1FPN3

Human rhinovirus serotype 2 (hrv2)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
237
structure length
237
Chain Sequence
b'GLPVFITPGSGQFLTTDDFQSPCALPWYHPTKEISIPGEVKNLVEICQVDSLVPINNTDTYINSENMYSVVLQSSINAPDKIFSIRTDVASQPLATTLIGEISSYFTHWTGSLRFSFMFCGTANTTVKLLLAYTPPGIAEPTTRKDAMLGTHVIWDVGLQSTISMVVPWISASHYRNTSPGRSTSGYITCWYQTRLVIPPQTPPTARLLCFVSGCKDFCLRMARDTNLHLQSGAIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structure of human rhinovirus serotype 2 (HRV2).
pubmed doi rcsb
molecule tags Virus
total genus 35
structure length 237
sequence length 237
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2000-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1fpn300
1PO13 1AYN2 1RUI2 3JBG3 1QQP1 1AR61 2BPA2 1R1A2 4IV3B 1VBB1 1F2NA 4CEWA 1AR92 5CFCC 4GB32 1E57A 2XBO3 4Y5Z0 5C4WC 1POV0 3VBOA 4GMP1 5AC92 1PVC1 5C8CC 3ZFEB 4CDUB 4PDWA 1H8TC 4Q4W2 1VBD2 1NCRB 1AL23 4YVSA 1Z7S1 1RUH3 3JD73 1ZBE1 1AYN3 1GFF2 2RM23 5K0UA 1VBA2 5FMOL 2R041 1VRH1 1BBT2 1EAH3 1ND3B 2HWE2 1BMV2 1K5MB 3FBMA 5L7OA 4GB33 1ND2C 2WFF2 1PVC2 3VBUC 2FZ2A 5AC93 1OOPC 1AUYA 1TME3 3NAPB 1VBD3 2ZZQA 3VBHB 1Z7S2 2RR11 1AL0G 2IZWA 1ZBE2 1F8VA 1RVF1 1AR63 4RQPB 3ZFGC 1HQNA 1A6CA 4LLFA 4CDQC 1VBA3 2BFUS 1PGL2 1VBB3 2RMU2 2XPJA 4QPIC 5BNOC 4GMP3 4Q4Y1 1PVC3 3VBRA 4GH4B 5CFCA 2X5IC 5C4WA 2RR12 1Z7S3 5C8CA 1ZBE3 3VDDB 3ZFFB 2HWD1 4Q4X2 1RMU2 3CJIB 1MQTA 4Z92B 2R043 1VRH3 4IV1B 2RMU3 3DPRC 4N53B 3ZXAC 5J98B 3VBOC 1R092 4PDWC 1RUD2 4CEWB 1PIV2 1ND2A 2RR13 1HRI1 4FTBA 1OOPA 5BNNB 1RVF3 2HWD2 4WM8A 5K0UC 1HXS2 3VBSB 1RB8G 5BNPC 3JBG2 4YVSB 4N43C 5C9AC 3J8F2 4RS5C 4CEYA 4Q4Y3 5GKAC 1R093 2R061 4JGYC 5JZGB 4QPIA 1TMF1 2XBO2 1RHI1 5DDJ2 1CD3G 2RS51 5L7OB 2VQ0A 1B35B 2X5IA 2HWD3 4YVWA 1AL22 1RUH2 1HXS3 1FMD1 1RUG1 3JD72 3VBFB 4CDXA 2RM22 3J8F3 4WM7C 4BCUA 3VBRC 1EAH2 3DPRA 4RHV1 1NCQA 1TMF2 2HWC1 5DDJ3 1HRI3 1TME2 2HWB1 5A32B 2HWF1 1MQTC 2GH8A 1RUJ1 3HAGA 1QQP2 1AR62 5C8CB 2WZR1 1ZBA1 1H8TB 3ZFEC 5FMOS 5CFDB 5BNPA 1VBB2 2Y26A 1RUF1 1FPN1 4N43A 5C9AA 1TMF3 1VB4A 1RHI3 2HWC2 3TN91 2RS53 1D4M1 1QJU1 4RS5A 1QJX1 2WS91 4JGYA 1POV1 1MEC1 2HWB2 1EV11 4WM8C 1VBC1 4RR3B 5D8AA 1FMD3 3VBUB 2R071 1QQP3 2R042 1VRH2 4FSJA 1RUF2 1FPN2 4CEYC 5ABJA 4RHV3 1COV1 1IHMA 3ZFGB 1NA1B 1PGW1 1QJU2 4WM7A 2HWC3 4Y4YA 4CDQB 2WS92 2DF7A 1MEC2 2HWB3 2HWF3 4AEDC 4QPIB 4YVWC 5BNOB 1NY71 4QPGB 4CDWB 2R072 1RVF2 5ACA1 2WZR3 1ZBA3 4CDXC 1QJY1 4GH4C 2X5IB 1RUC1 1RUF3 1FPN3 1NCQC 3ZFEA 4SBVA 1AYM1 3TN93 3M8LA 1QJU3 3VDDC 4Q4Y2 1NCRA 1RUE1 2WS93 1POV3 2RS31 1MEC3 1EV13 1VBE1 1VBC3 1OHFA 2GSYA 1NY72 4JGZC 2WLPA 1V9U1 3VBOB 1VAKA 2R073 2RS11 1FOD1 4PDWB 1ND3A 1C8NA 1K5MA 4Q4V1 5BNNC 1VB2A 2TBVA 1RUE2 5K0UB 3VBHA 2QQPA 1VBE2 3VBSC 4N43B 1R081 1HRI2 5D8AC 5ACA3 4JGYB 5A33A 2PLV1 4AEDA 5JZGC 1RUI1 1AR81 5ABJC 1B35C 4GH4A 1R1A1 1QJZA 1C8M1 1RUE3 2R062 4GMP0 1AR91 2RS33 2BBVA 1VBE3 1RHI2 3VDDA 2RS52 5AC91 2WWSA 3CJIA 1V9U3 4WM7B 2RS13 4Q4W1 1VBD1 3VBRB 2PLV2 4IV3C 5FOJB 1FOD3 1NG0A 4FTEA 4JGZA 5CFCB 4N53A 1RUG2 1FMD2 1AR82 4Q4V3 5C4WB 1VBA1 1ASJ1 1C8M2 1W39A 1OPOA 4CDUC 1DDLA 1MQTB 1BBT1 1HRV1 1NCRC 4RHV2 2HWE1 2R063 4RFT0 1BMV1 5BNNA 1AR71 2WFF1 4EJRA 1R083 3VBSA 5CFDC 4FTSA 1PO21 2PLV3 2HWF2 1RUG3 1ND3C 1RUI3 1AR83 1ND2B 1RUJ2 1K5MC 2WZR2 1ZBA2 1OOPB 1R1A3 1ASJ2 5JZGA 4WM8B 1C8M3 4NWVA 1PGL1 1HRV2 2RMU1 3NAPC 1AR93 3VBHC 4RR3C 1B35A 1AR72 3TN92 1D4M2 5J96B 1BEV1 1QJX2 4RQPC 4Q4W3 4CEYB 1HX6A 1EV12 1PO22 1VBC2 3VBFA 2MEV1 1RUJ3 1NA1C 4Q4X1 4IV3A 1RMU1 2BUKA 5LK7B 1ASJ3 2BFUL 5A33B 4AEDB 4YVWB 1BBT3 1HRV3 1COV2 2HWE3 4CDWC 4QPGC 1PGW2 1AR73 2ZTNA 4CDUA 2WFF3 4CDXB 1BEV2 1D4M3 1R091 3ZFFC 1QJX3 2ZAHA 3CJIC 5A32A 1RUD1 1PIV1 1PO23 3DPRB 4IV1C 1NCQB 2MEV2 4N53C 1H8TA 5ACA2 5CFDA 3JB8A 1QJY2 1HXS1 1PO11 1RUC2 3JBG1 4JGZB 4CEWC 1COV3 1NOVA 1AYM2 3J8F1 1M06G 1BEV3 3NAPA 1WCDJ 2RS32 4RR3A 5BNPB 1X36A 2XBO1 3VBUA 5DDJ1 4YVSC 4RQPA 2MEV3 5C9AB 1CJDA 1V9U2 2RS12 4RS5B 4Q4X3 1RMU3 1FOD2 1AL21 1PO12 1QJY3 1RUH1 3JD71 4Q4V2 1AYN1 3ZFGA 1RUC3 1NA1A 5D8AB 2RM21 4CDQA 3S6PA 3JB4C 1SMVA 5L7OC 2FZ1A 1AYM3 1X33A 1EAH1 5BNOA 1RUD3 4CDWA 4QPGA 4GB31 1PIV3 5ABJB 3LOBA 1R082 3VBFC 3ZFFA 4NWWA 1TME1 3IDEA 4IV1A
chains in the Genus database with same CATH superfamily
5CU1A 1PO13 2OIIA 5LZ6A 3QD6A 3BYWA 3JBG3 1QQP1 4AEMA 1QDOA 2A7AA 3LFIA 3PLQA 5FZEA 1HB3A 1R1A2 3VKLA 4E4HA 2BPA2 3I2GA 4HZFA 3WCRA 2OZJA 3O0XA 1CZSA 4L99A 1N3PA 2VBDA 2RE9A 4BISA 1CIYA 5KXCA 3O5SA 1J3PA 2Q1MA 3LOIA 3VHPA 3NJVA 4PI0A 4Y5Z0 3AZWA 4S2GA 3RPQA 3VBOA 5GLVA 2C6SA 3H7YA 4PCRA 4YG0A 5FY8A 5JSRA 1PVC1 4URTA 2XJQA 3VDBA 3NJYA 1GP6A 4QKFA 1H8TC 4QHBA 1IPJA 1Y9QA 3RZKA 4AI8A 4CP9A 4QM8A 1ZZCA 1WLCA 2YBSA 5FRAA 4B8EA 4DIQA 5C6CA 4P9WA 4IE7A 1T2XA 4B3NA 5F6KA 1GFF2 2JDYA 3UV9A 1O3RA 1O5UA 3ALQA 5IUQA 3L2YA 5K0UA 4LBMA 1GSLA 2WNUA 3FHIB 1UYZA 1BBT2 1EAH3 3D6EA 4WVWA 2F4LA 4N7IA 3K51A 4NHXA 5FZ6A 4ES8A 5ANNA 3GZTB 3ME2A 3VBUC 3FLTA 3ASIA 3EXUA 5FJHA 4BQYA 4Y5TA 2E26A 3C7HA 2PHRA 5C33A 2VD7A 5FTTC 2ADDA 2ERFA 1Z7S2 3QH7A 5FYSA 3VUOA 1ZBE2 4X8NA 3N9QA 2ZX0A 1RVF1 2WZ8A 3LEKA 3ABZA 1FI2A 3BVCA 1A6CA 1UY3A 