1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
1TN7A 4GTSA 1N9AA 3E32A 3KSLA 1N4PA 3C72A 1QBQA 3Q7AA 4GTRA 3Q7FA 3PZ3A 1TNUA 2H6HA 1TNZA 1KZPA 1FT1A 3DSTA 1D8EA 1TNBA 1TNYA 3DSXA 1FT2A 4GTVA 1O1SA 1O1RA 1JCQA 1LD8A 3HXFA 4LNBA 4GTOA 3HXDA 2H6GA 3E34A 2H6FA 4GTTA 3DSWA 1DCEA 1SA4A 3PZ1A 3PZ4A 3DSVA 1KZOA 4L9PA 1N4SA 3SFXA 3PZ2A 4YDOA 3DSUA 3HXCA 3E30A 1TN8A 1N4QA 1LD7A 2IEJA 2ZIRA 3E33A 1X81A 2H6IA 3EUVA 1FPPA 2R2LA 4YDEA 4MBGA 1NL4A 3DPYA 3E37A 3KSQA 1JCRA 3Q75A 1LTXA 1N95A 3HXEA 2ZISA 1N94A 1SA5A 2F0YA 3EU5A 3DRAA 3HXBA 1D8DA 1S64A 2BEDA 3Q78A 1NI1A 3Q79A 3DSSA 4GTMA 1N4RA 4LNGA 1O5MA 1O1TA 1JCSA 1S63A 1MZCA 4EHMA 3SFYA 3Q73A 1TNOA 4GTPA 1TN6A 4GTQA
chains in the Genus database with same CATH superfamily
3L16A 4HB5A 3BUAA 3S7JA 3UKRG 4JW1A 4HS2A 4DX6D 2XEHA 1QBQA 3Q15A 3Q7AA 3CHRA 2I6HA 4OVVA 3FUIA 5JJTA 3FHEA 5JHBA 2IF4A 2V4HC 3CGHA 4IULA 1UG3A 4GTVA 4QQIA 1INZA 4JHJA 3TG5A 4I2ZA 2H6GA 4JZYA 1L5JA 3NQPA 4QFVA 3ABME 3PZ1A 3DSVA 3CHPA 4DX1A 1HE8A 1HXIA 1N52A 3FULA 1H2UA 4LNUD 5B1BE 4BT9A 1S70B 1IHGA 3F6QA 3ZGQA 2L6BA 1Y6IA 2RG8A 4XKCA 3RK6A 3V31A 5EDSA 4UI9K 5AQ9A 4CYMD 4F3VA 1TEZA 2LUHA 3ZKJA 1Y8MA 4J8DA 4URKA 2EIKE 3EHRA 3T9KA 3G2UA 3R7RA 3K9IA 1E8YA 4DX7D 1SA5A 3QNKA 4UWGA 4P29A 3EU5A 4I1OB 3QB2A 2ZGDA 3SGHA 4L23A 2KCLA 2E2EA 2WQHA 4TRQA 2WXQA 3IV0A 3CVLA 4F7AA 3T8KA 3CVPA 1NA0A 4G2VA 5AQAA 4WWOA 5D0OD 1N54A 1KT0A 2PM7A 3R9MA 2R17C 2XPYA 3OXLA 4JL0A 1OCCE 3VLDA 1TNYA 2Y4TA 4CDMA 5BUZA 3FUEA 4N2SA 4B0ZA 4XX5A 3D9PA 5D2MC 2XS1A 3SF4A 1DCQA 1ELRA 4UQZA 2DBAA 2WXNA 2B0OE 3CK7A 3ZXPA 4ILGA 4BERA 3LY7A 4UWLA 3ZUVB 3CVYA 2HE0A 4BEPA 4HRNA 5CRVA 4EZJA 1TN8A 1UJJA 1N0RA 1K1BA 1KT1A 2H6IA 4J0UA 2MOWA 3U66A 1NFIE 3KAEA 5AARA 2WXOA 3X2QE 3V79K 3FY4A 3APCA 2F0YA 3APDA 3EDTB 5AN8A 4GA2A 5J08A 1JUQA 4AM9A 1H2TC 3AS5A 4A3VA 2UWJG 3HVEA 4EZLA 5G05C 2EINE 3HG0D 3Q47B 2WMOA 1TJCA 1TYQG 2IONA 3FUFA 3UI2A 4YVOA 4G11A 2IY0C 1Z6TA 2B6CA 2RFAA 4WWNA 1MX2A 3RRMB 3Q7FA 4JHRA 3UM2A 3PRZA 3DEPA 3FH7A 5LOZA 2LO6A 3ML9A 1N0QA 4DX5D 4WWPA 5ENRD 3SZ7A 2C0LA 1TR4A 2YHEA 3JUIA 3G2VA 4HLLA 3PUKA 3AG4E 3I4RB 1IQUA 5CMWA 1OCOE 2WXRA 5B3SE 3ZIMA 4U0ZA 3NB2A 1HX8A 4FLBA 2RD0A 3GZ2A 4G24A 2AWIA 4I43A 4J8YA 4I6GA 3UT4A 2I1KA 2XEEA 3EUVA 3LKUA 4WUYA 5CBNA 1SVXA 3TAXA 3DPYA 