1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
3HXEA 3DPYA 4GTOA 3Q73A 1FT2A 1N4PA 4GTTA 3HXCA 3EU5A 3E37A 1O1SA 1D8EA 1X81A 1O5MA 1S63A 3DSTA 4YDEA 3Q79A 2F0YA 3Q7AA 3HXBA 1N9AA 2H6GA 3DSVA 1LD8A 3KSLA 1TNZA 1JCQA 3Q75A 1LTXA 1TN7A 1TN8A 2IEJA 3DSSA 1TNUA 4GTSA 4L9PA 1N94A 4LNGA 1SA4A 4GTQA 1O1TA 2H6IA 2H6HA 1TNOA 1N4SA 1SA5A 3SFXA 3HXFA 1DCEA 3PZ2A 1JCSA 3Q78A 2H6FA 3E32A 1D8DA 3KSQA 2BEDA 3E33A 3DRAA 1NL4A 3PZ3A 1KZOA 3DSUA 2ZISA 1MZCA 3DSXA 2ZIRA 4YDOA 4GTRA 3E34A 3PZ4A 1LD7A 3HXDA 1FT1A 1TNYA 4MBGA 3EUVA 1KZPA 1QBQA 1TN6A 3Q7FA 1TNBA 1N95A 1NI1A 1FPPA 3DSWA 1N4RA 1S64A 1O1RA 3C72A 4GTVA 3E30A 4EHMA 1JCRA 4GTMA 2R2LA 3SFYA 4GTPA 1N4QA 4LNBA 3PZ1A
chains in the Genus database with same CATH superfamily
3HVEA 1FT2A 3L13A 4AEZC 4B8CB 2V4LA 4HFGA 3KS2A 4CT4A 4UWHA 1O5MA 2R5SA 4UI9C 4UUCA 2OVBA 1S0PA 2KCKA 1N54A 3OXGA 3LPZA 5EIDA 4FA6A 3FTZA 2WQ7A 4BWRA 2ETAA 3RU0A 2Q7FA 1EYHA 1NZNA 2XEEA 3CSTA 5D2MC 1QQEA 3CVVA 1E7UA 3ZXPA 3KEAA 5ARGA 5BT1A 3IV0A 2BTDA 4DX5D 4KVOA 4GMRA 3TG4A 5CBNA 2DZOA 3CHPA 4DPRA 1DCEA 4HVBA 3PZ2A 5ENQD 4CYMD 1HO8A 5CMWA 3T5XA 4G24A 1H6PA 3ZGQA 1TEZA 3RKVA 5D66A 3D9NA 4I43A 4G11A 4C9BB 4NIKA 4GZ3A 4DJAA 4ZHBA 4DK5A 4FU3A 2VTBA 1INZA 4WAFA 3TL5A 4JA7A 3HHMA 4M3OA 3FH8A 3SF4A 3DXKG 4I6JA 1G3NB 3VLDA 3PNLB 4XEIG 4F6RD 2XEHA 2HR2A 5AN8A 4MKTA 4G23A 3MV2B 3PEUB 3U66A 3B7UX 2EIJE 3ASHA 3V2XA 2RG8A 3P2BA 4APFA 1IXVA 2Y4TA 4ME2A 3UPVA 1BI8B 5LP0A 5LX8A 4HOUA 1E90A 3T9KA 4KVMA 3LEWA 1YA0A 3ONLA 3ASFA 4J8FA 4XZ4A 2LAHA 3HDXA 2P9NG 3CK7A 4GA0A 4RG9A 4U8HA 4UWGA 5EX3A 2IEJA 4RG6A 1DVPA 3DPDA 4IN3B 1NP7A 4A63B 2VSXE 4TUMA 4PS3A 3O4ZA 3APDA 4OVVA 2X3MA 5FJYA 3QAQA 2CHZA 3SFXA 3FEYA 3MKQA 2LXLA 3LJ3A 2DZNA 2B0OE 2NYJA 3LKUA 2VSYA 1K3ZD 1U3CA 3APFA 3DSUA 3CVWA 5LOZA 1E8XA 3B13A 3PS6A 3V79K 5CCMA 4ILGA 2I2OA 4G8LA 2GW1A 3C3RA 3RO2A 5G04J 3NBNB 1NI1A 3D9HA 4F53A 2V8SE 3PE3A 4NACA 3FTYA 2FEZA 5EX0A 3RAUA 3BG0B 2F37A 1N0QA 2KXPC 3CVNA 1PAQA 3B95A 3UKUG 4NURA 3QC1A 2XGOA 4JD2G 3PUKA 3OXFA 3UM0A 2V5FA 4FLBA 5FZSA 1MX4A 3K9IA 3ENEA 4GPKA 2WMNA 3TGOA 2KC7A 3PNTB 5KJMA 3GYZA 4O6FA 4APOA 1OCOE 1XNFA 2J49A 2XZTG 3HVEB 3MKRA 4GTQA 3Q47B 3HIZA 2QC9A 3RK6A 3ABLE 5AQAA 4BT8A 2PZIA 4JHKA 5B3SE 1MQSA 4CT0A 3JYSA 4HRLA 1NL4A 3Q15A 5EKQD 3BEEA 1EDUA 3EJNA 3PZ4A 2OOEA 3T5VA 3D9IA 3D9LA 4BSZB 2XS8A 5FT9A 1QBQA 3FFLA 2PL2A 3MA5A 5BPPA 4AIFA 3ZYQA 1N95A 4N2QA 2AXVA 2VGXA 2FBNA 1U2VG 4LERA 4J8SA 3TWTA 4GTVA 5E76A 1BU9A 4KZ0A 1XGWA 1TYQG 2V4HC 5H7PA 4HORA 3I4GA 3NOGD 5HQ8A 4HOQA 3PREA 2OVFA 3JQ0A 3ZHEB 2WXKA 4J8DA 2DIWA 2L0IA 1S70B 2ILRA 4OAUC 5FTPA 1HXIA 3KEZA 4YNDA 1OWNA 1IQRA 4LSZE 5JHBA 1N9AA 2DYRE 3D9OA 3IXEA 4G26A 5G55A 4U8YD 4ACKA 3CVXA 2ONDA 3FUFA 1OWLA 4J6IA 4AM9A 3LYAA 2ZXWE 3NF1A 2X6FA 2ZGDA 2F8YA 1UJJA 3QARA 2PNNA 2C2LA 3FU6A 2H6HA 2LUHA 3HG0D 3FUDA 1UOHA 2HE0A 2QY7A 3FTUA 3TJPA 3HYMB 3R7QA 4PUCA 1Q2ZA 3VLEA 3CSFA 1WM5A 3FTWA 4YDOA 1Z5SC 5A7DB 2KCLA 3D9PA 1LD7A 3CKCA 4GZ5A 1FT1A 4HRNA 4GMLA 3FP3A 4FP7A 2X38A 4JB8P 4ATGA 1W3BA 2GGFA 1DNPA 1NA0A 3MKQB 4MRUA 4I1AA 1E8YA 5LFAA 1KT1A 1V55E 2I9CA 3C72A 3KD7A 1OWPA 4PDXA 1LF8A 3ZXSA 1DCQA 2XHEA 2XZDG 1N4QA 3TWQA 3QWPA 3FUIA 3ULEG 5KWDA 