2RDSA 2W47A 5FP7A 2XONA 1VP6A 1VBA3 3SITA 4HSJA 3U37A 1V70A 3RG0A 2O8OA 2IXKA 2ZGSA 2XQRA 1CWPA 1FNZA 1D0GA 4JHTA 3W5NA 3VBRA 5T5JA 3U1XA 3ZR5A 2CGNA 3IIIA 4QB6A 2VW2A 1ENQA 5C4WA 2J7MA 2RHPA 4XCAA 1H6YA 4XPVA 4NE9A 2VZSA 2ARCA 2YU1A 4XF4A 3VDDB 4Q4X2 5CBLA 5FYTA 1RMU2 3OB8A 4Y20A 5C71A 1MQTA 4MYEA 3OGGA 3N9LA 3ZPOA 2R043 3IIAA 5BV6A 4K3UA 1JYIA 2A3XA 3B94A 2RMU3 3M3EA 1UKRA 4K1YA 2A6VA 4EQVA 1UY4A 4MSVA 1RITA 2JDKA 5BYNA 2WR9A 5FZ9A 1O3TA 4LJHA 1JZ2A 1LODA 1H2LA 1RUD2 1UPSA 3N4MA 2XGXA 4W8JA 4CEWB 1H9PA 1C3HA 1ULPA 3BOWA 1OOPA 4YGEA 2WUHA 3D4KA 4M3CF 1URXA 3B01A 4HN1A 3MHZA 1MS4A 3WLUA 5FLJA 5CKNA 1I6XA 2LM3A 3NJXA 1RB8G 1UD1A 4Y26A 5APAA 4ASLA 1BZWA 1GQPA 4YVSB 4BYYA 2HH9A 4DRRA 4P00B 3DEMA 1SG3A 2X53S 3PMSA 2ID4A 1K3IA 1ODNA 3M7AA 2WNEA 3HBZA 4TWTA 3EQEA 3N36A 2A73B 3VZLA 1DGWA 2VUDA 3NL1A 3MLJA 1TEIA 5FWEA 3ENRA 3RI9A 4Z1VA 3E6CC 1RHI1 2WAAA 3K46A 1O8SA 3WX5A 2VQ0A 4RL7A 5L7OB 1IZ3A 5IVFA 2YDEA 4GD4A 3U10A 3VHOA 1RYYA 3B3QE 2HWD3 1SPPA 3I49A 4G4FA 4YVWA 5K8SA 1AL22 2VOWA 1HXS3 3PNAA 3VBFB 5EYYA 1JODA 2VTXA 3OTFA 4XJZA 2O14A 2JE7A 4L2NA 1TNRA 5EZWA 5FY7A 2XWJB 4Y33A 2N7GA 2XVGA 1OURA 2IVIB 4GKYA 5JXJA 5LY2A 3JZVA 4Q5OA 1QJFA 2YGLA 4RHV1 4PT6A 3ILNA 2WNVC 4DEVA 3WDWA 4Y1XA 2D5HA 4LBLA 4AVSA 2HWC1 3VKNA 2B46X 2O0OA 5G05L 2EIEA 4W6YA 4XFGA 1TME2 1VR3A 4NIDA 3PUAA 4CCCA 1W8WA 4EYUA 3LFMA 1BQPA 1V6KA 2R0HA 3MIBA 4LBQB 3GHMA 2Y6JA 1RUJ1 1TNFA 1W9TA 5LCWL 2C4XA 3ACGA 1LENA 1SACA 1ZBA1 3ZMNA 1JZ5A 4GWMA 2BJSA 3MIEA 2TEPA 4INDA 4A45A 5F5AA 5BNPA 1VBB2 4Z2WA 2OQ7A 1GYKA 3NMBA 5IVCA 1X8MA 4N43A 2C26A 4CEYB 5FPZA 1AX1A 3ELNA 3TN91 4RS5A 2ZEWA 1W8FA 1UY2A 2WQ4A 1GOHA 2XQXA 4E4ZA 4FCAA 4PIYA 3O1PA 4OI0A 2Z2SB 4XAAA 5CG8A 3GZAA 3NRUA 2KA3A 2ET1A 2XKPA 1VBC1 2G9GA 3RFRA 5F5IA 2CAVA 4RR3B 1OQEA 5I0DA 1Q8QA 2ZHNA 4AQ6A 4LBKA 4CUAA 5D1IA 4EN7B 5FMBA 2QZ3A 2R071 3LD8A 2VCMA 3OY8A 4HFSA 1UU6A 4XFFA 4H3WA 5JSOA 3WD5A 3WF4A 4OFGA 5EP9A 4P9GA 3WHTA 2WLQA 5DPNA 4NIGA 4CEYC 5ABJA 4QX7A 3ZSKA 2HBTA 1COV1 2QQVA 4QHZA 3EO6A 4P9XA 4Q0VA 3ZFGB 4AOCA 1QJU2 2BZDA 5FKBA 3NV1A 4WM7A 3GBGA 3PUSA 2WS92 2W68A 5K4LA 1YLLA 3RNSA 1APNA 4L92A 1XRUA 1AVBA 4XZPA 2GNTA 4OHVA 3OEBA 3IDAA 1E5RA 3LF7A 3SCHA 2HWF3 1BVP1 4AHYA 4E27A 2PHUA 1PZ9A 2YXSA 4QPGB 2EAAA 1UPIA 1GQGA 1W8UA 4LPLA 3W21A 1Z78A 5ACA1 2Z5WA 3EHKA 4GH4C 1Q8OA 2X5IB 4LE4A 4O9EA 2LUWA 4HL0A 4UF0B 4AK3A 2V5YA 1RUC1 3HNMA 4YW7A 1RUF3 1SLCA 3VKOA 3IPVB 1CR7A 1VAVA 3AZYA 3R05A 2RDNA 3S7IA 2A6ZA 5J09A 5GLUA 1OKQA 4Q4Y2 4R9DA 2VECA 1RUE1 4LO6B 1HV1A 1POV3 2RS31 1MEC3 5GZFA 2ZJCA 3CNAA 1VBE1 2DUPA 2GC0A 1DG6A 4OZXA 2KD7A 2PAKA 1XYOA 2GSYA 3MI8A 4JQTA 4LO8A 5LRSA 5FZDA 1W03A 5DQ0A 3WG1A 3ZO0B 4AEJA 2PHWA 2WLPA 3VBOB 5FLHA 5A3OA 5CG9A 4OI4A 4BMEA 2C1FA 1MS9A 3BUCA 3T2TA 1TVGA 2B7YA 1DQ0A 1K5MA 1W6MA 5EJZB 1SHWB 2JG9A 1KDKA 5FQ0A 5CNAA 3FL7A 3WNOA 1UXXX 2ARBA 5BNNC 1RGSA 4D69A 1XNTA 4ZXKA 1N1TA 1OI6A 5K0UB 3ES4A 3VBHA 2WNUB 4GA9A 1IQDC 2QQPA 3O12A 1N1YA 2YV8A 2A70A 4PHZA 3S57A 3EJKA 1OLQA 3RMYA 4AFAA 1JMUB 2XLFA 4Q0QA 1WCUA 1WW4A 3Q8AA 4M4PA 1WLDA 4YW5A 3T4HB 3ZYFA 4MGSA 1US2A 1V0AA 3A22A 4XDQA 3L2HA 4JGYB 4MGTA 5FIXA 4LHNA 1SLAA 4K21A 2ZEYA 4YW3A 1HDKA 4MX3A 5IK4A 3H1YA 1UMIA 3KV9A 4TZDA 2XUEA 2C5DA 1OUSA 3SC7X 1R1A1 1JXNA 1QJZA 2ARXA 4PBOA 3S30A 4YZ3A 3PDQA 1C8M1 2HKXA 2V73A 1YUDA 1NLSA 2R062 2QCSB 1JZ6A 3AKQA 4NIAA 1QF3A 3GZEA 4FFFA 4BH9A 2W52A 3MW3A 2OX0A 4PIZA 1SDWA 4IEUA 2DVAA 2R1BA 2A71A 5E88A 2WC2A 3V0BA 3C8XA 1NQDA 2RS13 4KWKA 4DO0A 3FBYA 3VBRB 3H1WA 3WF2A 4IV3C 4C0HA 3N7LA 3PTYA 1NG0A 4NVPA 1XE8A 1LOAA 5FO7B 4FTEA 1RUG2 2HEYF 1FMD2 2MHFA 5C4WB 3ZIXA 4DXSA 3ACIA 1DBNA 5DZEA 4W6WA 4Q2FA 1GBGA 2VBBA 5E6HA 5H9SA 1AX0A 2PFWA 2D97A 3PUQA 2G19A 4AQTA 5ERLA 1J3RA 3VGIA 3E6DA 2ZHMA 3KQRA 1C1LA 1MQTB 2VCCA 1BBT1 1HRV1 1NCRC 3AMPA 3IZOA 4KU7A 1QXJA 1UX6A 2XL7A 3UJQA 2E33A 1G8WA 3ZYIB 1OVSA 2J1SA 4EJRA 3I8TA 2VUJA 1UMHA 4LA2A 1VPHA 5BY5A 3CDZB 1S1AA 3UL2A 2R16A 3VBSA 1U5ZA 3PMEA 2PLV3 3WNNA 3F95A 2CDOA 1XSQA 3RWNA 1ND3C 1AR83 5DZFA 3I7DA 2WZR2 2VMIA 2ZGOA 1DFQA 1OOPB 5FZOA 2G9ZA 2R1DA 3I2KA 4Z07A 5JZGA 4KWJA 3O1UA 2JG8A 2GC1A 1OC1A 1UU5A 4DZGA 1ZRFA 1WUVA 4IDZA 3T08A 5LBFA 2BEOA 4XQ4A 4P14A 5A3MA 3KMHA 5FP9A 2O1QA 1B35A 1O3QA 4AW7A 5LBEA 4OUEA 4XUOA 1D4M2 1KITA 2BGCA 3HMYA 4LBJA 4XYXA 3NNJA 4Q4W3 2OUHA 1MS8A 2VY0A 2E32A 1WD4A 3LA2A 4XFBA 4IQPA 3WEZA 4E4DX 4RSUA 4TTGA 1W99A 1ZA7A 2DVGA 2ZKNA 4PJYA 4UW5A 4D8MA 3K2OA 2BERA 4Q4X1 3I97A 5LBCA 1RMU1 4JAAA 1ZRDA 4XXPA 4IEOA 1XNCA 1ASJ3 3NQHA 2A5ZA 3LKJA 3LGRA 4YVWB 3HEIA 4LNVA 5T50A 4COVA 2HWE3 3D8CA 4QKBA 2FBEA 1ULDA 1UY1A 4XF1A 2K9ZA 1REFA 3AKSA 3I2JA 3RMXA 2AZ5A 1AR73 4AHWA 4QWNA 1BEV2 3WDYA 1HB4A 3MYXA 4RA0A 1K5JA 3ZFFC 1QJX3 2QE3A 2J22A 3CJIC 4I02A 2VZVA 2AREA 3PVNA 4K8RB 3SCGA 5A32A 1RUD1 4UFKA 1SLTA 1PO23 4XBNA 4HANA 4AI9A 2H6BA 4BHPA 4BE3A 4LIUA 2O8QA 2WT1A 2GZWA 4M3CA 1H8TA 2OPWA 2Q30A 2I07B 4XQDA 3ZSMA 4AFBA 1SBEA 4HXCA 3DYOA 2D7FA 2QQLA 3MIHA 4MGKE 2JDHA 1IS3A 1HKDA 1LHNA 2ZHKA 2KR2A 3NNGA 4FFHA 4Q8LA 5FPAA 2YPDA 1RTVA 3VN4A 3VD7A 1JZ8A 2ORZA 1X7NA 1ULGA 4NHYA 4HN0A 2P4EA 2WN3A 3GF6A 3H3LA 