2GRLA 2A5UA 3Q49B 2KCVA 3HXEA 5LFAA 4G8LA 3ZW3A 5ENOD 4ATGA 3L82A 2HYZA 2Q7FA 1E8WA 4I9CA 2EQXA 2XPZA 1A5EA 4U8VD 2NYJA 5CEDB 1O5MA 2LXMA 3RO2A 3L13A 5G04J 2P9KG 2WXMA 3LJ3A 2WVIA 2PL2A 3TWUA 2V8SE 5FJYA 4MS6A 4FA6A 3UINC 3MV3B 3CHQA 3FFLA 4MLPA 3TWRA 2XEVA 4FP7A 1KZPA 3D9NA 1MQSA 4YNDA 4KVMA 5ENNA 4W9RA 3FDHA 5JJ7A 3CVUA 3FTYA 2AXZA 1H6PA 4GU5A 4GZ6A 1TJFA 2J4DA 3PEVB 1DCEA 3CR3A 2WM9A 3ZHEA 2KCKA 4TXRA 4K5BA 4C0MA 2P9NG 2QFCA 4HI8A 3PZ2A 1FCHA 3AG2E 4BETA 3CLJA 1U3CA 5FQ8A 2OVBA 4HBDA 1V54E 3DXKG 4G26A 1U3DA 5FQ7A 3RSEG 1OWPA 1WDYA 3P1UA 2BF0X 4O6FA 3TWSA 4WNGA 5AENA 5FT9A 1X5BA 5EIDA 4LRZA 4C9BB 4CRWA 3LXUX 1S63A 5ARGA 4BESA 3SBSA 2GRPB 2LNIA 2X38A 4K5AB 1TN7A 1HZ4A 2Y1LE 3KSLA 3CSTA 1V55E 3I5PA 2YINA 3HIZA 2ILRA 3C3QA 2JEKA 4GTRA 1A17A 3LVRE 4B94A 3Q4AB 3PS6A 4BX8A 4N3BA 5T8IA 3L08A 1W3BA 2FO7A 3ML8A 3U64A 3CQCB 4GB9A 3NBNB 1HG5A 5CECB 3HYMB 5FZQA 3DWLG 2J09A 2IJGX 4B8AA 3AG1E 4B93B 3ABLE 1KPSB 2XS8A 3D9KA 4JVSA 3ZYQA 3WXXA 1X81A 2WQ7A 4O60A 3B13A 3FTXA 4TV3A 1HH8A 4ACLA 3LJNA 4GMLA 5LP0A 3HDXA 2RFMA 2KC7A 3JUEA 1E90A 3D9IA 4RLYA 2KBXA 5CCLA 4LNGA 3PE4A 4M3OA 3ABKE 4I2WA 4EQFA 4N3AA 2VGXA 4GTPA 3FEYA 5KWDA 4N5CA 3SO8A 2ZGGA 3J5PA 4I17A 3UPVA 4BX9A 4IYPA 4U0SA 2QZAA 3O4ZA 2DIWA 5EYPF 3CSFA 5E76A 3IXEA 4WNDA 1D8EA 3EU9A 4FULA 1JCQA 3GZSA 4GTOA 1VDYA 3HXDA 3VLFA 3D9MA 4LCTA 2VJ8A 1KZOA 3I4GA 4MKTA 5LX8A 3L22A 3B95A 4RQIA 5FZRA 1E7UA 2WXJA 4EECA 2IEJA 4JA9A 1OWOA 2QY7A 4R7LA 5C2YA 4I1MA 4GZCA 4AY6A 3SY2A 5JJ6A 5BXOA 1JCRA 5FIOA 3CHOA 1OXJA 4G23A 5KCMA 4ANVA 5EN5D 4NQ0A 3WG7E 3FU5A 3HVEB 2L9BA 1IQRA 2MYOA 4J8SA 4FHKA 1NI1A 4J8EA 3DSSA 2CHZA 3NZUA 3FWVA 2P9SG 3MJWA 2BKKB 4CCAA 3CVWA 4EBAG 3VLEA 3B7RL 5DIZA 2L6JA 4ANUA 1EYHA 3PZ3A 5LCWC 4GPMA 5ENQD 4UWFA 3QK0A 5H7PA 3CHMA 1O1RA 2XCBA 4KXKB 2HM8A 5J90A 4ZFHA 2ETCA 3UUXA 4BT8A 5HI7A 2H6FA 4PUCA 1OWLA 3ASOE 1YA0A 1ZBPA 4DLQA 5FQ4A 2OV8A 2R03A 5BT1A 3CK8A 3SFXA 3MKQA 4A1GA 1YYHA 4XE0A 3T5XA 2GRRB 4PS7A 2P9UG 2VQ2A 3Q9UC 4GYWA 3ULYA 5EIBE 1FPPA 3RRUA 3UKUG 3ULEG 2FULA 2GRMA 2KZTA 5FZSA 1OUVA 2HO1A 4OVUA 2ONDA 4GA1A 4APFA 3TWXA 3C98A 3L6AA 3EIJA 4RG9A 1RZ4A 4F1PA 3Q79A 3DPDA 3CVVA 4Z68A 3MA5A 3TGOA 5G05J 5CERB 4Y6WA 4M7CA 1G3NB 3FH8A 3UMVA 5KJLA 5JA4D 3SI5A 3C72A 3CKCA 2LAHA 5AYWD 2XQ0A 4KT6B 3VTXA 2CHWA 