1IHGA 2XPIA 4GPMA 3MYVA 1BPOA 3G2UA 4HOSA 2IOLA 3DWLG 1O1SA 5ENRD 4TXRA 3IEGA 4GZ6A 5C1DA 4AVXA 4L1BA 4M7CA 4DRXE 3G2SA 3RRUA 3JXJA 4XKCA 3TWXA 1TJFA 3DSSA 4O60A 2PQRA 3O48A 4L2YA 3NZUA 3SO8A 4BY6A 3EHRA 5A6CA 2DYSE 1D9SA 5ENSD 1GW6A 2LXMA 5B1BE 2BEDA 4CDMA 3ZNGA 3L08A 5AQ9A 1A17A 4W9RA 3RRMB 1ELRA 3V2OA 4JXTA 2GRMA 4DLOA 4KYOB 3L17A 4MBGA 4EBAA 5A23A 2AJAA 4HI9A 1QYMA 2EQXA 4GYOA 3J5QB 4A3TA 4JL0A 1Z6TA 2J8SD 2M63A 4KT6B 1Y6IA 4GTMA 2XRZA 1H2VC 3CVYA 1B89A 3LXUX 3RIBA 3DPYA 3NQPA 1K1BA 4I9EA 3UT4A 2I1JA 1YYHA 2XGMA 1FVFA 3MCXA 4F3VA 2F0YA 3FUNA 3UINC 3MZLB 2YQ8A 3C3OA 1JCQA 4J7WA 3L9TA 3SQVA 5EN5D 3KAEA 2MHKA 3QJZA 4L2LA 4PH4B 3PZDA 1TNUA 4XI0A 3S7DA 2NSZA 2EILE 4HQDA 4K5BA 2WB2A 1UN9A 5CHEE 2DCPA 5ENOD 1OCZE 4C0MA 4F7AA 1L5JA 3L82A 4YVOA 4KBQA 4UI9K 2OV8A 5AIJA 2CG3A 2KZTB 1HG2A 5G04C 4U96D 2VSNA 2J07A 4XE0A 3FTVA 5ENNA 5KBAA 4N3CA 2XEVA 4OYSA 2FO1E 3SY2A 3Q4AB 2GRQB 1H0AA 2XPYA 4UQYA 3D9MA 2WVIA 3UT8A 3ZHEA 1ZU2A 5JJTA 2P9LG 1SZAA 1RW2A 3RJVA 3U4TA 4JW1A 4GCOA 3W9FA 1AP7A 5AARA 4TXQA 3SFZA 2WXMA 2UY1A 1IQUA 5AQBA 1E7VA 4R7LA 3HRAA 4WUYA 3CQGB 2WM9A 2BKGA 2IF4A 2Y3AA 5JA4D 3UMVA 1LTXA 3QK0A 1TN8A 2PM7A 4GTSA 4F1SA 2JLBA 1UJKA 3GZ1A 1PC2A 4GU5A 4CGVA 1JWFA 3PUJA 4AV7A 4Y6WA 2X6KA 3PH0C 1P5QA 5ARFA 5FQ6A 3BQOA 3W9GA 2FI7A 2R05A 3UIOC 3DSXA 4I6EA 4Q69A 3IBEA 3QWWA 4HNAD 2EIME 4I2WA 4AJWA 2CFZA 1YMPA 1KLXA 4BX9A 5G05J 2L6BA 1TN6A 4U63A 3ABKE 3DSWA 1N4RA 3BUAA 4JPSA 5T8IA 3JQ1A 3DXMG 4UWLA 3D9KA 4JEUA 3E30A 2QYJA 3ASDA 2WXJA 3SFYA 4ACLA 2WXHA 3RRNB 5AQ7A 5KJKA 4GTOA 2P2CP 3AG4E 3AG2E 3E37A 1BD8A 5IY5E 5B1AE 2GRLA 1BI7B 3EU9A 3DSTA 4HI8A 3OAWA 2XRYA 2WXIA 2A4ZA 1HX8A 4A55A 3QOUA 3G2TA 2X6IA 1AWCB 1TNZA 4TXPA 2ETBA 2XGSA 3SNXA 4N5QA 3EHNA 4EQFA 4YDWA 5FQ4A 3QKYA 2MOWA 4C48B 5T4YA 4D10C 1MYOA 1N11A 1TNOA 1N52A 3AS8A 4O1OA 3E32A 3URZA 3KSQA 3G2WA 3WG7E 3ZYMA 4TRQA 3ABME 3UKRG 4O1PA 3FULA 4GTRA 2RD0A 4I1OB 4ANVA 2IFUA 2PQNA 2C0MA 5FZQA 2XS1A 2PM6A 3TWSA 4ABNA 4I17A 3UX4A 2WQHA 4F1PA 2R2LA 2LSVA 4K5AB 3CKBA 4WWNA 1HF8A 4J8YA 3R9MA 5KNHD 4CCAA 3SHFA 2XCBA 5D0QD 3OXLA 2ETCA 3FUMA 4DX7D 1H6OA 5EDSA 2IJGX 5AJDA 2EINE 3S2AA 2P9UG 4JC8A 1S63A 1Z3YA 3MGBA 4FHKA 4GCNA 3AU4A 1LD8A 5BNWA 4BEPA 2AW6A 4FC8A 3E4BA 4LRZA 1TN7A 1ELKA 1TJCA 2ZGGA 4Z68A 2VJ8A 1SA4A 3FHEA 2H6IA 2IONA 3WXXA 1E8WA 3U9WA 5LCWJ 2UY1B 3FUJA 1OUVA 3Q49B 2Y1LE 4UWKA 3E33A 2OCCE 3DRAA 2KZTA 5BUZA 4ZFHA 5EILA 5KNGA 3ZRHA 4RSYA 4KXKB 4I6GA 3PVLA 1OWMA 2A5EA 2HM8A 1JPLA 2DBAA 3TXNA 4B8AA 4AXHA 5BW8C 3CHOA 4JVSA 3CK8A 4KMOA 3NOCD 2KBXA 1UN8A 2CHWA 3UQ3A 3IHVA 5J08A 3UM3A 3SD5A 4ILHB 1JWGA 2J9QA 4LNBA 3ZFWA 4IULA 3B7TA 1IHBA 3B7SA 4H7YA 1EPUA 3LY7A 3AAAC 1E96B 2V5QC 4IRUA 1PY1A 4HLLA 5FQ8A 3L6AA 3C3QA 5HI7A 3KSLA 4WNGA 2P9PG 3EDTB 4N2SA 2UWJG 3PRZA 4GA1A 3U64A 2P9SG 3ULQA 4DLQA 3L54A 4TUUA 3IKOB 1QZ2A 3TG5A 1WDYA 4LCTA 2RKKA 4ATZD 4JHJA 4GZCA 2I6HA 3HXFA 2KATA 3CGHA 3JCKC 4NQ0A 4HS2A 2R59A 1RZ4A 2Y4UA 4LEUA 4NRHB 3E34A 2WMOA 3FU3A 4K0RA 4UQXA 2GROB 4YVQC 5EYPF 2HYZA 2X6HA 1KZPA 3NB2A 1EF1C 3LCAA 4BSXA 2XQ0A 3VTYA 2XCCA 3F6QA 4ANUA 1O1RA 5G2NA 3SBSA 4JEHA 3IHYA 3ZPJA 4GTPA 3DBSA 5EIBE 2YINA 3TAXA 5JMND 3VTXA 3ISMC 4BTAA 4LUNU 3Q73A 5FWQA 