1NOVA 1HQLA 1D7PM 2Y6FA 3D0SA 4LXLA 2Q5TA 4ITCA 4HKWA 2DBNA 1M06G 5JSPA 4IE5A 1WCDJ 5BNPB 5L9RA 5F2WA 4YG3A 2R0FA 1W3XA 5DAPA 4OHYA 3VBUA 3UT0A 3ZMOA 3C7GA 2KM2A 1BHGA 1NE4A 1YFYA 2JB8A 2HEVF 2W5FA 3ZXDA 3NW4A 5JMCA 1CJDA 3ECQA 3AC0A 1PX3A 4UFIA 4QX1A 4RS5B 4JRAA 2YBKA 1REEA 1LULA 4NPMA 4Y1ZA 3K4AA 1AL21 1PO12 2B9VA 4HBNA 3S0MA 1CGPA 1GWLA 1G6NA 4Q4V2 1AYN1 3DF0A 1GNHA 2BNOA 4HKLA 5T3NA 4B1LA 2C9AA 1F5JA 1EUTA 3S6PA 4XW3A 2G4IA 4Y3OA 3PU3A 1AYM3 2LS6A 5HV4A 1I1EA 2YC2A 3OY8B 4EWAA 1ONAA 4M3CE 5FY9A 4F7ZA 4PQ9A 2WAOA 3AFKA 3U11A 2XLGA 1XNKA 2W1SA 5ABJB 2WKKA 3WW1A 1PGSA 1R082 4JDOA 3D0JA 3HIFA 3KT7A 2LTNA 2UU8A 2NM1A 1TME1 4XJ9A 5GZEA 5CISA 3E5UA 4NIIA 1OKOA 2YFZA 3ZR6A 3AKRA 1PVXA 2PQSA 3VZMA 1RUI2 4LO7A 4COUA 1OLRA 1S2KA 4OUMA 1FNYA 1NT0A 2CV6A 2VG9A 2R6QA 5K9YA 2BQPA 3ZN5A 4QX3A 1PNFA 4XCBA 4NRPA 3TEYA 1VBB1 4QXHA 3KS7A 3J26N 4CEWA 4Y22A 5CFCC 2Y34A 3X29B 1E57A 2XBO3 1POV0 2DFBA 4P08A 5LEKA 5C8CC 3AYEA 2RDQA 5FO8B 2Y64A 3IDCB 2ZGUA 4K9SA 1AXKA 1KQRA 1WMXA 2WA4A 4YVSA 2Y33A 3ZXLA 4OQ8A 3JD73 2EXJA 1P8JA 2QNKA 5HCBA 3LDKA 4LOSA 3IMNA 4QMAA 1I5PA 1IS6A 1VBA2 3K48A 4LIVA 1JYWA 1LJ7A 5L36A 3CEWA 4BU2A 4IGPA 1K5MB 1W6MB 2EVXA 4KBBA 5L7OA 4GB33 1UYYA 5IYYA 2JG9B 1LNSA 2WFF2 5FQ0B 1PMJX 3RJ2X 2ZGRA 3C7OA 1H2KA 1ZVFA 5FZ7A 5JMOA 4OZOA 3KVBA 3VBHB 2RR11 1AL0G 4NPRA 5DABA 2MNGA 5B4NA 3FC0A 5A3UA 4RQPB 2DYCA 4LLFA 4C91A 4XZUG 2GMEA 2GNBA 3QCWA 3KLSA 1WBLA 1PGL2 2RMU2 2ZS6B 3KCCA 3Q9OA 4I0WB 4XBLA 3P1IA 2DVBA 4XFCA 5IVEA 4AF9A 1WCSA 4QPIC 3QH6A 4WZFA 3SEPA 2ET7A 2ZA9A 5LASA 5HCFA 4P9LA 3DL3A 3M2MA 2BWAA 2IXIA 4Q4Y1 1PVC3 4OMCA 4AQSA 2P6HA 3T0DA 1J83A 4WBBA 3WNXA 4QXKA 4HVOA 3ZIWA 2GN7A 4AE2A 1EP0A 5F1RA 3BALA 1Q3EA 2QQKA 5A3PA 5DUVA 3DCQA 2WSUA 5J37A 3V0BB 2B4KA 4N90A 4U36A 2OT7A 1PX4A 3RZGA 5FAXA 2V5DA 1S0FA 2I45A 2XL9A 4LKDA 4P9IA 4YARA 4H55A 2FDJA 2WJSA 1UY0A 2X10A 2YROA 5J98B 1V6NA 4UFLA 4ZY9A 3LA3A 4WVVA 3EB7A 4TYSA 3N9MA 4PDWC 2P1BA 3AKTA 1LOCA 1G7YA 4Q8KA 1ND2A 1KXGA 5IAVA 2B45X 2PHDA 3WP6A 2JICA 2ZCWA 1Y3TA 4LUMA 4FTBA 3O1RA 1RVF3 1H30A 3I59B 2HWD2 3AZVA 1O59A 1L7QA 2VUAA 2G9FA 2CGPA 5JXGA 2UURA 2ATFA 1HXS2 3VBSB 4UW6A 4E2GA 4M0NA 4KNCA 5T52A 1JW6A 4QXBA 4GIQA 2D3PA 5C9AC 1LGNA 5GJ6A 1YXWA 1RXFA 4CEYA 5FZOB 4CU8A 3RYRA 4JKKA 2K0GA 2R061 4BIFA 5JZGB 4A3XA 2JG8B 5A6XA 1TMF1 1JOPA 3HQUA 5C70A 1CD3G 1DZTA 3VHRA 1CQ9A 1B35B 2PTMA 1DLLA 4LHLA 4V1PA 5JAXA 1KFUL 4JKMA 3LEGA 3KHCA 2X5IA 1CAVA 1W2AX 3PVBB 4W6XA 2NLRA 5F39A 3T0BA 4Z8BA 3TEXA 1JYTA 3RYPA 4UYBA 2QQJA 1RUH2 1RUG1 1FMD1 3IPVA 1XXNA 4NOTA 4QHOA 2ZMLA 1NUKA 5J48A 4ONUA 2RM22 3P3NA 1OF3A 1JS9A 2VUCA 2BRTA 3BKZA 3J8F3 4QU1A 4COWA 1W6PA 3ZOIA 1HQWA 4BCUA 5FZFA 4QX5A 4FOQA 3DPRA 4NUBA 4N9IA 3FFZA 4O7XA 3LSDA 4D6RA 5F7UA 3ZSJA 3VDCA 1DQ2A 1OH4A 3M70A 2OKXA 1CONA 5I8YA 1WLWA 3RJRA 1H4GA 1G9AA 4BIOA 1SBFA 2HWB1 3ZN4A 2XJSA 2DCYA 3MO4A 5A32B 3KF3A 2NMOA 1ZA4A 3JCIA 1QIQA 2DFCA 3KCYA 1OFNA 1AR62 1JI6A 2WZR1 2ILMA 2EIBA 4TXWA 4OQ9A 4P5HA 4M3CB 4F83A 4MADA 1H8TB 5JOYA 1W0OA 1YFUA 1L7RA 2D6OX 2XB6C 3RQ0A 5CFDB 2YHJA 3SHRA 3L9JT 1YQ5A 2VMFA 2FDKA 5JOZA 2JIGA 4QX0A 1FPN1 3T2OA 4CP2A 5FZHA 3UGHA 4FP3A 2WA3A 1VB4A 1RHI3 1O7FA 2GMPA 2YGMA 1D4M1 4NHKA 2CY6A 4FPEA 1LGBA 2YB7A 2UWBA 3J7NA 3MUY1 4JGYA 3VZNA 3WP5A 1VAMA 1PZ8A 4AI2A 1UOBA 5I8TA 2TUNA 2P5BA 4IGQA 1UZWA 2GMMA 1K45A 3M3OA 1K12A 3VBUB 2QQIA 5FZ1A 5DG2A 5JOWA 1LOBA 3J9SA 1Q5OA 2VZQA 3FZ3A 1ENRA 2WO2A 3ACFA 4LKSA 4A44A 3BTAA 2EXKA 4D6SA 4R9AA 1LHVA 1VRH2 4FSJA 2D3RA 1RUF2 1SFYA 4RHV3 3AL5A 3KT1A 5B4XA 4XOGA 1C5IA 1NLRA 1H2NA 1H2MA 1GZTA 2HWC3 5A3LA 2VL4A 3PIGA 1YO8A 1CZTA 5T54A 2A6XA 4XFHA 1MEC2 2ZX2A 3I54A 3M1HA 3H8OA 3H3UA 4XF9A 3WINE 2BTVC 1YJLA 2EIGA 3AP5A 2VCBA 4AEDC 2NYYA 1DCSA 1GMMA 1NY71 3N9NA 1YIPA 2NMNA 2XUMA 5A7QA 5T5OA 2FDHA 1ZZ7A 3ACHA 4JTOA 1BKZA 4EZ4A 1ZNPA 1ZBA3 3I4IA 5AFEA 3RZMA 4MGZE 4CP1A 5IFPA 2A1XA 1XPWA 4O9GA 2XWBB 1GUIA 2ZGTA 4JX0A 1CVNA 1OUXA 2GH2A 1PM7A 2JKBA 4EWEA 1AX2A 3GALA 4SBVA 3ZFEA 4MOAA 3INAA 5FBZA 3M8LA 3MGUA 3TN93 3VDDC 4YW1A 3VKMA 2ZKLA 1NCRA 3ZXGA 3ZXKA 3WG3A 2J1TA 4BQ1A 3HT1A 3KGZA 1DIWA 3N3HA 4MHRA 4HMZA 3LZZA 1VBC3 4QQLA 3TEZA 4HKOA 2WT0A 3R4UA 4JGZC 4OI2A 2DDUA 4Y22B 2YC4A 5LATA 4O65A 2R073 1VRBA 2H0VA 2B5HA 3WF0A 1ST8A 5GZDA 3N35A 3OBTA 2E7TA 2JX9A 1ND3A 1IG3A 1C8NA 2XJUA 5EJ1B 1KRIA 4Q4V1 3B00A 4BOWA 3LDRA 4Q0UA 1RIRA 3G6JB 4XJWA 3MPBA 4CPBD 1WMFA 3WQ0A 3IBMA 5CKQA 4I0AA 1XBFA 4XHXA 2TBVA 1H9WA 1Y7BA 1YIFA 3T3YA 1OPMA 3OPTA 2Y60A 1JYCA 2BVVA 2DVDA 2GP5A 1NXMA 3GDBA 5CB7A 3ZX7A 4Q27A 4DNYA 2JDZA 4C8DA 1W6NA 3RZZA 1DZRA 1QNWA 1R081 2GNMA 1HRI2 3HR9A 3JQXA 3PU8A 4BK5A 4CU7A 5D8AC 1FV3A 5ACA3 3H8RA 3RSJA 1HV0A 1CAWA 2Z4FA 4B29A 3PHMA 5FYIA 5F3CA 2JKXA 2TNFA 4D94A 4CYDA 4LEJA 3F2ZA 1RUI1 2JE9A 4LBQD 2OYZA 3CLPA 1YC61 1JOBA 5LA0A 1JUHA 4LULA 2P3KA 2GC2A 3POIA 5FKCA 3V64A 3ZDSA 1IQAA 1GZCA 5GALA 4D7TA 5B2GB 4Q0SA 1C5HA 5EPAA 1RUE3 1OA3A 4IUGA 1HLCA 1KFXL 2BW8A 3ZVXA 4XAEA 5KHIA 2RS33 2BBVA 4J25A 5FV3A 5JI9A 4LOTA 2BBAA 1VBE3 2C0ZA 2VQAA 1GZ9A 2D6NA 2IXCA 2RS52 2VW0A 2YMZA 2VOKA 1JU3A 3CJIA 5FZAA 5GZCA 3AMNA 3OUIA 1UX7A 4D3WA 4PBPA 3M4FA 