4JHKA 4LUNU 1AWCB 2XZDG 1TNBA 4HRMB 1O1SA 2J07A 4UUCA 3E4BA 2X6KA 5T4YA 3ZHEB 4I6EA 3HHMA 2XHEA 2WQ6A 3DSWA 2EILE 3C5RA 3FTSA 4OAVB 2IOSA 2FI7A 5ENSD 1H6KA 1IKND 2LAIA 1H19A 3UT8A 2P9LG 2DYSE 3UIOC 3U9WA 5E75A 4BWRA 3RAUA 4AV7A 2VGYA 1K3ZD 4PS8A 4U04A 2YNQA 3ESLA 4N5QA 1UN9A 3SNXA 3FTWA 2QYUA 4F53A 1Z3YA 3T5VA 4FU3A 4MBGA 1NL4A 3PH0C 3UM1A 1B89A 2WXHA 1OWNA 2AXVA 3TG4A 3AU4A 3LPZA 4HOSA 2CG2A 3C3RA 2OEVA 4HQDA 4YDYA 4HFGA 4GPKA 3ASNE 5CRUA 2GW1A 4ATZD 1DNPA 3MYVA 5HRYA 3TWQA 4AOFA 2UY1B 1XNFA 2KM4A 5JHAA 1MHQA 4UQXA 4G25A 2WXLA 3LDZA 3UIPC 3AJIA 5BNWA 3JCKC 1QQEA 2J9QA 5AJLA 1ELWA 5KNHD 1H0AA 4CT0A 3QC1A 2OEWA 4JXTA 1Z5SC 3G2WA 4WNEA 4L1BA 1WM5A 4UWHA 4BY6A 3ZNGA 4GTTA 5C1DA 4YVQC 2QC9A 1Q2ZA 4ZHBA 1BU9A 2DZNA 5EYLA 4BFRA 4AVXA 2J49A 3ASHA 4JEHA 3ASDA 4L2YA 1SW6A 4N2QA 3L9TA 2Y3AA 1PC2A 5A23A 4ILIA 1DVPA 3B7BA 3UXGA 2CHXA 1LTXA 1N95A 4GZ5A 4B8CB 5ANRA 1SQMA 3N71A 5CHEE 4GZ3A 4LERA 4D10C 1JPLA 1SZAA 2YQ8A 4EPZA 2VGXB 4Q94A 4PDXA 3KEAA 5DBKA 2F8YA 3SFYA 3D9LA 5BW8C 4K5CA 3AS8A 1N9AA 1N4PA 1E8XA 3ZVVA 5AAOA 2CFZA 1GW6A 4I1AA 2I2OA 4IN3B 4HXIA 4XI9A 4JEUA 3DSXA 4K0RA 5EX3A 4KZCA 2M63A 4HOUA 1MX6A 4ANWA 2V0PA 3FUHA 3URZA 4CT4A 1U2VG 2WXGA 3QJZA 1OT8A 1IXVA 1FVFA 5FTPA 5KJKA 4U63A 2XGMA 2F8XK 4N3CA 2ZXWE 3FUJA 4DRXE 3TWTA 2KATA 3TWWA 3DXMG 3HXCA 3E30A 2E0IA 4RVBA 3OXGA 3BG0B 3EHNA 1NA3A 3RO3A 2R2LA 3ZYKA 4WAFA 3ZXSA 2VTBA 1OWMA 3Q5MA 2X6FA 2L0TB 5CMYA 5CBOA 2CFUA 2J8SD 4DK5A 3GW4A 3UT7A 3DRAA 3NF1A 2RKKA 2GROB 4XIFA 4A55A 3VTYA 3Q78A 4KMOA 4GTMA 3MGBA 4GYOA 4DLOA 1BD8A 3RKVA 5BXUA 3V2OA 4FADA 3B7UX 3G2SA 2R05A 3TXMA 2ETAA 3D9OA 3U4TA 3ONLA 3LEWA 1EF1C 2WXPA 3TL5A 3J5QB 1P5QA 4AP2A 5JMND 3V30A 3CVNA 4NURA 2MHKA 3FUMA 3IEGA 1H6OA 4NRHB 3JXIA 1HFAA 1JWGA 2XPIA 1E8ZA 2AXUA 4I6JA 4J8FA 1FVHA 2BUGA 4JD2G 4AIFA 3L54A 2V5QC 4AJWA 2FEZA 3JQ1A 3IBEA 1SA4A 3DBSA 4U0UA 3MKQB 4IRUA 5BV0A 3FTUA 4DUIA 2WXKA 2DCPA 4TXQA 1EPUA 4YDOA 3MCXA 3PEUB 2P9PG 1N4QA 4HOTA 5EILA 3S2AA 3O48A 3ULQA 2AW6A 2KZTB 2IU1A 5HKPA 4G8KA 4BTAA 1NP7A 3R9AB 1N11A 3KSQA 2AVPA 4A1SA 4HI9A 4UI9C 3RJVA 2ZISA 4DX2A 1IYGA 4FHJA 4DI3A 4F6RD 3LCAA 4NIKA 4Q69A 4TXPA 3BG1B 1QNFA 3PVLA 3SD5A 3C3OA 3PE3A 4LEUA 3GZ1A 4LG6A 3FH5A 3LYAA 1BLXB 2KXPC 3ENEA 2PNNA 1H2VC 4HVBA 5AQBA 3FUNA 3ASFA 5LCWJ 2YHCA 1TNZA 