3EIJA 4WWPA 1OT8A 4DX6D 2YNQA 5CMYA 2CFUA 4IYPA 3Q79A 4AOFA 2CG2A 3HXBA 3ZW3A 4RQIA 4E85A 4KZCA 3EHMA 3ONKA 5AAOA 2J08A 1ELWA 3LY8A 2DWZA 3C5RA 1O1TA 1KT0A 5JJ6A 3TWUA 3FUHA 2NXPA 3V31A 3B7BA 1MHQA 4CDRA 2I1KA 2VSOE 4GB9A 5FINA 3Q78A 5DBKA 3SI5A 3CVQA 3APCA 4FULA 2R02A 2LAIA 3CV0A 4ANXA 1SQMA 3PDNA 4N3AA 3LVRE 5G05C 3UXGA 3QWVA 5AYWD 3HXDA 2WXRA 2VGYA 4I2ZA 5KJLA 3ZIMA 1TNBA 1DC2A 3PEVB 2AXUA 5FIOA 2WXGA 4X8QA 4XKBA 3LVQE 3D9JA 2P58C 5CERB 1HZ4A 4HRMB 3SZ7A 3FUEA 4JA9A 2FF4A 1N4PA 3HXCA 3CHQA 2WXFA 3CHSA 5JJ7A 3ESKA 3CVUA 2RFMA 5CECB 4B94A 4BESA 2WXLA 5CRVA 3Q75A 4MLPA 3I3NA 2GRRB 2NC9A 5ITZF 3RO3A 4L9PA 2LNIA 5BXOA 4EBAG 1JCSA 5ANLA 1D8DA 3TWWA 2E0IA 2BKKB 1MZCA 4A3VA 3FEXA 5DIZA 3UM1A 3SBTB 4U04A 3LY9A 4L23A 3DEOA 4ILIA 5ENTD 3ASGA 1ZB1A 2ZU6B 1KPSB 3Q5MA 1WAO1 4K5CA 5FZRA 2BUGA 4HXIA 5AENA 3TWVA 2E2EA 3U3WA 2RFAA 2WXOA 2P9KG 3EHQA 1Y8MA 4PS7A 3ZKJA 4CEMA 2L6JA 3BG1B 2AWIA 4BERA 4JZYA 4HOTA 3CQCB 2XENA 1WY6A 5HRYA 3Q9UC 3UI2A 2LSUA 3CR3A 3L16A 4XIFA 1H6KA 4HB5A 5BXUA 3EU5A 4PS8A 5CCLA 4LG6A 4H7XA 1E8ZA 1K8KG 4BTBA 4BT9A 4E6HA 1BLXB 4UI9J 2J4BA 2Y69E 3JUEA 1U3DA 4GAAA 5HKPA 4L7TA 5LCWC 5ENPD 1HU3A 5CBOA 3CHMA 4GZDA 1X5BA 3QB2A 3FTXA 4EZKA 3TWRA 2Y0BG 3ZEFA 4A1GA 2C0LA 1UW4B 2H6FA 2MYOA 3ZUVB 4XI9A 3GZSA 1KZOA 2ZISA 2J4DA 3ASOE 3QNKA 5JHAA 5T3RA 3CLJA 3S7BA 3EIQC 2MRIA 3X2QE 4C0EA 3C98A 4G25A 1IYGA 4FJZA 4G2VA 4JHRA 1TNYA 2R03A 3EUVA 5BV1A 1OWOA 3MJWA 3RSEG 5CEDB 3ULYA 3NAWA 1HFAA 4G1TA 4CDNA 4RVBA 4WWOA 2HO1A 3AJIA 3L22A 4A1SA 3UT7A 1H19A 2AXZA 3PE4A 4OAVB 4BETA 3LJNA 2GRNB 3PZ1A 4QQIA 3HXEA 1OY3D 3SGHA 2P9IG 3UTMA 3I4RB 2IY0C 2FO7A 1MX6A 1D8EA 2JABA 3DEPA 1TR4A 4MS6A 4TV3A 2AVPA 1V54E 1FCHA 4G8KA 3BU8A 2JEKA 4FHJA 3FDHA 2KCVA 3LDZA 4DX1A 1A5EA 3UUXA 2VGEA 5KJNA 4LNUD 2BF0X 4ANWA 5E75A 3D3MA 1WG0A 1VDYA 1SA5A 3AG3E 2VYIA 1Z3XA 1FVHA 1UG3A 5FQ7A 3PZ3A 4CGWA 1K1AA 1OCCE 3CHRA 2J09A 3Q9NC 3S7JA 4U7EB 3CVLA 4N39A 3AG1E 2V0PA 1OXJA 2IU1A 3CVPA 4DX2A 3ESLA 3JUIA 2VTBB 2WPVA 2CHXA 1SZ9A 5ANRA 4U0UA 1N0RA 2IQCA 4GTTA 4QFVA 5C2YA 1X81A 4J0UA 3TXMA 2WXQA 1OCRE 2XPZA 4K03A 4YDEA 2IO3C 3Q7AA 4EZJA 4CZ2D 3QDNA 2IOSA 2H6GA 3ZU7B 4BX8A 2R17C 3ZYKA 4URKA 2B6CA 2QYUA 3R9AB 1HG5A 2WXPA 3AU5A 5BV0A 4XX5A 5CEAA 4U8VD 3FWVA 1MJ0A 3ASNE 3UM2A 4HLEA 1N94A 3ML9A 4CRWA 1ZBPA 2OEWA 4Y6CA 3AS4A 4EPZA 4FJYA 1YCSB 1N4SA 3CIAA 2GRPB 3ZVVA 3ZN3A 3CEQA 4DUIA 3FY4A 2ZIRA 4Q94A 3G2VA 4EZLA 2WQ6A 4AY5A 2KM4A 1IKND 1HS6A 3GZ2A 5D0OD 1SVXA 3I5PA 4AP2A 3ML8A 3S7FA 3MEKA 1H2TC 4B93B 4UQZA 3ZYLA 4OVUA 4EECA 1FPPA 3J5PA 3FH5A 5HS0A 4GMJA 3N71A 4FLHA 4P29A 3T8MA 5M72A 2X6JA 2YHCA 4J8EA 5J90A 1JCRA 2IO2C 4U0ZA 4WNFA 3MX3A 4WNEA 2DVWA 3FTSA 3JXIA 3UIPC 4GYWA 3FU0A 4DI4A 2QZAA 4B0ZA 3V30A 4U07A 3VLFA 2OEVA 1QNFA 4I9CA 3DSVA 4N3BA 4N5CA 2FULA 4GYYA 1JUQA 4B89A 4HBDA 4LNGA 4YDYA 1MX2A 2A5UA 5EYLA 4V3IA 5CRUA 3NZSA 3CK9A 3MV3B 4AY6A 2EIKE 2WXNA 4WNDA 4U0SA 3R7RA 3FUKA 1HE8A 2YHEA 3FU5A 3GW4A 1NA3A 4BFRA 5AJLA 3P1UA 1SW6A 2F8XK 3B7RL 2L0TB 3LS8A 4UWFA 4U95D 3AS5A 5KCMA 2VQ2A 4I1MA 4Q96A 3T8KA 4GA2A 4RLYA 3Q7FA 4DI3A 3OTNA 1S64A 2VGXB 2L9BA 4EHMA 2LO6A 2QFCA 3FH7A 1H2UA 4FADA 1NFIE 1HH8A
chains in the Genus database with same CATH topology