1WA6X 2PLV2 2XMLA 3H42B 3SNMA 1ALYA 2WNVB 1IS4A 4KL1A 5FFOC 5FOJB 5HCHA 3K3OA 1WA4A 2DCKA 2VCAA 1AR82 3O1TA 2ZABA 3CL1A 4L97A 4RD7A 3RZHA 1VBA1 1ENXA 1W39A 3OBAA 4CDUC 4XMIA 1W9YA 5DG1A 4YSFA 2PHTA 3OD4A 4YM0A 4DY5A 1K42A 5IHRA 1N1VA 4XF0A 4HONA 2WFF1 4JV4A 4J1XA 4H7MA 4OHWA 4Q1RA 1JH5A 1FT9A 1YRZA 2R7EB 1F35A 1VALA 5ANQA 2Q1ZB 4YFZA 5FP4A 1QXPA 1OQ1A 2GALA 5T5LA 4IEYA 4I09A 1ND2B 4KG8A 4IERA 5J3UA 2JDNA 2ZGLA 5DMYA 3R6SA 1ZRCA 1R1A3 1ASJ2 3V65A 3AVSA 2VZPA 3GBFA 4WV8A 4YW2A 1C8M3 4V2VA 2Y6HA 3BODA 3RS6A 1PGL1 2D43A 2RMU1 3GYDA 3GXUA 4W4ZA 1OH3A 3DYMA 3NAPC 4KGQA 3ZXEA 3O1MA 1S4CA 3KD4A 4RR3C 4FFGA 4HG6B 3FHQA 4NJ4A 1AR72 2WNOA 3EMRA 5KHKA 1DGRN 1QOSA 4GKXA 2RG4A 3GZUC 4NROA 1QJX2 1F9KA 4DRVA 2R49A 4XDOA 1NKGA 5SV5A 2ZPXA 2IVJA 3TB0A 3P3PA 1JN2P 1EV12 4AAPA 4BXFA 1PO22 4WVZA 3AYCA 4LMFA 3O1SA 4QB1A 1HB2A 3BTXA 2RDRA 3B9CA 5H9QA 5BPXA 2XOMA 2MEV1 1ZZ9A 1I3HA 2E53A 3CO2A 4LQRA 5J1XA 2XHNA 1F4HA 1FYUA 1ULEA 3WG2A 3P5BA 2BUKA 1N1SA 5LK7B 1YEWA 1TG7A 2BFUL 4XJAA 1CAVB 4AG4A 5A33B 2D6LX 2XG3A 2W1QA 4AHXA 1BBT3 1HRV3 3I3MA 2RJKA 4MO3M 1G86A 5JPMB 4QPGC 1YYNA 3OYWA 3QOPA 2HEWF 4MGQA 1PM4A 3KF5A 4N8MA 4PLNA 5FY5A 3WQBA 1H6XA 2F4PA 1W28A 1W6PB 3KZ4C 1QY4A 3OG2A 1GWKA 1UOGA 5EYXA 5FYHA 3DPRB 4IV1C 1DYKA 1XE7A 5ISLA 3TRSB 2E7QA 4N53C 5I0SA 1AZDA 4BB3A 2QBXA 4BQWA 3U78A 5FYYA 1GQHA 2NZ9A 4YZ5A 5A6ZA 3SMHA 4GXLA 1S0IA 1HXS1 5FZGA 1D2SA 4QT6A 4JHZA 3U4XA 5I0UA 1IPSA 3AL6A 3O14A 4I3GA 5FXZA 1AYM2 1DQ1A 1SZBA 2YPJA 1IKPA 1DP0A 4COYA 5BXXA 4FVVA 2C9KA 4QQOA 4PQQA 3KGLA 1H4HA 1MZFA 4PI2A 3BOPA 4JC1A 4MGIE 3SH3A 1ZREA 2IXHA 3FX3A 5IVVA 5JR2A 1MVEA 4RQPA 4QXCA 1V9U2 2V09A 4L11A 4Q4X3 1O5LA 1RMU3 2CTVA 5FK8A 4FP2A 1FOD2 2HYKA 4OMDA 1QJY3 2VZ3A 2WNUC 3DKQA 5KXEA 4S2DA 2WYFA 1RUH1 4AVVA 4R52A 2XVLA 3USUA 4ZU7A 3VD9A 1NA1A 1WWYA 3ES1A 3FE5A 1O4TA 5A1FA 2RM21 3ROUA 2R30A 4BMBA 4D7YA 4XIOA 5F5QA 4CU9A 4IEWA 2PAMA 1FAYA 3V0AA 1CX4A 1W2OA 3C3VA 2VR4A 4GJYA 5FOBB 1RUD3 4CDWA 1NLQA 5IT6A 4Y5SA 4DUXA 3KT4A 1V6IA 2VMDA 4BDVB 3WNPA 2ZX4A 4UWDA 4QPYA 1YNAA 3ETQA 3NKGA 4MHUA 1ZZ6A 2W08A 4R4ZA 3IDEA 4TSVA 4UBGA 4YGBA 3J4UH 1UOJA 3WSOA 2CSGA 3T0AA 3AK0A 2JENA 5F6LB 3JXSA 2AYHA 1AR61 2VJXA 1GWMA 2DCTA 3E5QA 4GULA 1ACCA 5IWFA 3KWVA 4IV3B 3H8XA 5JIAA 4JDMA 1LRHA 1QXRA 2LALA 4OVEA 1F2NA 2Y6LA 1AR92 1JUIA 4XUQA 2D40A 2IUWA 2Y0IA 4GB32 2JJ6A 4P9YA 3RWKX 2XJRA 1UL9A 3E5XA 5C4WC 2P6CA 4GMP1 3I59A 3TWIA 4N9HA 1CZVA 2ZX3A 3ZFEB 2P37A 3MUZ1 4PDWA 4W65A 4BQ2A 4XUPA 1NCRB 5K7PA 1AL23 3IM0A 1KS4A 2W92A 1IS5A 1W8TA 1Z7S1 3POSA 2P3JA 2WABA 4LO4B 5FYZA 5EFUA 1S0JA 1AYN3 1ZBE1 3WG4A 1FATA 3HD8B 2JB4A 5FMOL 3ON7A 2E51A 5FP8A 3GBWA 1VRH1 5A7PA 3KCXA 5KC6A 2JD4A 4Y24A 3VL8A 1CIWA 1ND3B 3Q8FA 3H9AA 1W0NA 2JIJA 2OQ6A 2PN5A 3FBMA 1BMV2 4G9SB 5EV7A 4OUSA 4KWUA 4DUWA 4AAXA 2PYTA 1PVC2 5FXWA 1UU4A 4QGNA 1NXD1 5AC93 4UFMA 1OOPC 5SV8A 4Y1VA 3HT2A 1VLNA 1TME3 1VBD3 1OVPA 5FZLA 4HVQA 4RGGA 2JDMA 2EA7A 4XMAA 2D6KA 4QKNA 1W6NB 1F8VA 1W06A 5F3GA 3SKJE 4MZUA 4XF3A 1JHJA 4G3YC 2J1UA 3C7EA 3UGGA 4CDQC 1CESA 3I2FA 1YQCA 1CAWB 2BFUS 5L9VA 4YZ4A 1RUNA 4OCTA 2JDPA 1VBB3 2FDIA 5FXVA 2PELA 3NNLA 2XPJA 1PK6C 2YUEA 1MR5A 5BNOC 5LA1A 3OD0A 5FZBA 4R9BA 3AZZA 3DXTA 3WNLA 2BGOA 4CRQA 4AI0A 3I2HA 3I3DA 1X9PA 2VW1A 2I74A 4FOVA 2JE8A 4AGRA 1PHMA 3KVAA 4FXKB 1UOFA 5A3WA 3IKWA 3IMMA 1LESA 4XEZA 1CX1A 1AXZA 1YI9A 1W6QA 1OXCA 2Q8DA 1V00A 3ZFFB 2A3WA 1KGYA 5LA9A 3CJIB 1WCKA 2ENRA 4E4SA 4Z92B 4QKDA 2FCUA 5JLVA 1U5XA 2UY9A 1UF2C 2WWJA 3PVOA 5DAVA 1JZ4A 1DGLA 3UGFA 2PHXA 3U07A 4EE2A 2VC9A 3AB0A 4QPWA 3FWEA 1EPWA 1XNAA 3H3ZA 4QU2A 3U4SA 4ET7A 1SQ4A 1PIV2 3MBWA 3MZHA 2RR13 1XYNA 5FYUA 3MLKA 4WZCA 1E5SA 1HRI1 1TZOA 5JCTA 2Y38A 4C0BA 4Q29A 1RINA 1OD5A 5FMDA 3KB5A 3O7OA 3S7EA 2CU5A 4KG0A 2WZPP 2QQOA 2CAUA 4GWNA 3WDXA 5BNPC 1O91A 1QKQA 3JBG2 4X8PA 2QDNA 3Q8CA 1L7LA 4N43C 4OYUA 2WSVA 1OA2A 4ORFA 2JDUA 4S2HA 3SCFA 3J8F2 3SEEA 3K4ZA 3WT3A 3ATGA 4RS5C 4Q4Y3 1LGCA 1U5YA 5A7NA 4ZZ5A 5GKAC 3U75A 3ST7A 1R093 1LKNA 4A4AA 3LIHA 4QQPA 3MFAA 4DXRA 1QWRA 1ZYBA 3GJBA 4DINB 2RS51 4KBZA 4QGMA 1LOEA 2VOTA 5BNQA 3S5QA 3ZKUA 1GKBA 3WDVA 5I0RA 1A8MA 4Q26A 4IEPA 4YYOA 4AVTA 5I0TA 3VDAA 2QZ2A 3N7MA 4CCDA 3POFA 2GDFA 4UFJA 4EN8B 3RVHA 3SQOA 2W1UA 3HQRA 3OUJA 3LSEA 3MF6A 4YZ1A 2VZRA 4NN0A 5CZKA 3W5MA 4YM3A 1H1AA 3H1MA 5IK7A 2ZGNA 5FPBA 3MDPA 3SXWA 4WM7C 1CN1A 1EAH2 2VNOA 1CAXA 2BV4A 1UCXA 4D0QA 2XJPA 4LBOA 4IEQA 4UFHA 1GLHA 5DDJ3 2QVSB 1W8HA 2IFWA 3AYDA 3OYWB 2ORXA 4UW3A 4YWAA 5AFBA 1ENSA 2VTXJ 4MG2A 4NIHA 1YFXA 5IVYA 1RJ8A 1YWKA 2ZGQA 2EXIA 2VE1A 1S0EA 4XACA 2GH8A 4JRLA 2HJIA 1KS5A 2YC0A 3LEIA 3HAGA 4PLMA 4YPJA 1V6OA 4UXAA 5C8CB 1U5IA 4NRMA 1MACA 3OF1A 1O4YA 4K7JA 4LK7A 3ZYHA 4LT5A 1BVVA 1XE0A 5FMOS 4YG6A 1KD7A 1LU1A 2Y26A 1J1TA 1GICA 1SDDB 2P2KA 2VZUA 3SKVA 5EXOA 1TMF3 2HWC2 1QJU1 4L9BA 2F17A 4TN7A 1QJX1 5BUVA 3LB9A 2WS91 5FUIA 1W8ZA 1QJEA 4E2QA 3KV6A 1YFWA 2GU9A 1EV11 1WGPA 5E89A 4ATEA 4WM8C 1OLMA 1CAUA 3BIWE 2IC1A 5D8AA 1FMD3 1S0DA 3THCA 1Y9GA 5LRRA 4MUVA 4XJUA 1QQP3 1S0BA 3HVDA 4JQRA 3VZKA 1SLLA 1C28A 4Z2AA 1NZIA 1O8PA 1XNDA 3EYPA 3IN9A 4FXGB 2R042 3WV6A 4CUCA 3I2IA 4B4QA 