3D3MA 5FWQA 2R5SA 4DI4A 3TJPA 3ESKA 3NAWA 3FUDA 4U8HA 4G1TA 3PNTB 3ZEFA 3IHYA 3CV0A 4V3IA 3D9HA 3PDNA 3APFA 4RSYA 4AXHA 4Q96A 2NSZA 3R7QA 4JC8A 3ZFWA 3PZ4A 2GRQB 4L9PA 3QAQA 3QWWA 4NACA 5KBAA 3P2BA 1PAQA 4HOQA 1AP7A 4XZ4A 3CKBA 3MEKA 1UW4B 4UQYA 2LSUA 3CVXA 3BU8A 3FEXA 1UJKA 2EIME 3OXFA 1HU3A 3IHVA 2WMNA 3LY9A 5ARFA 2VSYA 4CDRA 4JA7A 3AS4A 5D66A 4GMRA 1BPOA 1WY6A 3CK9A 4A3TA 4E6HA 3RIBA 3FTZA 1D8DA 3FU0A 3NZSA 2R02A 4MRUA 1NZNA 3CQGB 1KLXA 4WNFA 2VSOE 2LSVA 1OCZE 2XRYA 1XGWA 1Z3XA 4L2LA 3PUJA 4EHMA 3AU5A 4U07A 3ZPJA 2GRNB 4O1PA 5ENTD 2PQNA 3EHMA 5AIJA 1OY3D 2XGOA 4U96D 1TNUA 5IY5E 2VGEA 4CGWA 4ABNA 2VSNA 3JXJA 5HS0A 1PY1A 4ACKA 3QWPA 4X8QA 3FTVA 2V5FA 2XZTG 2JABA 4Y6CA 5CCMA 2F37A 2XGSA 3NOGD 3CEQA 1LD7A 4FC8A 2WXIA 3SFZA 4JPSA 2C0MA 2IFUA 1RW2A 4EZKA 4H7YA 5BPPA 1QYMA 3ONKA 3QKYA 3Q75A 1DC2A 1HG2A 3RRNB 4OAUC 3D9JA 5G2NA 2PQRA 1S64A 2PM6A 2JLBA 4H7XA 2IQCA 4ME2A 3W9FA 3SQVA 4FJYA 4TUMA 3QOUA 2DYRE 4XEIG 3FP3A 4KBQA 1MZCA 1SZ9A 1TNOA 1TN6A 2WB2A 2V4LA 4PH4B 4GMJA 3LS8A 4C48B 3KEZA 1K8KG 3FU3A 3MKRA 3B7TA 5KJMA 5FQ6A 1FT2A 5A6CA 3HXFA 4BSXA 2C2LA 3NOCD 4GCOA 2XRZA 4HORA 2IOLA 3QWVA 5ENPD 1YCSB 2Y69E 3EIQC 1WG0A 2IO2C 3PZDA 2FO1E 1UN8A 2VTBB 4F1SA 1BI8B 3E33A 1HO8A 2A4ZA 4GZDA 4YDEA 2MRIA 3PREA 3T8MA 1K1AA 3S7DA 3HXBA 4KVOA 1ZU2A 2BEDA 4FLHA 4XKBA 3ZYMA 3DEOA 5EKQD 4HLEA 1O1TA 3UM0A 1JCSA 2I1JA 4GA0A 4J7WA 5A7DB 5G04C 4CGVA 3OAWA 3ISMC 1ZB1A 2AJAA 3FUKA 3ZN3A 1IHBA 4GTSA 2EIJE 2VYIA 2FBNA 3I3NA 1UOHA 5CEAA 5AQ7A 1E7VA 2J4BA 2OVFA 3JQ0A 1ELKA 4HNAD 4PS3A 2VSXE 3DSTA 5EX0A 3SBTB 4U95D 2L0IA 2Y4UA 3TXNA 3ZRHA 1LD8A 3GYZA 2WPVA 3E34A 5ITZF 3MV2B 3UTMA 2X3MA 4DJAA 3LVQE 3TWVA 3ZU7B 4ILHB 2XENA 2NC9A 3HRAA 3SHFA 5ANLA 1E96B 3UX4A 2I9CA 2P9IG 3EJNA 4EBAA 1D9SA 4LSZE 4BTBA 4I9EA 1HF8A 2IO3C 1MX4A 2ZIRA 4CZ2D 3QARA 5T3RA 2X6HA 3BQOA 1WAO1 5M72A 3S7BA 3EHQA 4O1OA 3CIAA 3L17A 4GAAA 4HRLA 2BKGA 3IKOB 3B7SA 1N94A 2PZIA 3CHSA 1JWFA 5AJDA 2HR2A 4JB8P 5KJNA 2CG3A 2Y0BG 2UY1A 1N4RA 2R59A 2QYJA 5KNGA 1HS6A 1QZ2A 4J6IA 4KZ0A 3Q73A 1MYOA 2LXLA 4GTQA 3UQ3A 2ETBA 3E32A 3MZLB 4U8YD 3LY8A 5G55A 5FINA 3PNLB 2NXPA 1S0PA 2H6HA 1YMPA 1FT1A 3BEEA 2BTDA 3UM3A 4FJZA 4N39A 4TUUA 3CVQA 4LNBA 2FF4A 4AEZC 2X6IA 3V2XA 2GGFA 3S7FA 1OCRE 3AAAC 5D0QD 4XI0A 3RU0A 3JYSA 1EDUA 4L7TA 4GCNA 