3HXEA 3DPYA 4GTOA 3Q73A 1FT2A 1N4PA 4GTTA 3HXCA 3EU5A 3E37A 1O1SA 1D8EA 1X81A 1O5MA 1S63A 3DSTA 4YDEA 3Q79A 2F0YA 3Q7AA 3HXBA 1N9AA 2H6GA 3DSVA 1LD8A 3KSLA 1TNZA 1JCQA 3Q75A 1LTXA 1TN7A 1TN8A 2IEJA 3DSSA 1TNUA 4GTSA 4L9PA 1N94A 4LNGA 1SA4A 4GTQA 1O1TA 2H6IA 2H6HA 1TNOA 1N4SA 1SA5A 3SFXA 3HXFA 1DCEA 3PZ2A 1JCSA 3Q78A 2H6FA 3E32A 1D8DA 3KSQA 2BEDA 3E33A 3DRAA 1NL4A 3PZ3A 1KZOA 3DSUA 2ZISA 1MZCA 3DSXA 2ZIRA 4YDOA 4GTRA 3E34A 3PZ4A 1LD7A 3HXDA 1FT1A 1TNYA 4MBGA 3EUVA 1KZPA 1QBQA 1TN6A 3Q7FA 1TNBA 1N95A 1NI1A 1FPPA 3DSWA 1N4RA 1S64A 1O1RA 3C72A 4GTVA 3E30A 4EHMA 1JCRA 4GTMA 2R2LA 3SFYA 4GTPA 1N4QA 4LNBA 3PZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXE A;  3DPY A;  4GTO A;  3Q73 A;  1FT2 A;  1N4P A;  4GTT A;  3HXC A;  3EU5 A;  3E37 A;  1O1S A;  1D8E A;  1X81 A;  1O5M A;  1S63 A;  3DST A;  4YDE A;  3Q79 A;  2F0Y A;  3Q7A A;  3HXB A;  1N9A A;  2H6G A;  3DSV A;  1LD8 A;  3KSL A;  1TNZ A;  1JCQ A;  3Q75 A;  1LTX A;  1TN7 A;  1TN8 A;  2IEJ A;  3DSS A;  1TNU A;  4GTS A;  4L9P A;  1N94 A;  4LNG A;  1SA4 A;  4GTQ A;  1O1T A;  2H6I A;  2H6H A;  1TNO A;  1N4S A;  1SA5 A;  3SFX A;  3HXF A;  1DCE A;  3PZ2 A;  1JCS A;  3Q78 A;  2H6F A;  3E32 A;  1D8D A;  3KSQ A;  2BED A;  3E33 A;  3DRA A;  1NL4 A;  3PZ3 A;  1KZO A;  3DSU A;  2ZIS A;  1MZC A;  3DSX A;  2ZIR A;  4YDO A;  4GTR A;  3E34 A;  3PZ4 A;  1LD7 A;  3HXD A;  1FT1 A;  1TNY A;  4MBG A;  3EUV A;  1KZP A;  1QBQ A;  1TN6 A;  3Q7F A;  1TNB A;  1N95 A;  1NI1 A;  1FPP A;  3DSW A;  1N4R A;  1S64 A;  1O1R A;  3C72 A;  4GTV A;  3E30 A;  4EHM A;  1JCR A;  4GTM A;  2R2L A;  3SFY A;  4GTP A;  1N4Q A;  4LNB A;  3PZ1 A; 
#chains in the Genus database with same CATH topology
 3HVE A;  1FT2 A;  3L13 A;  4AEZ C;  4B8C B;  2V4L A;  4HFG A;  3KS2 A;  4CT4 A;  4UWH A;  1O5M A;  2R5S A;  4UI9 C;  4UUC A;  2OVB A;  1S0P A;  2KCK A;  1N54 A;  3OXG A;  3LPZ A;  5EID A;  4FA6 A;  3FTZ A;  2WQ7 A;  4BWR A;  2ETA A;  3RU0 A;  2Q7F A;  1EYH A;  1NZN A;  2XEE A;  3CST A;  5D2M C;  1QQE A;  3CVV A;  1E7U A;  3ZXP A;  3KEA A;  5ARG A;  5BT1 A;  3IV0 A;  2BTD A;  4DX5 D;  4KVO A;  4GMR A;  3TG4 A;  5CBN A;  2DZO A;  3CHP A;  4DPR A;  1DCE A;  4HVB A;  3PZ2 A;  5ENQ D;  4CYM D;  1HO8 A;  5CMW A;  3T5X A;  4G24 A;  1H6P A;  3ZGQ A;  1TEZ A;  3RKV A;  5D66 A;  3D9N A;  4I43 A;  4G11 A;  4C9B B;  4NIK A;  4GZ3 A;  4DJA A;  4ZHB A;  4DK5 A;  4FU3 A;  2VTB A;  1INZ A;  4WAF A;  3TL5 A;  4JA7 A;  3HHM A;  4M3O A;  3FH8 A;  3SF4 A;  3DXK G;  4I6J A;  1G3N B;  3VLD A;  3PNL B;  4XEI G;  4F6R D;  2XEH A;  2HR2 A;  5AN8 A;  4MKT A;  4G23 A;  3MV2 B;  3PEU B;  3U66 A;  3B7U X;  2EIJ E;  3ASH A;  3V2X A;  2RG8 A;  3P2B A;  4APF A;  1IXV A;  2Y4T A;  4ME2 A;  3UPV A;  1BI8 B;  5LP0 A;  5LX8 A;  4HOU A;  1E90 A;  3T9K A;  4KVM A;  3LEW A;  1YA0 A;  3ONL A;  3ASF A;  4J8F A;  4XZ4 A;  2LAH A;  3HDX A;  2P9N G;  3CK7 A;  4GA0 A;  4RG9 A;  4U8H A;  4UWG A;  5EX3 A;  2IEJ A;  4RG6 A;  1DVP A;  3DPD A;  4IN3 B;  1NP7 A;  4A63 B;  2VSX E;  4TUM A;  4PS3 A;  3O4Z A;  3APD A;  4OVV A;  2X3M A;  5FJY A;  3QAQ A;  2CHZ A;  3SFX A;  3FEY A;  3MKQ A;  2LXL A;  3LJ3 A;  2DZN A;  2B0O