1D4VB 4A42A 2AH2A 4GQ7A 4BQ5A 1A34A 3USUB 1VJ2A 1IHMA 1QHDA 5KBFA 1NA1B 3VKFC 3SLIA 4IETA 4JTNA 4Y4YA 1V6LA 2WIIB 2D6PA 4MV2A 4NHMA 3QLQA 5A1LA 5DAQA 2WNVA 1WMDA 5EQUA 5FUNA 3V0AB 2HWB3 1DQ6A 3VHNA 4A7ZA 1GZWA 4HT1T 4XABA 3H50A 4QPIB 4AFMA 4FPOB 2B9UA 4A2UA 5FY1A 4XXAA 4CDWB 1W90A 3WF3A 1BK0A 2R072 3DXUA 1OQDA 3LPFA 4E8DA 2EF6A 2WZR3 4FBFA 2XXZA 1GANA 2W94A 4CDXC 1VMHA 3RYKA 5IATA 2AUYA 5HXVA 4KMQA 1SBDA 1GOGA 2HLEA 1YJKA 2IWGB 5F5CA 1FPN3 1WKYA 3OPWA 3JQWA 3CU7A 1NCQC 4B7EA 3DN7A 3UNPA 1AYM1 1OLME 1RJ7A 1OA4A 5JI7A 2WO3A 2X09A 3CMGA 4PLOA 4AR2A 5JOXA 5JXHA 4FI9A 2XLAA 1HIXA 1QEXA 3GCWA 4EV0A 4KQ7A 2A75A 5AVPA 4XVHA 1C57A 2BP6A 3M3QA 3PIJA 4XDPA 2W87A 1DGRA 1V9U1 3T30A 1VAKA 1S0GA 1EYBA 2E63A 5F32A 2RV9A 1FOD1 3OBRA 4PDWB 2BYVE 1JZ7A 4FO9A 3B02A 1H1IA 2ZXQA 5C5TA 3AMQA 4QQHA 3BI3A 1V6MA 1FV2A 3NV2A 3OGRA 5JIUA 5C3RA 4IEXA 3POEA 2NQYA 5KXDA 3EBRA 3WUCA 4F8AA 1MVQA 1D0HA 1RUE2 2VOXA 1BYHA 3T09A 3TYJA 5L19A 1A3KA 4FFIA 4XTPA 5DZGA 3ORJA 1KDMA 5KHHA 5T5PA 3AP9A 1VBE2 1W8NA 2VU9A 2D5FA 4RGAA 3VBSC 5HCAA 1WMEA 5KWRA 2ZMNA 2VMEA 2JDAA 5HXMA 2ARAA 2W46A 5G04L 1LAJA 4GJZA 4ATFA 2YBPA 4CTEA 4LO5B 5A33A 2DV9A 4CE8A 2QUOA 3TNPB 4Y1YA 5JZGC 2JG8C 2D3SA 4BWOA 1I5ZA 2HBUA 3BTZA 4CU6A 1GP4A 3ZSEA 4BZ4A 3WXPA 1OFSA 2VBPA 2J1VA 4CXYA 1PZ7A 1B35C 4GH4A 2P3IA 2QQUA 3BU7A 3MW2A 4MXVA 2VZTA 2VVFA 4ZS2A 3FN9A 1C1FA 4FPKA 5KXBA 1JZ3A 3OGJA 1AR91 1DQ4A 4AZZA 2WFPA 4H14A 3P6BA 1EPZA 1KJRA 1GV9A 1DHKB 1X9TA 1MS3A 3CJXA 3AM2A 2ZGKA 5FY4A 4RFRB 3FMGA 4ZONA 4HPKA 2WQ8A 1RC6A 5FYBA 3ZYGA 4LORA 4CUBA 4N53A 4Q4V3 1MPXA 4YGCA 3AFGA 4UI9L 2VO5A 4NO4A 2PAEA 1STMA 3R4SA 4EN9B 2AR6A 1MS1A 4A3ZA 1W6QB 2PHLA 4CCOA 1F15A 1C8M2 4FPCA 1XB9A 1RL3A 3NSTA 4XIKA 3OEAA 5D21A 5FYCA 4RFT0 1BMV1 1CPMA 5E8AA 1Q56A 2HYXA 5BNNA 2BWCA 1R083 5F3EA 3MPPG 2Q0AA 1IPKA 3B93A 1B09A 5FXXA 3WP4A 4B4RA 4COZA 2JD9A 3OPZA 1G9FA 2GN3A 4KGGA 3AVRA 5CFDC 2SBAA 2HWF2 3OCPA 4HSLA 4A6OA 1RUI3 4AFDA 1UIKA 1US3A 3CKHA 2VPVA 4XFAA 2P3YA 3KHBA 4JDNA 4P9JA 5T55A 1W6OB 4NWVA 1O6UA 3R4DB 1HRV2 1UYXA 3BIEA 4E2SA 1LR5A 4LUKA 3THPA 1DQ5A 1N3QA 1D2QA 1U12A 3PJYA 3FHAA 4K40A 5FYMA 1BEV1 4ZHNA 1XQNA 1LEDA 4LHKA 4FOWA 5A1AA 5LBBA 2JWPA 2SLIA 5DN2A 4QAWA 3T1MA 4FOYA 4M4RA 3BTYA 1LECA 1RUJ3 3VV1A 1LU2A 2D44A 3H7JA 2VQTA 4IV3A 4ZS3A 4DMIA 5J36A 5FREA 2ETEA 1E5IA 4LKEA 4P5YA 4YRDA 5FDBA 3MLLA 4YW6A 1XSRA 3APBA 4AEDB 2MPFA 2DTYA 5LWBA 3I2OA 1IOAA 1ULFA 3PURA 2G1MA 3O0WA 1UZYA 3AJZA 4Q1PA 5FZIA 3TOJA 4C1WA 1N3OA 4B7KA 1PGW2 3QBQA 4K1ZA 2ZTNA 4FAHA 4BQ3A 2WFF3 4DXZA 4CSWA 2QFEA 3H8UA 2ZAHA 2VQUA 3LE0A 1AJOA 1XNBA 3AX4A 4QDQA 3DECA 4E9KA 2ES3A 3IWZA 1PIV1 1QMJA 3A7QA 3T2PA 1CAXB 4CZSA 4ZKTB 3N9OA 5DXDA 1A78A 5FMCA 3UETA 3MICA 3POBA 3LCPA 3NV3A 1L3JA 2XHKA 2FCTA 2FDFA 1QJY2 2DU0A 1Y4WA 3KM5A 3Q8EA 3UKVA 3THDA 4AQ2A 1PO11 3VD4A 2FDGA 2R32A 4AVCA 2CDPA 3JBG1 4M01A 4JGZB 1XU2A 5A7SA 4CEWC 5A80A 1COV3 5CFDA 5HBAA 1WZXA 1LOGA 3J8F1 4CXWA 3SH5A 2X29A 2QJVA 2F6BA 4FPYA 4NR1A 3T2QA 2WT2A 2EALA 3C7FA 4YVSC 4FPGA 4K8FA 1UXZA 2MEV3 1UO9A 3HBKA 3W20A 2UYBA 3I3BA 2RS12 2FHRA 3AXDA 4JCKA 5C5UA 3NJZA 4J6GA 3IAQA 1S2BA 1T6GC 3GHNA 5LK5A 1CAUB 1RUC3 2ZOEB 3IDBB 5D8AB 4XQWA 4CDQA 4AI3A 5FZ4A 4C90A 3AXEA 4DUVA 5L7OC 1N47A 2WBKA 2RJLA 3O0VA 4BXSV 3OUHA 2BGPA 1EAH1 1QDCA 3DYPA 1PK6A 3O1OA 1OMIA 5BNOA 1ZM1A 1YHFA 1CPNA 2A3YA 1W9WA 3WDUA 1SCRA 2Y0OA 3D5OA 4I30A 1H8VA 4QX2A 3VBFC 5A6YA 3ZFFA 4NWWA 4IE4A 2VVDA 1YI7A 2YYOA 1ZRRA 1LOFC 3KV4A 3CF6E 4BPZA 3ZN6B 3VL9A 5F8PA 5IVJA 4XHBA 2D98A 3I3QA 1AYN2 2VM9A 3WNKA 1GOFA 1GZWB 2Z69A 3BGAA 4CCNA 5IK5A 4XE9A 1PMHX 1BJQA 2FMYA 3JU9A 5FBJA 5A7OA 2W3JA 1G9BA 3CHXA 1Q8VA 5HPOA 4I2OA 5GLZA 2BOIA 1SFNA 3NNMA 5AC92 5A7WA 5A3TA 4CDUB 4YM2A 2ZGMA 2DWRA 4Q4W2 1VBD2 2JEMA 1A8DA 2ZX1A 5DAXA 2LW8A 2VXRA 2XDVA 5GLTA 1RUH3 3D82A 3MV11 4ZU5A 4EZHA 1ODMA 4LBNA 1C4RA 1X82A 2AEYA 2OVUA 5IJRA 5CA6A 4XJ8A 2RM23 4XBQA 2C24A 4KU8A 3FLRA 4I3PA 2OS2A 2R041 3HNYM 4YGDA 4M0HA 3VLBB 4NAOA 2BDRA 3KSCA 1J58A 2HWE2 4P02B 3E6BA 4H2AA 4OHXA 5A70A 3WQ1A 1RXGA 3TBDA 3GCXA 1ND2C 3VZJA 1S55A 2V72A 2FZ2A 3LDBA 3ZYBA 3WP3A 1AUYA 4J1WA 4WVMA 5FZ3A 1YCIA 2YY1A 3NAPB 5FR3A 1BXHA 2EIDA 2ZZQA 5TSWA 2FQPA 2BNNA 2IZWA 2WQZC 2D93A 1AR63 1Q8PA 2AACA 5H9PA 1HQNA 3ZFGC 3IB3A 1BK1A 2FCVA 3HNBM 4OLLA 1AF9A 4R9CA 1GP5A 5IK8A 3N7KA 2K46A 2AEZA 2QTWB 3ZXJA 4DQAA 1MS0A 2NN8A 4QB2A 1JHNA 4GMP3 1RUOA 1T6BX 2J1AA 4GH4B 2EICA 4FPHA 5DUXA 3VD5A 5CFCA 1UN1A 1U0AA 4YLZA 2X5IC 2WO7A 3WDTA 2WZEA 1WCQA 2RR12 3DGTA 4AI1A 2OUJA 4AYUA 3MW4A 2XVKA 4FPFA 1Z7S3 4BM8A 2DCZA 2B8MA 2XKOA 3NVCA 4QX8A 1ZBE3 4DY3A 4OHZA 5C8CA 4LR4A 1LB2A 2L9LA 2YG0A 2XJTA 2HWD1 4D6QA 4MH0E 4HPKB 1XYPA 4MXWA 1VRH3 2VMGA 4IV1B 4IL7A 2Q8OA 5EIYB 4XETA 4MGYE 3DPRC 3DUIA 4N53B 2ZAAA 3ZXAC 4QD2A 4AFCA 2DUQA 1JBCA 2UYAA 1DYPA 5JXIA 3DV8A 3VBOC 3ILRA 1R092 3KQ4B 2KXLA 1XU1A 4YNIA 1BCXA 3LPGA 4BLJA 4GWIA 1HB1A 3TEWA 3H0OA 1UZVA 5FZKA 3LQCA 4CCMA 5J7MA 5BNNB 5LB6A 1EY2A 1JOJA 3ZSLA 3LIGA 4LK6A 1HJGA 5FWJA 4WM8A 4HK9A 3OJBA 1WLTA 1WBFA 4QQ2A 3GM8A 3A23A 3A0KA 2DBIA 5K0UC 5IVBA 3A21A 4MVTA 5EWSA 4CP9B 4F3JA 1QH6A 4CUGA 4EWDA 1NAEA 