4CEMA 4UWKA 1N4SA 2DWZA 3KD7A 4APOA 4KYOB 3W9GA 2DVWA 2OCCE 3DSUA 5HQ8A 1BI7B 2ZU6B 3AG3E 3ASGA 4B89A 4YDWA 3MX3A 2XCCA 2P58C 5BV1A 4K03A 2X6JA 3G2TA 4UI9J 3E37A 3U3WA 4ANXA 2A5EA 3KS2A 2P2CP 4BSZB 4CDNA 2DZOA 1LF8A 2OOEA 4U7EB 3ZYLA 3OTNA 2WXFA 3QDNA 4AY5A 5B1AE 4OYSA 4E85A 4C0EA 3Q9NC 4DPRA 4RG6A 1MJ0A 3FU6A 2J08A 4GYYA 4A63B
chains in the Genus database with same CATH topology
1TN7A 4GTSA 1N9AA 3E32A 3KSLA 1N4PA 3C72A 1QBQA 3Q7AA 4GTRA 3Q7FA 3PZ3A 1TNUA 2H6HA 1TNZA 1KZPA 1FT1A 3DSTA 1D8EA 1TNBA 1TNYA 3DSXA 1FT2A 4GTVA 1O1SA 1O1RA 1JCQA 1LD8A 3HXFA 4LNBA 4GTOA 3HXDA 2H6GA 3E34A 2H6FA 4GTTA 3DSWA 1DCEA 1SA4A 3PZ1A 3PZ4A 3DSVA 1KZOA 4L9PA 1N4SA 3SFXA 3PZ2A 4YDOA 3DSUA 3HXCA 3E30A 1TN8A 1N4QA 1LD7A 2IEJA 2ZIRA 3E33A 1X81A 2H6IA 3EUVA 1FPPA 2R2LA 4YDEA 4MBGA 1NL4A 3DPYA 3E37A 3KSQA 1JCRA 3Q75A 1LTXA 1N95A 3HXEA 2ZISA 1N94A 1SA5A 2F0YA 3EU5A 3DRAA 3HXBA 1D8DA 1S64A 2BEDA 3Q78A 1NI1A 3Q79A 3DSSA 4GTMA 1N4RA 4LNGA 1O5MA 1O1TA 1JCSA 1S63A 1MZCA 4EHMA 3SFYA 3Q73A 1TNOA 4GTPA 1TN6A 4GTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN7 A;  4GTS A;  1N9A A;  3E32 A;  3KSL A;  1N4P A;  3C72 A;  1QBQ A;  3Q7A A;  4GTR A;  3Q7F A;  3PZ3 A;  1TNU A;  2H6H A;  1TNZ A;  1KZP A;  1FT1 A;  3DST A;  1D8E A;  1TNB A;  1TNY A;  3DSX A;  1FT2 A;  4GTV A;  1O1S A;  1O1R A;  1JCQ A;  1LD8 A;  3HXF A;  4LNB A;  4GTO A;  3HXD A;  2H6G A;  3E34 A;  2H6F A;  4GTT A;  3DSW A;  1DCE A;  1SA4 A;  3PZ1 A;  3PZ4 A;  3DSV A;  1KZO A;  4L9P A;  1N4S A;  3SFX A;  3PZ2 A;  4YDO A;  3DSU A;  3HXC A;  3E30 A;  1TN8 A;  1N4Q A;  1LD7 A;  2IEJ A;  2ZIR A;  3E33 A;  1X81 A;  2H6I A;  3EUV A;  1FPP A;  2R2L A;  4YDE A;  4MBG A;  1NL4 A;  3DPY A;  3E37 A;  3KSQ A;  1JCR A;  3Q75 A;  1LTX A;  1N95 A;  3HXE A;  2ZIS A;  1N94 A;  1SA5 A;  2F0Y A;  3EU5 A;  3DRA A;  3HXB A;  1D8D A;  1S64 A;  2BED A;  3Q78 A;  1NI1 A;  3Q79 A;  3DSS A;  4GTM A;  1N4R A;  4LNG A;  1O5M A;  1O1T A;  1JCS A;  1S63 A;  1MZC A;  4EHM A;  3SFY A;  3Q73 A;  1TNO A;  4GTP A;  1TN6 A;  4GTQ A; 
#chains in the Genus database with same CATH topology