E;  2NYJ A;  3LKU A;  2VSY A;  1K3Z D;  1U3C A;  3APF A;  3DSU A;  3CVW A;  5LOZ A;  1E8X A;  3B13 A;  3PS6 A;  3V79 K;  5CCM A;  4ILG A;  2I2O A;  4G8L A;  2GW1 A;  3C3R A;  3RO2 A;  5G04 J;  3NBN B;  1NI1 A;  3D9H A;  4F53 A;  2V8S E;  3PE3 A;  4NAC A;  3FTY A;  2FEZ A;  5EX0 A;  3RAU A;  3BG0 B;  2F37 A;  1N0Q A;  2KXP C;  3CVN A;  1PAQ A;  3B95 A;  3UKU G;  4NUR A;  3QC1 A;  2XGO A;  4JD2 G;  3PUK A;  3OXF A;  3UM0 A;  2V5F A;  4FLB A;  5FZS A;  1MX4 A;  3K9I A;  3ENE A;  4GPK A;  2WMN A;  3TGO A;  2KC7 A;  3PNT B;  5KJM A;  3GYZ A;  4O6F A;  4APO A;  1OCO E;  1XNF A;  2J49 A;  2XZT G;  3HVE B;  3MKR A;  4GTQ A;  3Q47 B;  3HIZ A;  2QC9 A;  3RK6 A;  3ABL E;  5AQA A;  4BT8 A;  2PZI A;  4JHK A;  5B3S E;  1MQS A;  4CT0 A;  3JYS A;  4HRL A;  1NL4 A;  3Q15 A;  5EKQ D;  3BEE A;  1EDU A;  3EJN A;  3PZ4 A;  2OOE A;  3T5V A;  3D9I A;  3D9L A;  4BSZ B;  2XS8 A;  5FT9 A;  1QBQ A;  3FFL A;  2PL2 A;  3MA5 A;  5BPP A;  4AIF A;  3ZYQ A;  1N95 A;  4N2Q A;  2AXV A;  2VGX A;  2FBN A;  1U2V G;  4LER A;  4J8S A;  3TWT A;  4GTV A;  5E76 A;  1BU9 A;  4KZ0 A;  1XGW A;  1TYQ G;  2V4H C;  5H7P A;  4HOR A;  3I4G A;  3NOG D;  5HQ8 A;  4HOQ A;  3PRE A;  2OVF A;  3JQ0 A;  3ZHE B;  2WXK A;  4J8D A;  2DIW A;  2L0I A;  1S70 B;  2ILR A;  4OAU C;  5FTP A;  1HXI A;  3KEZ A;  4YND A;  1OWN A;  1IQR A;  4LSZ E;  5JHB A;  1N9A A;  2DYR E;  3D9O A;  3IXE A;  4G26 A;  5G55 A;  4U8Y D;  4ACK A;  3CVX A;  2OND A;  3FUF A;  1OWL A;  4J6I A;  4AM9 A;  3LYA A;  2ZXW E;  3NF1 A;  2X6F A;  2ZGD A;  2F8Y A;  1UJJ A;  3QAR A;  2PNN A;  2C2L A;  3FU6 A;  2H6H A;  2LUH A;  3HG0 D;  3FUD A;  1UOH A;  2HE0 A;  2QY7 A;  3FTU A;  3TJP A;  3HYM B;  3R7Q A;  4PUC A;  1Q2Z A;  3VLE A;  3CSF A;  1WM5 A;  3FTW A;  4YDO A;  1Z5S C;  5A7D B;  2KCL A;  3D9P A;  1LD7 A;  3CKC A;  4GZ5 A;  1FT1 A;  4HRN A;  4GML A;  3FP3 A;  4FP7 A;  2X38 A;  4JB8 P;  4ATG A;  1W3B A;  2GGF A;  1DNP A;  1NA0 A;  3MKQ B;  4MRU A;  4I1A A;  1E8Y A;  5LFA A;  1KT1 A;  1V55 E;  2I9C A;  3C72 A;  3KD7 A;  1OWP A;  4PDX A;  1LF8 A;  3ZXS A;  1DCQ A;  2XHE A;  2XZD G;  1N4Q A;  3TWQ A;  3QWP A;  3FUI A;  3ULE G;  5KWD A;  1IHG A;  2XPI A;  4GPM A;  3MYV A;  1BPO A;  3G2U A;  4HOS A;  2IOL A;  3DWL G;  1O1S A;  5ENR D;  4TXR A;  3IEG A;  4GZ6 A;  5C1D A;  4AVX A;  4L1B A;  4M7C A;  4DRX E;  3G2S A;  3RRU A;  3JXJ A;  4XKC A;  3TWX A;  1TJF A;  3DSS A;  4O60 A;  2PQR A;  3O48 A;  4L2Y A;  3NZU A;  3SO8 A;  4BY6 A;  3EHR A;  5A6C A;  2DYS E;  1D9S A;  5ENS D;  1GW6 A;  2LXM A;  5B1B E;  2BED A;  4CDM A;  3ZNG A;  3L08 A;  5AQ9 A;  1A17 A;  4W9R A;  3RRM B;  1ELR A;  3V2O A;  4JXT A;  2GRM A;  4DLO A;  4KYO B;  3L17 A;  4MBG A;  4EBA A;  5A23 A;  2AJA A;  4HI9 A;  1QYM A;  2EQX A;  4GYO A;  3J5Q B;  4A3T A;  4JL0 A;  1Z6T A;  2J8S D;  2M63 A;  4KT6 B;  1Y6I A;  4GTM A;  2XRZ A;  1H2V C;  3CVY A;  1B89 A;  3LXU X;  3RIB A;  3DPY A;  3NQP A;  1K1B A;  4I9E A;  3UT4 A;  2I1J A;  1YYH A;  2XGM A;  1FVF A;  3MCX A;  4F3V A;  2F0Y A;  3FUN A;  3UIN C;  3MZL B;  2YQ8 A;  3C3O A;  1JCQ A;  4J7W A;  3L9T A;  3SQV A;  5EN5 D;  3KAE A;  2MHK A;  3QJZ A;  4L2L A;  4PH4 B;  3PZD A;  