2XR4A 3GGLA 4LKFA 1YQ2A 3AP4A 2P17A 4BJ0A 4META 4KI5M 5CKMA 3ZLIA 4DPNA 5DUUA 4BQXA 1LCLA 2ZACA 1UNBA 3WY6A 4JGYC 3MEPA 3PJQA 4A7YA 2CHHA 2QQWA 3QACA 4QPIA 4QDSA 2XBO2 1GU3A 5DDJ2 3WCSA 1VMJA 2YFUA 4IEZA 4JVAA 3TNQA 2W9XA 2X05A 2Y6KA 4TLFA 1J3QA 4CCLA 2AC1A 2VGDA 2CNAA 1DYOA 2A6YA 2WL1A 5FZCA 5DAWA 3HPNA 2LRPA 2CYFA 2Z79A 2ZZJA 3JD72 4BLIA 5IFTA 2V4AA 2H6CA 3W59A 4UBHA 3ZDVA 1MZ5A 4GAZA 4KH9A 4CDXA 2CWMA 3ITQA 1ULOA 5FCCA 2FMDA 4NHLA 4URAA 5FLIA 1R64A 5L9BA 3J7MA 1G9CA 5M0TA 3VBRC 4CCJA 1NCQA 1TMF2 1OBNA 2Q8EA 2X8KA 2VNGA 4ZU4A 3RGBA 2CGOA 3UKTA 1I9RA 3NNFA 3JUUA 4QM9A 1IGOA 1HRI3 1J84A 3CQOA 3HN1A 3J7LA 4HOOA 4BQ4A 5E16A 1NYWA 5C3PA 1NZCA 3M3IA 5CIRA 2HWF1 4BA6A 1Q43A 1MQTC 3GJAA 5A6QA 2PQQA 3ILFA 5KR7A 3NV4A 3PTRB 1PMIA 3PVEA 3WNMA 1QQP2 5C3QA 5H9RA 3IT8A 2W2IA 4XC9A 3W58A 2VOVA 4ZXEA 3ZFEC 3WQ7A 5HI0A 2DUOA 3AJYA 4QDRA 4Y20B 3AYAA 2I2SA 3K3NA 3WR0A 2QQNA 4AGVA 1RUF1 3PUIA 2ADEA 4UW4A 4PIXA 1UZ0A 5C9AA 4PF5A 4B4PA 2J1EA 2RS53 3OOXA 1HW5A 2E6VA 4W50A 4GALA 4PF1A 4C1XA 5C7GA 4ISRA 1POV1 1ZZBA 2HWB2 1MEC1 1F4AA 1FX5A 4U2AA 3AZXA 3N9PA 2Z42A 4IGOA 4EN6B 3OGVA 3RRDA 3CIHA 1IKQA 3FJSA 1G9DA 2VMCA 4LE3A 4Q0PA 4XTMA 3IAPA 5FPVA 4OULA 4IE6A 2EXHA 4XFIA 1FPN2 5JWPA 1V6JA 1X50A 2DVFA 3DKWA 5GLWA 1F31A 2XH6A 1MZEA 1JYXA 1QOOA 3B9IA 3S5AA 1PGW1 3K75B 3MIGA 3OSDA 2UWAA 2W1WA 4CDQB 2DF7A 1HN0A 1SCSA 1JU4A 4ZPIA 1BLZA 1SLBA 2ZMKA 5F9TA 1QOTA 3WOGA 2Q8CA 1X8EA 3ACLA 1PK6B 2QDRA 1AJKA 4FPLA 4YVWC 5BNOB 5CADA 3AKPA 3SH4A 2AGSA 3O1VA 1RVF2 1WW7A 2WRAA 2NPIA 5HV0A 2E31A 4DOUA 1GR3A 2UWCA 2GP3A 1QJY1 2IXLA 5FYVA 4UT5A 1SPPB 3WUDA 1QGLA 2UY8A 1UZZA 2PMWB 5CAZA 2PHFA 3ZM8A 4I01A 1VIWB 3N7JA 3PL0A 5LW9A 1AXYA 5FUPA 4LA3A 4CP0A 1QJU3 1LTEA 1W9FA 1NX9A 2WS93 1NQJA 2WWUA 1UW8A 1EV13 1YQ8A 2PXJA 3MV01 4MLOA 1OT5A 1WW6A 3UKNA 5FPUA 1EUUA 1OHFA 5FY0A 1JYVA 1NY72 4JZRA 2DTWA 2RS11 4NRQA 2Y6GA 3K77A 5JPNB 3OGSA 3E97A 5AVAA 4AGGA 2Q4SA 1W6OA 2RJ2A 4HVRA 5A7WB 2OA2A 4Z82A 5FP3A 1WD3A 5A3NA 2PA7A 3FFQA 4E8CA 4N7UA 3THTA 4OI1A 4D7SA 4A6SA 4BK4A 4LLOA 1J59A 1F5FA 3FLPA 3GNEA 3B7MA 1GNZA 1VB2A 4FQZA 3WW3A 2D6MA 4CXXA 3POJA 1UQXA 5CVRA 5LA2A 1UWWA 1UAIA 3VD3A 3A0NA 4FQ4A 4N43B 4B1MA 4RN5A 3I3EA 5LEJA 3T1LA 2BNMA 3C2UA 3URFA 2LROA 3OBZA 4AVAA 4IXLA 2PLV1 4AEDA 2VH9A 4AL9A 4WVMB 2J1RA 4A41A 2BOJA 2V4VA 4LHSA 3RZJA 2IFRA 3ZPYA 5I91A 1AR81 5IW0A 5F2SA 2QQMA 3B5LB 5ABJC 2B39A 4K20A 5C3SA 1NE6A 3CZJA 2BU9A 4UAPA 4XUTA 1UYPA 2OW4A 4NAMA 4AXOA 4O61A 4GMP0 5GM0A 3KV5A 3HWJA 3MIFA 1H1MA 2FD8A 1OF4A 1QH7A 1ZX5A 3USSA 3BU0A 4IE0A 2GNDA 1RHI2 3VDDA 3FUOA 5E1RA 4AWDA 5AC91 2WWSA 3ZYJB 1V9U3 4WM7B 4ZZ8A 4Q4W1 4M00A 1VBD1 1ZZ8A 4R8HA 5FJKA 1FOD3 4JGZA 5CFCB 4SLIA 1O3SA 5EHDA 1W9SA 1IG0A 2W39A 3LEMA 3TAYA 4ASKA 2BVBA 2VZ1A 3I2DA 4IEVA 1QNYA 1ASJ1 1GNYA 4JKLA 4QGLA 4UOJA 1OPOA 3WHUA 4DFSA 4DXTA 5FO9B 5KHGA 2ZEXA 1W0PA 1DDLA 3RDIA 5D2AA 3FUQA 4RHV2 4IW3A 2HWE1 2R063 4I0BA 4MXWB 1UKGA 5JR7B 5FZ8A 3HOBA 1MZ6A 2GAUA 4EROA 1AHSA 2VNVA 1AR71 3B69A 4AVBA 2YU2A 3POGA 5FK7A 1DF0A 2Y8KA 2OZ6A 4GZ9A 2B42B 3U14A 4FTSA 4TLGA 4AHZA 2W0XA 1LHUA 1PO21 3WW4A 4FT8A 3UESA 2W95A 3W9AA 5F37A 5LY1A 1JYNA 1LHOA 1Q8SA 1RUG3 3U0ZA 1RUJ2 1K5MC 3HJRA 4DEQA 5KHJA 3MFCA 3ETPA 1ZBA2 2JG9C 3AMMA 1XJAA 3D3AA 3LA7A 4WM8B 4X6RB 4YM1A 4CCEA 3MIDA 3UK9A 1OD3A 2E9QA 1DGWX 1R1ZA 3WF1A 1AR93 3VBHC 1DLCA 4XURA 4YZ2A 4KWLA 3NKTA 4ARYA 2ZEZA 5JDBA 3TN92 1W8OA 2Q1FA 3WW2A 3Q8BA 5J96B 4RQPC 4X6QB 3ZN6A 2DURA 4NMIA 1HX6A 2NP0A 5DUWA 1VBC2 4Y4RA 3VBFA 3CBNA 3PUHA 2W91A 2OXBA 1TE1B 3BPZA 4CPBA 2VTFA 1Y43B 1LOFA 4R4XA 1NA1C 5JVVA 2XJVA 4EN0A 3LAGA 3WZ1A 5CEHA 4XILA 1SFPA 2YZ4A 3LWCA 4RGKA 1LEMA 1REDA 4K6BA 3UJOA 1HJFA 1W05A 5L73A 3AP7A 1W2UA 4CVUA 2ZHLA 4GWJA 4CA9A 5I93A 1COV2 3M3CA 1W2NA 2EAKA 2OPKA 3POWA 1Y9MA 3J7HA 3E1F1 1E5HA 4IESA 4RYDA 2QKDA 3NWKA 4CDWC 1Z0HA 2WYSA 3BCWA 4CDUA 4HLTA 4CDXB 1D4M3 1R091 1S0CA 1CJPA 1DU3D 1FXZA 1W04A 4L0PA 1UMZA 1OSGA 4A7KA 4LBQA 3BN6A 4XUNA 1NCQB 1MS5A 2JXAA 2MEV2 2JECA 1VE0A 3POYA 1LHWA 4HETA 5ACA2 4HK8A 5GZGA 3JB8A 1YQ6A 1POQA 1DZQA 1TQ5A 1KJLA 4Y1UA 5CYYA 2ZGPA 3HQXA 1RUC2 2VXJA 3RZLA 5C3OA 3VZOA 3ZKYA 2DCJA 3K4DA 4V2WA 5F3IA 2CL2A 5FPXA 3AMHA 2E7AA 4ARXA 5JUVA 4YW4A 2WO1A 3V56A 4ES9A 1BEV3 4ASMB 5IAXA 3NAPA 1O4ZA 3UYJA 2RS32 4RR3A 3BB6A 3MF9A 1X36A 1WW5A 5FZMA 5FZ0A 3ZYPA 2XBO1 1JTZX 3SISA 4ISQA 1H0BA 5DDJ1 1S2EA 4FAGA 3BPSA 5C9AB 2ZBJA 3A4UA 2WDBA 3AP6A 1XOYA 1KEXA 1HN1A 2DU1A 2H0BA 1QU0A 4AEKA 1J1LA 2VNRA 4FPJA 4LITA 2VMHA 4S2FA 4YFWA 3CZUA 3JD71 1VMFA 2AENA 3ZFGA 3ZYRA 3NO8A 2K2SA 4DB5A 1SEFA 4NPLA 3T4VA 3JB4C 2CWSA 1SMVA 2FZ1A 2VULA 1ULCA 5EJ3A 1X33A 2WN2A 4H7LA 3RI8A 3G7DA 4LTAA 4DS0A 2A6WA 3HN3A 5KC5A 1ZRIA 3ZXFA 5I8SA 1SLIA 4L8QA 3VB9A 3WVJA 2WINB 4QPGA 3R0RA 1PIV3 2IXJA 4GB31 1PNGA 1M4WA 3LOBA 1W3VA 2P34A 5C8WA 5FPLA 2J42A 2RVAA 1XC6A 4UF0A 1UIJA 2VAUA 1W2TA 4IV1A 2VVEA 4CCKA 2VZOA 2GC3A
chains in the Genus database with same CATH topology