 3L16 A;  4HB5 A;  3BUA A;  3S7J A;  3UKR G;  4JW1 A;  4HS2 A;  4DX6 D;  2XEH A;  1QBQ A;  3Q15 A;  3Q7A A;  3CHR A;  2I6H A;  4OVV A;  3FUI A;  5JJT A;  3FHE A;  5JHB A;  2IF4 A;  2V4H C;  3CGH A;  4IUL A;  1UG3 A;  4GTV A;  4QQI A;  1INZ A;  4JHJ A;  3TG5 A;  4I2Z A;  2H6G A;  4JZY A;  1L5J A;  3NQP A;  4QFV A;  3ABM E;  3PZ1 A;  3DSV A;  3CHP A;  4DX1 A;  1HE8 A;  1HXI A;  1N52 A;  3FUL A;  1H2U A;  4LNU D;  5B1B E;  4BT9 A;  1S70 B;  1IHG A;  3F6Q A;  3ZGQ A;  2L6B A;  1Y6I A;  2RG8 A;  4XKC A;  3RK6 A;  3V31 A;  5EDS A;  4UI9 K;  5AQ9 A;  4CYM D;  4F3V A;  1TEZ A;  2LUH A;  3ZKJ A;  1Y8M A;  4J8D A;  4URK A;  2EIK E;  3EHR A;  3T9K A;  3G2U A;  3R7R A;  3K9I A;  1E8Y A;  4DX7 D;  1SA5 A;  3QNK A;  4UWG A;  4P29 A;  3EU5 A;  4I1O B;  3QB2 A;  2ZGD A;  3SGH A;  4L23 A;  2KCL A;  2E2E A;  2WQH A;  4TRQ A;  2WXQ A;  3IV0 A;  3CVL A;  4F7A A;  3T8K A;  3CVP A;  1NA0 A;  4G2V A;  5AQA A;  4WWO A;  5D0O D;  1N54 A;  1KT0 A;  2PM7 A;  3R9M A;  2R17 C;  2XPY A;  3OXL A;  4JL0 A;  1OCC E;  3VLD A;  1TNY A;  2Y4T A;  4CDM A;  5BUZ A;  3FUE A;  4N2S A;  4B0Z A;  4XX5 A;  3D9P A;  5D2M C;  2XS1 A;  3SF4 A;  1DCQ A;  1ELR A;  4UQZ A;  2DBA A;  2WXN A;  2B0O E;  3CK7 A;  3ZXP A;  4ILG A;  4BER A;  3LY7 A;  4UWL A;  3ZUV B;  3CVY A;  2HE0 A;  4BEP A;  4HRN A;  5CRV A;  4EZJ A;  1TN8 A;  1UJJ A;  1N0R A;  1K1B A;  1KT1 A;  2H6I A;  4J0U A;  2MOW A;  3U66 A;  1NFI E;  3KAE A;  5AAR A;  2WXO A;  3X2Q E;  3V79 K;  3FY4 A;  3APC A;  2F0Y A;  3APD A;  3EDT B;  5AN8 A;  4GA2 A;  5J08 A;  1JUQ A;  4AM9 A;  1H2T C;  3AS5 A;  4A3V A;  2UWJ G;  3HVE A;  4EZL A;  5G05 C;  2EIN E;  3HG0 D;  3Q47 B;  2WMO A;  1TJC A;  1TYQ G;  2ION A;  3FUF A;  3UI2 A;  4YVO A;  4G11 A;  2IY0 C;  1Z6T A;  2B6C A;  2RFA A;  4WWN A;  1MX2 A;  3RRM B;  3Q7F A;  4JHR A;  3UM2 A;  3PRZ A;  3DEP A;  3FH7 A;  5LOZ A;  2LO6 A;  3ML9 A;  1N0Q A;  4DX5 D;  4WWP A;  5ENR D;  3SZ7 A;  2C0L A;  1TR4 A;  2YHE A;  3JUI A;  3G2V A;  4HLL A;  3PUK A;  3AG4 E;  3I4R B;  1IQU A;  5CMW A;  1OCO E;  2WXR A;  5B3S E;  3ZIM A;  4U0Z A;  3NB2 A;  1HX8 A;  4FLB A;  2RD0 A;  3GZ2 A;  4G24 A;  2AWI A;  4I43 A;  4J8Y A;  4I6G A;  3UT4 A;  2I1K A;  2XEE A;  3EUV A;  3LKU A;  4WUY A;  5CBN A;  1SVX A;  3TAX A;  3DPY A;  2GRL A;  2A5U A;  3Q49 B;  2KCV A;  3HXE A;  5LFA A;  4G8L A;  3ZW3 A;  5ENO D;  4ATG A;  3L82 A;  2HYZ A;  2Q7F A;  1E8W A;  4I9C A;  2EQX A;  2XPZ A;  1A5E A;  