1TNU A;  4XI0 A;  3S7D A;  2NSZ A;  2EIL E;  4HQD A;  4K5B A;  2WB2 A;  1UN9 A;  5CHE E;  2DCP A;  5ENO D;  1OCZ E;  4C0M A;  4F7A A;  1L5J A;  3L82 A;  4YVO A;  4KBQ A;  4UI9 K;  2OV8 A;  5AIJ A;  2CG3 A;  2KZT B;  1HG2 A;  5G04 C;  4U96 D;  2VSN A;  2J07 A;  4XE0 A;  3FTV A;  5ENN A;  5KBA A;  4N3C A;  2XEV A;  4OYS A;  2FO1 E;  3SY2 A;  3Q4A B;  2GRQ B;  1H0A A;  2XPY A;  4UQY A;  3D9M A;  2WVI A;  3UT8 A;  3ZHE A;  1ZU2 A;  5JJT A;  2P9L G;  1SZA A;  1RW2 A;  3RJV A;  3U4T A;  4JW1 A;  4GCO A;  3W9F A;  1AP7 A;  5AAR A;  4TXQ A;  3SFZ A;  2WXM A;  2UY1 A;  1IQU A;  5AQB A;  1E7V A;  4R7L A;  3HRA A;  4WUY A;  3CQG B;  2WM9 A;  2BKG A;  2IF4 A;  2Y3A A;  5JA4 D;  3UMV A;  1LTX A;  3QK0 A;  1TN8 A;  2PM7 A;  4GTS A;  4F1S A;  2JLB A;  1UJK A;  3GZ1 A;  1PC2 A;  4GU5 A;  4CGV A;  1JWF A;  3PUJ A;  4AV7 A;  4Y6W A;  2X6K A;  3PH0 C;  1P5Q A;  5ARF A;  5FQ6 A;  3BQO A;  3W9G A;  2FI7 A;  2R05 A;  3UIO C;  3DSX A;  4I6E A;  4Q69 A;  3IBE A;  3QWW A;  4HNA D;  2EIM E;  4I2W A;  4AJW A;  2CFZ A;  1YMP A;  1KLX A;  4BX9 A;  5G05 J;  2L6B A;  1TN6 A;  4U63 A;  3ABK E;  3DSW A;  1N4R A;  3BUA A;  4JPS A;  5T8I A;  3JQ1 A;  3DXM G;  4UWL A;  3D9K A;  4JEU A;  3E30 A;  2QYJ A;  3ASD A;  2WXJ A;  3SFY A;  4ACL A;  2WXH A;  3RRN B;  5AQ7 A;  5KJK A;  4GTO A;  2P2C P;  3AG4 E;  3AG2 E;  3E37 A;  1BD8 A;  5IY5 E;  5B1A E;  2GRL A;  1BI7 B;  3EU9 A;  3DST A;  4HI8 A;  3OAW A;  2XRY A;  2WXI A;  2A4Z A;  1HX8 A;  4A55 A;  3QOU A;  3G2T A;  2X6I A;  1AWC B;  1TNZ A;  4TXP A;  2ETB A;  2XGS A;  3SNX A;  4N5Q A;  3EHN A;  4EQF A;  4YDW A;  5FQ4 A;  3QKY A;  2MOW A;  4C48 B;  5T4Y A;  4D10 C;  1MYO A;  1N11 A;  1TNO A;  1N52 A;  3AS8 A;  4O1O A;  3E32 A;  3URZ A;  3KSQ A;  3G2W A;  3WG7 E;  3ZYM A;  4TRQ A;  3ABM E;  3UKR G;  4O1P A;  3FUL A;  4GTR A;  2RD0 A;  4I1O B;  4ANV A;  2IFU A;  2PQN A;  2C0M A;  5FZQ A;  2XS1 A;  2PM6 A;  3TWS A;  4ABN A;  4I17 A;  3UX4 A;  2WQH A;  4F1P A;  2R2L A;  2LSV A;  4K5A B;  3CKB A;  4WWN A;  1HF8 A;  4J8Y A;  3R9M A;  5KNH D;  4CCA A;  3SHF A;  2XCB A;  5D0Q D;  3OXL A;  2ETC A;  3FUM A;  4DX7 D;  1H6O A;  5EDS A;  2IJG X;  5AJD A;  2EIN E;  3S2A A;  2P9U G;  4JC8 A;  1S63 A;  1Z3Y A;  3MGB A;  4FHK A;  4GCN A;  3AU4 A;  1LD8 A;  5BNW A;  4BEP A;  2AW6 A;  4FC8 A;  3E4B A;  4LRZ A;  1TN7 A;  1ELK A;  1TJC A;  2ZGG A;  4Z68 A;  2VJ8 A;  1SA4 A;  3FHE A;  2H6I A;  2ION A;  3WXX A;  1E8W A;  3U9W A;  5LCW J;  2UY1 B;  3FUJ A;  1OUV A;  3Q49 B;  2Y1L E;  4UWK A;  3E33 A;  2OCC E;  3DRA A;  2KZT A;  5BUZ A;  4ZFH A;  5EIL A;  5KNG A;  3ZRH A;  4RSY A;  4KXK B;  4I6G A;  3PVL A;  1OWM A;  2A5E A;  2HM8 A;  1JPL A;  2DBA A;  3TXN A;  4B8A A;  4AXH A;  5BW8 C;  3CHO A;  4JVS A;  3CK8 A;  4KMO A;  3NOC D;  2KBX A;  1UN8 A;  2CHW A;  3UQ3 A;  3IHV A;  5J08 A;  3UM3 A;  3SD5 A;  4ILH B;  1JWG A;  2J9Q A;  4LNB A;  3ZFW A;  4IUL A;  3B7T A;  1IHB A;  3B7S A;  4H7Y A;  1EPU A;  3LY7 A;  3AAA C;  1E96 B;  2V5Q C;  4IRU A;  1PY1 A;  4HLL A;  5FQ8 A;  3L6A A;  3C3Q A;  5HI7 A;  3KSL A;  4WNG A;  2P9P G;  3EDT B;  4N2S A;  2UWJ G;  3PRZ A;  4GA1 A;  3U64 A;  2P9S G;  3ULQ A;  