5CMAA 4IMLA 3SJVE 1KCLA 2DIBA 3VWJD 4IM8A 3OZ9L 3WNOA 4E41B 3QH3A 2AJVL 1M05B 2DICA 4WU7B 2OX5A 1J12A 2NW2B 3Q6GL 5EZIH 3QQNA 4MAYB 3RVUC 2E9IA 4FMFA 5E8DL 3RDTC 5LBSL 3IB4A 1DP0A 4MJIE 1U8QA 1IGTA 2E6QA 3PHOB 2AGJH 3BGFC 3KYMA 4UBDD 1MCPH 4JHWH 4JANA 5I1GH 3HUJF 5HHMB 1PX3A 1FO0B 4PP1D 4XBGB 1MRCL 2VQ1A 3Q0HA 4PB9L 5FGSA 3O45B 4XCYA 5I2IB 1H8SA 5FECB 4Y88A 4CNIA 4OZFH 2IPUG 1VGEL 3C5ZD 3WLBA 1CTNA 1NC4A 4PY8J 1WZ1H 4PRPE 1PZ5B 2H2SD 4ORZC 2DQCL 4LF3A 2WWMD 3NIDE 1VACA 3WL9A 3AMKA 3L7EA 4APQD 5FYJL 1NCTA 4PJ5A 2BVOB 4IRSA 5CILH 3INUH 1FYTA 1U8OA 4KRPB 5JPMA 3QWRD 5DEZA 3UC0H 3EAKA 4YBHA 1J1PH 3BIAX 1YC7A 4JG0L 4L3AA 4JRYE 5F71A 1IGJB 3PGCA 1HKLL 5F7DA 4L3CB 4ZS7L 1LO0L 2V5RA 4PJGF 3KHQA 3QXVA 3VXOA 25C8L 5HI4D 4NQEE 4FQ1L 12E8L 1T7XA 3QP3A 3MLZL 3MREB 2DMCA 5FEBA 5E8EA 3G6DH 1QBLL 1MFEH 5B8CB 2WUBH 2FECL 4EOWH 1A3RH 4HS3A 2X4TA 4N0CC 4NRXB 2DQTH 1NCWL 2VWEC 2ERJB 2Z8SA 3FFDA 1H3TA 3L3OB 4U6XB 4AM0A 1FVCB 4PREB 2PCPB 4J3UA 4B5EA 4PJ8B 3PABA 1LEKB 3LCYA 5CGYC 3PWPE 1TJHH 3AY4C 4MXVF 5FO8A 4QRRB 3ZYOA 4J6RH 3ARZA 1E4WH 1KIRA 3QPXH 4LKCA 5C0AE 2UV3A 5IKCB 4Y2DD 1U8PB 5TE6L 4GRWE 1HHIA 4MNQD 4NWTH 2FX7H 2DTMH 5I1JL 2LU7A 2MSPA 4PJGB 1NANI 4RGND 2VDOH 2BNRA 3WJLC 2VIRA 4N1EA 2Q7NA 3F12A 3RWFA 2DL2A 2UUDK 4PUBL 1BZ9B 1TQBC 2VDQH 1RQ5A 3NIGE 4NJ9H 4F33A 3GMRA 4UAOB 2MCG1 1CD1A 2AEIT 5FO9A 5HHVH 1YZZA 3FONA 4DCQA 5I30H 1DANU 1O0VA 4I0CC 4RIRB 4KROB 3MNVA 2BMKB 4F7TB 1JMXA 3ARBC 3KPNB 3HLAB 3T0WA 3ARPA 4I8DA 1EMTH 1UT9A 3SDXE 1NGPL 2VAAA 2X4SB 5KW9L 4PJ7B 2DDQL 3NZHL 4N8VA 4Q2ZA 4PJCE 1QSZA 2GAZA 4ZUSB 1JWMB 4NP4H 3IVKB 4NQCE 5DZLA 1NC4D 5E4IA 2YN5A 1RZJC 1S7UB 4RQQA 4YHYC 3RKDC 3QO0B 1HZHH 5EZOH 1BJ8A 5JR1H 1YMHA 3NPSC 4NHCH 5IW3A 3VD4A 4IRSD 5I73C 1FYTD 2XY1A 3J7HA 1D5XA 5DD0H 5FF6B 1JHKL 1AJ7L 3LKNA 4M7ZB 1KN4H 1JF1B 3TYFB 4TVSa 1W72L 3WSQL 2DWEB 1RJCA 5D7JB 1X7QA 2R1YB 3GSRA 4L9LA 1NAMA 3V5DA 3HG1E 3KS0H 4X4ZA 3CFBA 3L5WA 3LN5A 4GRMA 3S8WA 2PUQT 1KG0A 2JB6A 4XP5L 2VXTL 4OD2B 1FJ1B 3KPLB 1VHPA 3CVIL 5T5FH 3K0WA 2OZ4A 5MEOB 4YZFE 2GSGB 4D9LH 1U3ZA 3HZVB 2AK4B 3UTQA 5B38B 1KTLA 4Q9RL 5IBUG 3DOSA 3G5XA 2FJHA 3SE9L 3TPKA 1CLZH 3V7MA 3NTCL 4Z7WE 1YJDH 2R0LL 2IWGA 4JZJB 3I3DA 1EEUA 4EDXB 5CJXA 5JW4M 2WINB 1JWUA 2FIRT 3KGRA 1IKNA 4D9QE 3ZKSD 1DLHA 1J0YA 1QSFE 4HF5H 3TLRA 3BKYH 5L0QB 4V2BA 4U49A 1IRAY 3MBXH 5HHQA 3FB8A 3MUJA 5GGSB 2J7LA 3M1BA 1NCAL 4XPGH 4Z7UA 4FFWC 2I5YH 1KGCE 3DV6B 3K2UL 3DBXB 2P47B 2DQFA 2NY7L 2EKSA 4Q97A 1F58L 1WIPA 3SJVA 3R1GH 3VW3H 3NACH 3MRKB 4D2NA 4MJ5A 1OSZA 2HJLA 1SEQH 2WWKT 5DS8B 1YMME 1CGXA 3MRHA 4FQIH 3GUTA 4X6FA 5GRYA 5LGHH 4O4YH 2O26U 1FZMB 1AP2B 5GJSH 2HWZH 4GSDL 5CBEB 1U42A 5DHYA 4MJIA 5LG1A 1HSBA 4BSVB 2CLZA 2VO5A 1B88A 3VXNB 2RFXA 3IKCA 3UYPA 1VFBA 1NMBH 3CH1B 8FABB 4RBPK 3X14A 3JWDL 4U1GB 3S5LB 2Z4QA 3QCVH 1BVZA 2EIDA 1U93B 4OGXH 3BP7A 5C0JB 4X4YA 2FBJH 4U1LA 2C3VA 2FHBA 3GI9H 4PRPA 2B2XH 4GBXC 4JY5L 3ZTNH 3BWAB 5D7KE 2HVJA 2EYTA 4XT1C 2FYYB 2P46B 4R4NC 3SBWA 3F5WA 1JF5A 3P9MB 5EC1A 5MERB 2L7UA 3NH7L 4PJHE 5HHNB 4JRYA 3ZE1F 1H3VA 4QT5B 4ORGA 5J06A 4Y4FC 5CEZE 1CE1L 3VXSB 1UCBH 4Y0GA 1KULA 3F58H 3F65A 3WS3B 4NQEA 1I3GH 4ZOEA 1M6OB 3ET9F 3G9AB 4E0RB 4HUMB 5DT1H 3N1MC 5EUOF 3U46A 2FL5B 1NMCC 1T0PB 4KQ4L 4IDJH 3Q1SH 1K4DA 4P4RA 2BVQB 2CKBL 1ZK9A 2EC9U 3C8DA 3F7VA 2BJMH 4ESKA 1PYWA 4XB7A 1P4IH 1YQVH 3QUYA 4O2FB 3HCVB 1KCVL 4KK5C 1FZJB 1R5VA 2Z9TA 3NFNA 4DQOH 2OJZL 4JFFB 4XVTH 4GKOA 4XCNB 3N0PB 2BNUB 3SDDC 2D7TL 2XTJB 4KMTH 3RAJL 1NDMA 1HNGA 1WBYB 1QLFB 1O7SA 3PWPA 4H20H 2BRQA 4H88H 5I1AA 1NCDL 3P4MB 4KXZI 4DFIA 4GXVL 3NFSH 1L6ZA 4X6BA 4G8IA 2AXGB 4KJPD 5C0AA 4YEEA 3Q6FB 4GRLB 5CIPB 2ED7A 4JQXC 1ZLVH 3WIFB 5KANG 5D1XC 2ZOLA 4AEHH 3HE7B 3STLA 2W0FA 4PRIE 3SKJH 3L95B 5DVMA 5TFSH 1H3PL 1FNGB 2UY6A 3SJVD 1DBML 1C5CH 3CSBA 4PFEA 2EO1A 2DKSA 2MKLC 3HC0B 5CZXD 3GSNB 2DJSA 4WHTB 3MV7E 3GMMA 4K7PY 4NNYA 4IOFD 3OKEB 4W81A 3QUZC 1EJOL 5T1KA 3MUY1 2E9WA 5AD0B 1ETZB 4GG6E 3GMPA 3D1MC 1IGML 4MJID 3I6GA 3ULSB 4M8VA 1G7MA 4LLWB 4TNWK 4X9GA 3SDXA 2FECI 2J8UE 4EI6A 3AVEA 3DARA 4YXHL 3D18B 2AEQL 5I8EB 4PJCA 5CUSL 4ZUUB 1AI1H 1Y0LB 2GUOA 1AQDA 4NQCA 3QAZC 5A1AA 4RAVA 4PRPD 1Y6MR 1DANT 1FFOA 2R29H 4Z7NF 4E42A 2Q1EA 3CVHA 3LRSB 1ZHLB 4TSCL 3FQUB 3B43A 1MQ8A 3VXME 1UB5A 2FEDC 2AW2A 3VFVA 2V2WB 2NY3C 1U9KA 1OT2A 1TZIB 3LEXB 1R3LA 5D2NC 1AFVH 3VCLB 1S7WA 5A16B 5KJRL 1FG2A 2JIXB 5F6HI 3BSZL 3TPUB 1YJDC 4P46B 1FRGH