5CU1A 1PO13 2OIIA 3QD6A 3JBG3 1QQP1 4AEMA 1QDOA 2A7AA 3PLQA 3VKLA 2BPA2 1R1A2 4HZFA 3WCRA 2OZJA 3O0XA 4L99A 1N3PA 2RE9A 5KXCA 3O5SA 1J3PA 2Q1MA 3LOIA 3VHPA 4Y5Z0 3AZWA 4S2GA 3RPQA 3VBOA 5GLVA 3H7YA 4PCRA 4YG0A 5JSRA 1PVC1 4URTA 2XJQA 1H8TC 4QHBA 1IPJA 1Y9QA 4AI8A 4QM8A 1ZZCA 1WLCA 5FRAA 4B8EA 5C6CA 4P9WA 4B3NA 5F6KA 1GFF2 3UV9A 1O3RA 1O5UA 3ALQA 5IUQA 3L2YA 5K0UA 4LBMA 1GSLA 2WNUA 3FHIB 1BBT2 1EAH3 3D6EA 4WVWA 4N7IA 3K51A 4ES8A 3GZTB 3ME2A 3VBUC 3FLTA 3ASIA 3EXUA 2PHRA 5C33A 5FTTC 2ERFA 1Z7S2 3QH7A 3VUOA 1ZBE2 4X8NA 2ZX0A 1RVF1 1FI2A 1A6CA 3SITA 1VP6A 1VBA3 4HSJA 1V70A 3RG0A 2O8OA 2IXKA 2ZGSA 1FNZA 1D0GA 3VBRA 5T5JA 2CGNA 2VW2A 1ENQA 5C4WA 2RHPA 4XPVA 4XF4A 3VDDB 4Q4X2 5CBLA 1RMU2 4Y20A 1MQTA 4MYEA 3OGGA 2R043 3IIAA 5BV6A 4K3UA 1JYIA 2A3XA 3B94A 2RMU3 3M3EA 1UKRA 4K1YA 2A6VA 4MSVA 1RITA 5BYNA 1O3TA 1LODA 1H2LA 1RUD2 3N4MA 2XGXA 4CEWB 1H9PA 1C3HA 3BOWA 1OOPA 4YGEA 3D4KA 4M3CF 1URXA 3B01A 4HN1A 1MS4A 3WLUA 5FLJA 1I6XA 2LM3A 1RB8G 1UD1A 4Y26A 4ASLA 1BZWA 4YVSB 4BYYA 4DRRA 2X53S 3PMSA 3M7AA 2WNEA 3HBZA 4TWTA 3EQEA 3N36A 2A73B 3VZLA 1DGWA 3NL1A 3RI9A 3MLJA 1TEIA 4Z1VA 3ENRA 3E6CC 1RHI1 3WX5A 2VQ0A 4RL7A 5L7OB 1IZ3A 2YDEA 3U10A 3VHOA 3B3QE 2HWD3 4G4FA 4YVWA 5K8SA 1AL22 2VOWA 1HXS3 3PNAA 3VBFB 5EYYA 3OTFA 4XJZA 2JE7A 4L2NA 1TNRA 5EZWA 2XWJB 2N7GA 2XVGA 4GKYA 3JZVA 2YGLA 4RHV1 3ILNA 2WNVC 3WDWA 4Y1XA 2D5HA 4LBLA 4AVSA 2HWC1 3VKNA 2B46X 2O0OA 4W6YA 4XFGA 1TME2 1VR3A 1BQPA 1V6KA 2R0HA 3MIBA 4LBQB 3GHMA 1RUJ1 1TNFA 1LENA 1SACA 1ZBA1 3ZMNA 4GWMA 3MIEA 2TEPA 4INDA 5BNPA 1VBB2 4Z2WA 1GYKA 1X8MA 4N43A 5FPZA 1AX1A 3ELNA 3TN91 4RS5A 2WQ4A 4E4ZA 4FCAA 4PIYA 4OI0A 2Z2SB 5CG8A 3GZAA 2KA3A 2ET1A 2XKPA 1VBC1 2G9GA 2CAVA 4RR3B 1OQEA 1Q8QA 2ZHNA 4AQ6A 4LBKA 5D1IA 4EN7B 2QZ3A 2R071 3OY8A 4HFSA 1UU6A 4XFFA 4H3WA 5JSOA 3WD5A 4OFGA 3WHTA 4P9GA 2WLQA 4CEYC 5ABJA 3ZSKA 1COV1 3EO6A 4P9XA 4Q0VA 3ZFGB 1QJU2 3NV1A 4WM7A 3GBGA 2WS92 2W68A 3RNSA 1YLLA 1APNA 4L92A 1XRUA 1AVBA 4XZPA 2GNTA 4OHVA 3SCHA 4AHYA 4E27A 2HWF3 1BVP1 2PHUA 1PZ9A 2YXSA 4QPGB 2EAAA 1UPIA 1GQGA 5ACA1 1Z78A 2Z5WA 3EHKA 4GH4C 1Q8OA 2X5IB 4LE4A 4O9EA 2LUWA 4HL0A 4AK3A 2V5YA 1RUC1 1RUF3 1SLCA 3VKOA 3IPVB 1CR7A 1VAVA 3AZYA 3R05A 3S7IA 2A6ZA 5GLUA 1OKQA 4Q4Y2 4R9DA 2VECA 1RUE1 4LO6B 1HV1A 1POV3 2RS31 1MEC3 5GZFA 2ZJCA 3CNAA 1VBE1 2DUPA 2GC0A 1DG6A 4OZXA 2PAKA 1XYOA 2GSYA 3MI8A 4LO8A 5LRSA 3WG1A 3ZO0B 4AEJA 2PHWA 2WLPA 3VBOB 5FLHA 5CG9A 4OI4A 4BMEA 2C1FA 1MS9A 3T2TA 2B7YA 1DQ0A 1K5MA 1W6MA 2JG9A 1KDKA 5FQ0A 5CNAA 2ARBA 5BNNC 1RGSA 4D69A 4ZXKA 1N1TA 1OI6A 5K0UB 3ES4A 3VBHA 2WNUB 4GA9A 2QQPA 3O12A 1N1YA 2YV8A 2A70A 3EJKA 1OLQA 3RMYA 4AFAA 2XLFA 4Q0QA 1WW4A 4YW5A 1WLDA 4XDQA 3L2HA 4JGYB 4LHNA 1SLAA 4K21A 4YW3A 1HDKA 4MX3A 5IK4A 3H1YA 4TZDA 2C5DA 1R1A1 1JXNA 1QJZA 2ARXA 4PBOA 3S30A 4YZ3A 1C8M1 2HKXA 2V73A 1YUDA 1NLSA 2R062 2QCSB 3AKQA 1QF3A 4BH9A 2W52A 3MW3A 4PIZA 1SDWA 4IEUA 2DVAA 2R1BA 2A71A 5E88A 2WC2A 3V0BA 1NQDA 2RS13 4KWKA 3FBYA 3VBRB 3H1WA 4IV3C 4C0HA 3N7LA 3PTYA 1NG0A 4NVPA 1XE8A 1LOAA 5FO7B 4FTEA 1RUG2 2HEYF 1FMD2 2MHFA 5C4WB 3ZIXA 1DBNA 5DZEA 4W6WA 4Q2FA 1GBGA 5H9SA 1AX0A 2PFWA 2D97A 4AQTA 1J3RA 3VGIA 3E6DA 2ZHMA 3KQRA 1C1LA 1MQTB 3AMPA 1BBT1 1HRV1 1NCRC 4KU7A 1QXJA 1UX6A 2XL7A 3UJQA 3ZYIB 1G8WA 4EJRA 3I8TA 2VUJA 4LA2A 5BY5A 1S1AA 3UL2A 2R16A 3VBSA 1U5ZA 3PMEA 2PLV3 3RWNA 1ND3C 1AR83 5DZFA 3I7DA 2WZR2 2VMIA 2ZGOA 1DFQA 1OOPB 2R1DA 4Z07A 5JZGA 4KWJA 2JG8A 2GC1A 1UU5A 4DZGA 1ZRFA 1WUVA 2BEOA 4XQ4A 4P14A 5A3MA 3KMHA 2O1QA 1B35A 1O3QA 4AW7A 1D4M2 1KITA 2BGCA 3HMYA 4LBJA 4XYXA 4Q4W3 2OUHA 1MS8A 2VY0A 1WD4A 3LA2A 4XFBA 4IQPA 4E4DX 4RSUA 2ZKNA 4PJYA 2DVGA 4UW5A 4Q4X1 1RMU1 4JAAA 1ZRDA 4XXPA 4IEOA 1XNCA 1ASJ3 2A5ZA 3LKJA 3LGRA 4YVWB 4LNVA 5T50A 4COVA 2HWE3 3D8CA 2FBEA 1ULDA 4XF1A 3RMXA 2K9ZA 1REFA 3AKSA 4AHWA 2AZ5A 1AR73 1BEV2 3WDYA 3MYXA 4RA0A 3ZFFC 1QJX3 2QE3A 3SCGA 3CJIC 4I02A 5A32A 2AREA 3PVNA 1RUD1 1SLTA 1PO23 4XBNA 4HANA 4BHPA 2H6BA 4BE3A 4XQDA 2O8QA 2WT1A 2GZWA 4M3CA 1H8TA 2Q30A 2I07B 4AFBA 3ZSMA 1SBEA 5CFDA 3MIHA 2D7FA 4MGKE 1IS3A 1HKDA 1LHNA 2ZHKA 4Q8LA 3VN4A 1RTVA 1X7NA 1ULGA 4HN0A 3GF6A 1NOVA 1HQLA 3D0SA 2Q5TA 4ITCA 4HKWA 1M06G 5JSPA 1WCDJ 5BNPB 4OHYA 4YG3A 2R0FA 3VBUA 3ZMOA 2KM2A 1NE4A 1YFYA 3ZXDA 5JMCA 2HEVF 1RUNA 3NW4A 1CJDA 3ECQA 4RS5B 4JRAA 1REEA 1LULA 4Y1ZA 1AL21 1PO12 4HBNA 3S0MA 1CGPA 1G6NA 4Q4V2 1AYN1 3DF0A 1GNHA 2BNOA 4HKLA 5T3NA 2C9AA 1F5JA 3S6PA 4XW3A 2G4IA 1AYM3 1I1EA 3OY8B 4EWAA 1ONAA 4M3CE 4F7ZA 4PQ9A 3AFKA 3U11A 2XLGA 1XNKA 5ABJB 2WKKA 3WW1A 1PGSA 1R082 4JDOA 3D0JA 3HIFA 3KT7A 2LTNA 2UU8A 2NM1A 1TME1 4XJ9A 5GZEA 3E5UA 3AKRA 1PVXA 3VZMA 1RUI2 4LO7A 4COUA 1OLRA 1S2KA 4OUMA 1FNYA 2CV6A 2VG9A 2R6QA 5K9YA 2BQPA 3ZN5A 1PNFA 1VBB1 3KS7A 3J26N 4CEWA 4Y22A 5CFCC 3X29B 1E57A 2XBO3 1POV0 2DFBA 5LEKA 5C8CC 3AYEA 5FO8B 3IDCB 2ZGUA 4K9SA 1AXKA 1KQRA 2WA4A 4YVSA 3ZXLA 3JD73 2EXJA 2QNKA 5HCBA 3IMNA 4QMAA 1IS6A 1VBA2 3K48A 1LJ7A 5L36A 3CEWA 1K5MB 1W6MB 2EVXA 4KBBA 5L7OA 4GB33 2JG9B 2WFF2 5FQ0B 3RJ2X 2ZGRA 1H2KA 1ZVFA 3VBHB 2RR11 1AL0G 4NPRA 2MNGA 3FC0A 4RQPB 2DYCA 4LLFA 4C91A 2GMEA 2GNBA 3QCWA 3KLSA 1WBLA 1PGL2 2RMU2 2ZS6B 3KCCA 3Q9OA 4I0WB 4XBLA 2DVBA 4XFCA 4AF9A 1WCSA 4QPIC 3QH6A 4WZFA 2ET7A 2ZA9A 5HCFA 4P9LA 3DL3A 3M2MA 2BWAA 2IXIA 4Q4Y1 1PVC3 4AQSA 4WBBA 3WNXA 4QXKA 4HVOA 3ZIWA 2GN7A 