4DLQ A;  3L54 A;  4TUU A;  3IKO B;  1QZ2 A;  3TG5 A;  1WDY A;  4LCT A;  2RKK A;  4ATZ D;  4JHJ A;  4GZC A;  2I6H A;  3HXF A;  2KAT A;  3CGH A;  3JCK C;  4NQ0 A;  4HS2 A;  2R59 A;  1RZ4 A;  2Y4U A;  4LEU A;  4NRH B;  3E34 A;  2WMO A;  3FU3 A;  4K0R A;  4UQX A;  2GRO B;  4YVQ C;  5EYP F;  2HYZ A;  2X6H A;  1KZP A;  3NB2 A;  1EF1 C;  3LCA A;  4BSX A;  2XQ0 A;  3VTY A;  2XCC A;  3F6Q A;  4ANU A;  1O1R A;  5G2N A;  3SBS A;  4JEH A;  3IHY A;  3ZPJ A;  4GTP A;  3DBS A;  5EIB E;  2YIN A;  3TAX A;  5JMN D;  3VTX A;  3ISM C;  4BTA A;  4LUN U;  3Q73 A;  5FWQ A;  3EIJ A;  4WWP A;  1OT8 A;  4DX6 D;  2YNQ A;  5CMY A;  2CFU A;  4IYP A;  3Q79 A;  4AOF A;  2CG2 A;  3HXB A;  3ZW3 A;  4RQI A;  4E85 A;  4KZC A;  3EHM A;  3ONK A;  5AAO A;  2J08 A;  1ELW A;  3LY8 A;  2DWZ A;  3C5R A;  1O1T A;  1KT0 A;  5JJ6 A;  3TWU A;  3FUH A;  2NXP A;  3V31 A;  3B7B A;  1MHQ A;  4CDR A;  2I1K A;  2VSO E;  4GB9 A;  5FIN A;  3Q78 A;  5DBK A;  3SI5 A;  3CVQ A;  3APC A;  4FUL A;  2R02 A;  2LAI A;  3CV0 A;  4ANX A;  1SQM A;  3PDN A;  4N3A A;  3LVR E;  5G05 C;  3UXG A;  3QWV A;  5AYW D;  3HXD A;  2WXR A;  2VGY A;  4I2Z A;  5KJL A;  3ZIM A;  1TNB A;  1DC2 A;  3PEV B;  2AXU A;  5FIO A;  2WXG A;  4X8Q A;  4XKB A;  3LVQ E;  3D9J A;  2P58 C;  5CER B;  1HZ4 A;  4HRM B;  3SZ7 A;  3FUE A;  4JA9 A;  2FF4 A;  1N4P A;  3HXC A;  3CHQ A;  2WXF A;  3CHS A;  5JJ7 A;  3ESK A;  3CVU A;  2RFM A;  5CEC B;  4B94 A;  4BES A;  2WXL A;  5CRV A;  3Q75 A;  4MLP A;  3I3N A;  2GRR B;  2NC9 A;  5ITZ F;  3RO3 A;  4L9P A;  2LNI A;  5BXO A;  4EBA G;  1JCS A;  5ANL A;  1D8D A;  3TWW A;  2E0I A;  2BKK B;  1MZC A;  4A3V A;  3FEX A;  5DIZ A;  3UM1 A;  3SBT B;  4U04 A;  3LY9 A;  4L23 A;  3DEO A;  4ILI A;  5ENT D;  3ASG A;  1ZB1 A;  2ZU6 B;  1KPS B;  3Q5M A;  1WAO 1;  4K5C A;  5FZR A;  2BUG A;  4HXI A;  5AEN A;  3TWV A;  2E2E A;  3U3W A;  2RFA A;  2WXO A;  2P9K G;  3EHQ A;  1Y8M A;  4PS7 A;  3ZKJ A;  4CEM A;  2L6J A;  3BG1 B;  2AWI A;  4BER A;  4JZY A;  4HOT A;  3CQC B;  2XEN A;  1WY6 A;  5HRY A;  3Q9U C;  3UI2 A;  2LSU A;  3CR3 A;  3L16 A;  4XIF A;  1H6K A;  4HB5 A;  5BXU A;  3EU5 A;  4PS8 A;  5CCL A;  4LG6 A;  4H7X A;  1E8Z A;  1K8K G;  4BTB A;  4BT9 A;  4E6H A;  1BLX B;  4UI9 J;  2J4B A;  2Y69 E;  3JUE A;  1U3D A;  4GAA A;  5HKP A;  4L7T A;  5LCW C;  5ENP D;  1HU3 A;  5CBO A;  3CHM A;  4GZD A;  1X5B A;  3QB2 A;  3FTX A;  4EZK A;  3TWR A;  2Y0B G;  3ZEF A;  4A1G A;  2C0L A;  1UW4 B;  2H6F A;  2MYO A;  3ZUV B;  4XI9 A;  3GZS A;  1KZO A;  2ZIS A;  2J4D A;  3ASO E;  3QNK A;  5JHA A;  5T3R A;  3CLJ A;  3S7B A;  3EIQ C;  2MRI A;  3X2Q E;  4C0E A;  3C98 A;  4G25 A;  1IYG A;  4FJZ A;  4G2V A;  4JHR A;  1TNY A;  2R03 A;  3EUV A;  5BV1 A;  1OWO A;  3MJW A;  3RSE G;  5CED B;  3ULY A;  3NAW A;  1HFA A;  4G1T A;  4CDN A;  4RVB A;  4WWO A;  2HO1 A;  3AJI A;  3L22 A;  4A1S A;  3UT7 A;  1H19 A;  2AXZ A;  3PE4 A;  4OAV B;  4BET A;  3LJN A;  2GRN B;  3PZ1 A;  4QQI A;  3HXE A;  1OY3 D;  3SGH A;  2P9I G;  3UTM A;  3I4R B;  2IY0 C;  2FO7 A;  1MX6 A;  1D8E A;  2JAB A;  3DEP A;  1TR4 A;  4MS6 A;  4TV3 A;  2AVP A;  1V54 E;  1FCH A;  4G8K A;  3BU8 A;  2JEK A;  4FHJ A;  3FDH A;  2KCV