4AE2A 1EP0A 5F1RA 3BALA 1Q3EA 5DUVA 5J37A 2WSUA 3V0BB 4N90A 4U36A 5FAXA 1S0FA 2I45A 2XL9A 4P9IA 4YARA 4H55A 2WJSA 2YROA 5J98B 1V6NA 3LA3A 4WVVA 4TYSA 4PDWC 3AKTA 1LOCA 1G7YA 4Q8KA 1ND2A 1KXGA 3WP6A 2B45X 2PHDA 2JICA 2ZCWA 1Y3TA 4LUMA 4FTBA 1RVF3 1H30A 3I59B 2HWD2 3AZVA 2VUAA 2G9FA 2CGPA 2UURA 2ATFA 1HXS2 3VBSB 4UW6A 4E2GA 4M0NA 4KNCA 5T52A 1JW6A 4GIQA 2D3PA 5C9AC 1LGNA 5GJ6A 1YXWA 4CEYA 3RYRA 2K0GA 2R061 4BIFA 5JZGB 4A3XA 2JG8B 1TMF1 1CD3G 1DZTA 3VHRA 1CQ9A 1B35B 2PTMA 1DLLA 4LHLA 4V1PA 5JAXA 1KFUL 2X5IA 1CAVA 4W6XA 3PVBB 4Z8BA 2NLRA 3RYPA 1RUH2 1RUG1 1FMD1 3IPVA 1XXNA 4NOTA 2ZMLA 5J48A 4ONUA 2RM22 3P3NA 3J8F3 4COWA 1W6PA 4BCUA 1HQWA 4QX5A 4FOQA 3DPRA 4N9IA 3FFZA 3LSDA 3ZSJA 1DQ2A 3M70A 1CONA 5I8YA 1WLWA 3RJRA 1H4GA 1G9AA 4BIOA 1SBFA 2HWB1 3ZN4A 2XJSA 2DCYA 5A32B 2NMOA 1ZA4A 3JCIA 2DFCA 3KCYA 1OFNA 1AR62 2WZR1 2ILMA 4F83A 5JOYA 4P5HA 4M3CB 1H8TB 1W0OA 1YFUA 2D6OX 2XB6C 3RQ0A 5CFDB 2YHJA 3SHRA 3L9JT 5JOZA 1FPN1 4CP2A 4FP3A 2WA3A 1VB4A 1RHI3 1O7FA 2GMPA 2YGMA 1D4M1 4NHKA 2CY6A 4FPEA 1LGBA 4JGYA 2UWBA 3WP5A 3VZNA 1VAMA 1PZ8A 4AI2A 5I8TA 2TUNA 2GMMA 3M3OA 3VBUB 5DG2A 5JOWA 1LOBA 3J9SA 1Q5OA 3FZ3A 1ENRA 3BTAA 2EXKA 4R9AA 1LHVA 1VRH2 4FSJA 2D3RA 1RUF2 1SFYA 4RHV3 3KT1A 4XOGA 1C5IA 1NLRA 1H2NA 1H2MA 2HWC3 5A3LA 1YO8A 5T54A 2A6XA 4XFHA 1MEC2 2ZX2A 3I54A 3M1HA 3H3UA 4XF9A 3WINE 2BTVC 1YJLA 2EIGA 3AP5A 4AEDC 2NYYA 1NY71 1YIPA 2XUMA 2NMNA 5T5OA 1ZZ7A 4JTOA 1BKZA 1ZNPA 1ZBA3 3I4IA 5AFEA 4MGZE 4CP1A 4O9GA 2XWBB 2ZGTA 1CVNA 2GH2A 1PM7A 2JKBA 4EWEA 1AX2A 3GALA 4SBVA 3ZFEA 3INAA 5FBZA 3M8LA 3MGUA 3TN93 3VDDC 4YW1A 3VKMA 2ZKLA 1NCRA 3ZXGA 3ZXKA 3WG3A 4BQ1A 3HT1A 3KGZA 1DIWA 3N3HA 4HMZA 3LZZA 1VBC3 4QQLA 4HKOA 2WT0A 3R4UA 4JGZC 4OI2A 4Y22B 2R073 2H0VA 2B5HA 5GZDA 3N35A 3OBTA 2E7TA 2JX9A 1ND3A 1C8NA 2XJUA 1KRIA 4Q4V1 3B00A 4BOWA 4Q0UA 1RIRA 3G6JB 4XJWA 3MPBA 1WMFA 3WQ0A 3IBMA 4I0AA 4XHXA 2TBVA 1H9WA 1Y7BA 1YIFA 1OPMA 1JYCA 2BVVA 2DVDA 5CB7A 1NXMA 3ZX7A 4Q27A 4DNYA 2JDZA 1W6NA 3RZZA 1DZRA 1QNWA 1R081 2GNMA 1HRI2 3HR9A 3JQXA 5D8AC 1FV3A 5ACA3 3RSJA 1HV0A 1CAWA 4B29A 3PHMA 2TNFA 4D94A 4CYDA 4LEJA 4LBQD 1RUI1 2JE9A 2OYZA 3CLPA 1JUHA 4LULA 2P3KA 2GC2A 3V64A 3ZDSA 4D7TA 1IQAA 1GZCA 5GALA 5B2GB 4Q0SA 1C5HA 1RUE3 1OA3A 1HLCA 1KFXL 2BW8A 3ZVXA 5KHIA 2RS33 2BBVA 5JI9A 1VBE3 2C0ZA 2VQAA 1GZ9A 2D6NA 2YMZA 2IXCA 2RS52 2VW0A 2VOKA 3CJIA 5GZCA 3AMNA 4D3WA 4PBPA 3M4FA 3SNMA 2PLV2 5FOJB 1ALYA 2WNVB 1IS4A 4KL1A 5FFOC 1WA4A 2DCKA 1AR82 2ZABA 3CL1A 4L97A 4RD7A 1VBA1 1ENXA 1W39A 4CDUC 4XMIA 5DG1A 4YSFA 2PHTA 3OD4A 4YM0A 4DY5A 1N1VA 4XF0A 2WFF1 4JV4A 4J1XA 4H7MA 4OHWA 4Q1RA 1JH5A 1FT9A 1YRZA 1VALA 2Q1ZB 4YFZA 1QXPA 1OQ1A 2GALA 5T5LA 4IEYA 4I09A 1ND2B 4KG8A 4IERA 5J3UA 2ZGLA 1ZRCA 3R6SA 1R1A3 1ASJ2 3V65A 3GBFA 4WV8A 4YW2A 1C8M3 3RS6A 3BODA 1PGL1 2D43A 2RMU1 3GYDA 3ZXEA 3NAPC 4KGQA 3KD4A 4RR3C 1AR72 5KHKA 1DGRN 1QOSA 4GKXA 3GZUC 1QJX2 1F9KA 4DRVA 2R49A 5SV5A 2ZPXA 5J09A 3TB0A 3P3PA 1JN2P 1EV12 4CEYB 1PO22 4WVZA 3AYCA 3B9CA 5H9QA 5BPXA 2MEV1 1ZZ9A 1I3HA 2E53A 3CO2A 1FYUA 1ULEA 3WG2A 2BUKA 1N1SA 5LK7B 2BFUL 4XJAA 1CAVB 4AG4A 5A33B 2D6LX 2XG3A 4AHXA 1BBT3 1HRV3 2RJKA 1G86A 5JPMB 4QPGC 1YYNA 3OYWA 3QOPA 2HEWF 4PLNA 2F4PA 1W6PB 3KZ4C 1QY4A 5EYXA 3DPRB 4IV1C 1DYKA 1XE7A 3TRSB 2E7QA 4N53C 5I0SA 1AZDA 4YZ5A 1GQHA 2NZ9A 3SMHA 4GXLA 1S0IA 1HXS1 1D2SA 4QT6A 3U4XA 5I0UA 3O14A 4I3GA 1AYM2 1DQ1A 2YPJA 1IKPA 4COYA 5BXXA 4FVVA 4QQOA 3KGLA 1H4HA 1MZFA 3BOPA 4JC1A 4MGIE 3SH3A 1ZREA 2IXHA 3FX3A 1MVEA 4RQPA 1V9U2 2V09A 4L11A 4Q4X3 1O5LA 1RMU3 2CTVA 4FP2A 1FOD2 2HYKA 1QJY3 5KXEA 2WNUC 4S2DA 1RUH1 4AVVA 4R52A 2XVLA 3USUA 4ZU7A 1NA1A 3ES1A 3FE5A 1O4TA 2RM21 3ROUA 2R30A 4BMBA 4D7YA 4XIOA 5F5QA 4IEWA 2PAMA 1FAYA 3V0AA 1CX4A 3C3VA 5FOBB 1RUD3 4CDWA 5IT6A 3KT4A 1V6IA 2ZX4A 4QPYA 1YNAA 3ETQA 3NKGA 1ZZ6A 2W08A 4R4ZA 3IDEA 4TSVA 4UBGA 4YGBA 3J4UH 3AK0A 2JENA 5F6LB 2AYHA 1AR61 2DCTA 3E5QA 4GULA 4IV3B 5JIAA 4JDMA 1LRHA 1QXRA 2LALA 4OVEA 1F2NA 1AR92 1JUIA 2D40A 2Y0IA 4GB32 2JJ6A 4P9YA 2XJRA 1UL9A 3E5XA 5C4WC 3TWIA 4GMP1 3I59A 4N9HA 2ZX3A 3ZFEB 2P37A 4PDWA 4W65A 1NCRB 5K7PA 1AL23 3IM0A 1KS4A 3POSA 1IS5A 1Z7S1 2P3JA 4LO4B 3WG4A 5EFUA 1S0JA 1AYN3 1ZBE1 1FATA 3HD8B 5FMOL 2E51A 3GBWA 1VRH1 3KCXA 5KC6A 2JD4A 4Y24A 3VL8A 1CIWA 1ND3B 3H9AA 1BMV2 2PN5A 3FBMA 4G9SB 5EV7A 4OUSA 2PYTA 1PVC2 1UU4A 4QGNA 1NXD1 5AC93 1OOPC 5SV8A 4Y1VA 3HT2A 1VLNA 1TME3 1VBD3 4HVQA 4RGGA 2EA7A 4XMAA 2D6KA 1W6NB 1F8VA 4MZUA 4XF3A 4G3YC 4CDQC 1CESA 1CAWB 2BFUS 4YZ4A 1VBB3 2PELA 2XPJA 1PK6C 2YUEA 1MR5A 5BNOC 3OD0A 4R9BA 3AZZA 4CRQA 4AI0A 2VW1A 2I74A 4FOVA 4AGRA 1PHMA 4FXKB 3IKWA 1LESA 4XEZA 1AXZA 1YI9A 1W6QA 1V00A 3ZFFB 2A3WA 3CJIB 1WCKA 2ENRA 4E4SA 4Z92B 5JLVA 1U5XA 2UY9A 1UF2C 3PVOA 1DGLA 2PHXA 3U07A 3AB0A 3FWEA 1EPWA 3H3ZA 4QU2A 1SQ4A 1PIV2 3MZHA 2RR13 1XYNA 3MLKA 4WZCA 1HRI1 5JCTA 2Y38A 4C0BA 4Q29A 1RINA 1OD5A 3KB5A 3O7OA 3S7EA 4KG0A 2WZPP 2CAUA 4GWNA 3WDXA 5BNPC 1O91A 1QKQA 3JBG2 4X8PA 2QDNA 4N43C 2WSVA 1OA2A 4ORFA 4S2HA 3WT3A 3SCFA 3J8F2 3ATGA 4RS5C 4Q4Y3 1LGCA 1U5YA 5GKAC 3ST7A 1R093 1LKNA 4QQPA 3MFAA 1QWRA 1ZYBA 4DINB 2RS51 4QGMA 1LOEA 5BNQA 1GKBA 3WDVA 5I0RA