A;  3LDZ A;  4DX1 A;  1A5E A;  3UUX A;  2VGE A;  5KJN A;  4LNU D;  2BF0 X;  4ANW A;  5E75 A;  3D3M A;  1WG0 A;  1VDY A;  1SA5 A;  3AG3 E;  2VYI A;  1Z3X A;  1FVH A;  1UG3 A;  5FQ7 A;  3PZ3 A;  4CGW A;  1K1A A;  1OCC E;  3CHR A;  2J09 A;  3Q9N C;  3S7J A;  4U7E B;  3CVL A;  4N39 A;  3AG1 E;  2V0P A;  1OXJ A;  2IU1 A;  3CVP A;  4DX2 A;  3ESL A;  3JUI A;  2VTB B;  2WPV A;  2CHX A;  1SZ9 A;  5ANR A;  4U0U A;  1N0R A;  2IQC A;  4GTT A;  4QFV A;  5C2Y A;  1X81 A;  4J0U A;  3TXM A;  2WXQ A;  1OCR E;  2XPZ A;  4K03 A;  4YDE A;  2IO3 C;  3Q7A A;  4EZJ A;  4CZ2 D;  3QDN A;  2IOS A;  2H6G A;  3ZU7 B;  4BX8 A;  2R17 C;  3ZYK A;  4URK A;  2B6C A;  2QYU A;  3R9A B;  1HG5 A;  2WXP A;  3AU5 A;  5BV0 A;  4XX5 A;  5CEA A;  4U8V D;  3FWV A;  1MJ0 A;  3ASN E;  3UM2 A;  4HLE A;  1N94 A;  3ML9 A;  4CRW A;  1ZBP A;  2OEW A;  4Y6C A;  3AS4 A;  4EPZ A;  4FJY A;  1YCS B;  1N4S A;  3CIA A;  2GRP B;  3ZVV A;  3ZN3 A;  3CEQ A;  4DUI A;  3FY4 A;  2ZIR A;  4Q94 A;  3G2V A;  4EZL A;  2WQ6 A;  4AY5 A;  2KM4 A;  1IKN D;  1HS6 A;  3GZ2 A;  5D0O D;  1SVX A;  3I5P A;  4AP2 A;  3ML8 A;  3S7F A;  3MEK A;  1H2T C;  4B93 B;  4UQZ A;  3ZYL A;  4OVU A;  4EEC A;  1FPP A;  3J5P A;  3FH5 A;  5HS0 A;  4GMJ A;  3N71 A;  4FLH A;  4P29 A;  3T8M A;  5M72 A;  2X6J A;  2YHC A;  4J8E A;  5J90 A;  1JCR A;  2IO2 C;  4U0Z A;  4WNF A;  3MX3 A;  4WNE A;  2DVW A;  3FTS A;  3JXI A;  3UIP C;  4GYW A;  3FU0 A;  4DI4 A;  2QZA A;  4B0Z A;  3V30 A;  4U07 A;  3VLF A;  2OEV A;  1QNF A;  4I9C A;  3DSV A;  4N3B A;  4N5C A;  2FUL A;  4GYY A;  1JUQ A;  4B89 A;  4HBD A;  4LNG A;  4YDY A;  1MX2 A;  2A5U A;  5EYL A;  4V3I A;  5CRU A;  3NZS A;  3CK9 A;  3MV3 B;  4AY6 A;  2EIK E;  2WXN A;  4WND A;  4U0S A;  3R7R A;  3FUK A;  1HE8 A;  2YHE A;  3FU5 A;  3GW4 A;  1NA3 A;  4BFR A;  5AJL A;  3P1U A;  1SW6 A;  2F8X K;  3B7R L;  2L0T B;  3LS8 A;  4UWF A;  4U95 D;  3AS5 A;  5KCM A;  2VQ2 A;  4I1M A;  4Q96 A;  3T8K A;  4GA2 A;  4RLY A;  3Q7F A;  4DI3 A;  3OTN A;  1S64 A;  2VGX B;  2L9B A;  4EHM A;  2LO6 A;  2QFC A;  3FH7 A;  1H2U A;  4FAD A;  1NFI E;  1HH8 A; 
#chains in the Genus database with same CATH homology
 3HXE A;  3DPY A;  4GTO A;  3Q73 A;  1FT2 A;  1N4P A;  4GTT A;  3HXC A;  3EU5 A;  3E37 A;  1O1S A;  1D8E A;  1X81 A;  1O5M A;  1S63 A;  3DST A;  4YDE A;  3Q79 A;  2F0Y A;  3Q7A A;  3HXB A;  1N9A A;  2H6G A;  3DSV A;  1LD8 A;  3KSL A;  1TNZ A;  1JCQ A;  3Q75 A;  1LTX A;  1TN7 A;  1TN8 A;  2IEJ A;  3DSS A;  1TNU A;  4GTS A;  4L9P A;  1N94 A;  4LNG A;  1SA4 A;  4GTQ A;  1O1T A;  2H6I A;  2H6H A;  1TNO A;  1N4S A;  1SA5 A;  3SFX A;  3HXF A;  1DCE A;  3PZ2 A;  1JCS A;  3Q78 A;  2H6F A;  3E32 A;  1D8D A;  3KSQ A;  2BED A;  3E33 A;  3DRA A;  1NL4 A;  3PZ3 A;  1KZO A;  3DSU A;  2ZIS A;  1MZC A;  3DSX A;  2ZIR A;  4YDO A;  4GTR A;  3E34 A;  3PZ4 A;  1LD7 A;  3HXD A;  1FT1 A;  1TNY A;  4MBG A;  3EUV A;  1KZP A;  1QBQ A;  1TN6 A;  3Q7F A;  1TNB A;  1N95 A;  1NI1 A;  1FPP A;  3DSW A;  1N4R A;  1S64 A;  1O1R A;  3C72 A;  4GTV A;  3E30 A;  4EHM A;  1JCR A;  4GTM A;  2R2L A;  3SFY A;  4GTP A;  1N4Q A;  4LNB A;  3PZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...