4U8V D;  2NYJ A;  5CED B;  1O5M A;  2LXM A;  3RO2 A;  3L13 A;  5G04 J;  2P9K G;  2WXM A;  3LJ3 A;  2WVI A;  2PL2 A;  3TWU A;  2V8S E;  5FJY A;  4MS6 A;  4FA6 A;  3UIN C;  3MV3 B;  3CHQ A;  3FFL A;  4MLP A;  3TWR A;  2XEV A;  4FP7 A;  1KZP A;  3D9N A;  1MQS A;  4YND A;  4KVM A;  5ENN A;  4W9R A;  3FDH A;  5JJ7 A;  3CVU A;  3FTY A;  2AXZ A;  1H6P A;  4GU5 A;  4GZ6 A;  1TJF A;  2J4D A;  3PEV B;  1DCE A;  3CR3 A;  2WM9 A;  3ZHE A;  2KCK A;  4TXR A;  4K5B A;  4C0M A;  2P9N G;  2QFC A;  4HI8 A;  3PZ2 A;  1FCH A;  3AG2 E;  4BET A;  3CLJ A;  1U3C A;  5FQ8 A;  2OVB A;  4HBD A;  1V54 E;  3DXK G;  4G26 A;  1U3D A;  5FQ7 A;  3RSE G;  1OWP A;  1WDY A;  3P1U A;  2BF0 X;  4O6F A;  3TWS A;  4WNG A;  5AEN A;  5FT9 A;  1X5B A;  5EID A;  4LRZ A;  4C9B B;  4CRW A;  3LXU X;  1S63 A;  5ARG A;  4BES A;  3SBS A;  2GRP B;  2LNI A;  2X38 A;  4K5A B;  1TN7 A;  1HZ4 A;  2Y1L E;  3KSL A;  3CST A;  1V55 E;  3I5P A;  2YIN A;  3HIZ A;  2ILR A;  3C3Q A;  2JEK A;  4GTR A;  1A17 A;  3LVR E;  4B94 A;  3Q4A B;  3PS6 A;  4BX8 A;  4N3B A;  5T8I A;  3L08 A;  1W3B A;  2FO7 A;  3ML8 A;  3U64 A;  3CQC B;  4GB9 A;  3NBN B;  1HG5 A;  5CEC B;  3HYM B;  5FZQ A;  3DWL G;  2J09 A;  2IJG X;  4B8A A;  3AG1 E;  4B93 B;  3ABL E;  1KPS B;  2XS8 A;  3D9K A;  4JVS A;  3ZYQ A;  3WXX A;  1X81 A;  2WQ7 A;  4O60 A;  3B13 A;  3FTX A;  4TV3 A;  1HH8 A;  4ACL A;  3LJN A;  4GML A;  5LP0 A;  3HDX A;  2RFM A;  2KC7 A;  3JUE A;  1E90 A;  3D9I A;  4RLY A;  2KBX A;  5CCL A;  4LNG A;  3PE4 A;  4M3O A;  3ABK E;  4I2W A;  4EQF A;  4N3A A;  2VGX A;  4GTP A;  3FEY A;  5KWD A;  4N5C A;  3SO8 A;  2ZGG A;  3J5P A;  4I17 A;  3UPV A;  4BX9 A;  4IYP A;  4U0S A;  2QZA A;  3O4Z A;  2DIW A;  5EYP F;  3CSF A;  5E76 A;  3IXE A;  4WND A;  1D8E A;  3EU9 A;  4FUL A;  1JCQ A;  3GZS A;  4GTO A;  1VDY A;  3HXD A;  3VLF A;  3D9M A;  4LCT A;  2VJ8 A;  1KZO A;  3I4G A;  4MKT A;  5LX8 A;  3L22 A;  3B95 A;  4RQI A;  5FZR A;  1E7U A;  2WXJ A;  4EEC A;  2IEJ A;  4JA9 A;  1OWO A;  2QY7 A;  4R7L A;  5C2Y A;  4I1M A;  4GZC A;  4AY6 A;  3SY2 A;  5JJ6 A;  5BXO A;  1JCR A;  5FIO A;  3CHO A;  1OXJ A;  4G23 A;  5KCM A;  4ANV A;  5EN5 D;  4NQ0 A;  3WG7 E;  3FU5 A;  3HVE B;  2L9B A;  1IQR A;  2MYO A;  4J8S A;  4FHK A;  1NI1 A;  4J8E A;  3DSS A;  2CHZ A;  3NZU A;  3FWV A;  2P9S G;  3MJW A;  2BKK B;  4CCA A;  3CVW A;  4EBA G;  3VLE A;  3B7R L;  5DIZ A;  2L6J A;  4ANU A;  1EYH A;  3PZ3 A;  5LCW C;  4GPM A;  5ENQ D;  4UWF A;  3QK0 A;  5H7P A;  3CHM A;  1O1R A;  2XCB A;  4KXK B;  2HM8 A;  5J90 A;  4ZFH A;  2ETC A;  3UUX A;  4BT8 A;  5HI7 A;  2H6F A;  4PUC A;  1OWL A;  3ASO E;  1YA0 A;  1ZBP A;  4DLQ A;  5FQ4 A;  2OV8 A;  2R03 A;  5BT1 A;  3CK8 A;  3SFX A;  3MKQ A;  4A1G A;  1YYH A;  4XE0 A;  3T5X A;  2GRR B;  4PS7 A;  2P9U G;  2VQ2 A;  3Q9U C;  4GYW A;  3ULY A;  5EIB E;  1FPP A;  3RRU A;  3UKU G;  3ULE G;  2FUL A;  2GRM A;  2KZT A;  5FZS A;  1OUV A;  2HO1 A;  4OVU A;  2OND A;  4GA1 A;  4APF A;  3TWX A;  3C98 A;  3L6A A;  3EIJ A;  4RG9 A;  1RZ4 A;  4F1P A;  3Q79 A;  3DPD A;  3CVV A;  4Z68 A;  3MA5 A;  3TGO A;  5G05 J;  5CER B;  4Y6W A;  4M7C A;  1G3N B;  3FH8 A;  3UMV A;  5KJL A;  5JA4 D;  3SI5 A;  3C72 A;  3CKC A;  2LAH A;  5AYW D;  2XQ0 A;  4KT6 B;  3VTX A;  2CHW A;  4JHK A;  4LUN U;  1AWC B;  2XZD G;  1TNB A;  4HRM B;  1O1S A;  2J07 A;  4UUC A;  3E4B A;  2X6K A;  5T4Y A;  3ZHE B;  4I6E A;  3HHM A;  2XHE A;  2WQ6 A;  3DSW A;  2EIL E;  3C5R A;  3FTS A;  4OAV B;  2IOS A;  2FI7 A;  5ENS D;  1H6K A;  1IKN D;  2LAI A;  1H19 A;  3UT8 A;  2P9L G;  2DYS E;  3UIO C;  3U9W A;  5E75 A;  4BWR A;  3RAU A;  4AV7 A;  2VGY A;  1K3Z D;  4PS8 A;  4U04 A;  2YNQ A;  3ESL A;  4N5Q A;  1UN9 A;  3SNX A;  3FTW A;  2QYU A;  4F53 A;  1Z3Y A;  3T5V A;  4FU3 A;  4MBG A;  1NL4 A;  3PH0 C;  3UM1 A;  1B89 A;  2WXH A;  1OWN A;  2AXV A;  3TG4 A;  3AU4 A;  3LPZ A;  4HOS A;  2CG2 A;  3C3R A;  2OEV A;  4HQD A;  4YDY A;  4HFG A;  4GPK A;  3ASN E;  5CRU A;  2GW1 A;  4ATZ D;  1DNP A;  3MYV A;  5HRY A;  3TWQ A;  4AOF A;  2UY1 B;  1XNF A;  2KM4 A;  5JHA A;  1MHQ A;  4UQX A;  4G25 A;  2WXL A;  3LDZ A;  3UIP C;  3AJI A;  5BNW A;  3JCK C;  1QQE A;  2J9Q A;  5AJL A;  1ELW A;  5KNH D;  1H0A A;  4CT0 A;  3QC1 A;  2OEW A;  4JXT A;  1Z5S C;  3G2W A;  4WNE A;  4L1B A;  1WM5 A;  4UWH A;  4BY6 A;  3ZNG A;  4GTT A;  5C1D A;  4YVQ C;  2QC9 A;  1Q2Z A;  4ZHB A;  1BU9 A;  2DZN A;  5EYL A;  4BFR A;  4AVX A;  2J49 A;  3ASH A;  4JEH A;  3ASD A;  4L2Y A;  1SW6 A;  4N2Q A;  3L9T A;  2Y3A A;  1PC2 A;  5A23 A;  4ILI A;  1DVP A;  3B7B A;  3UXG A;  2CHX A;  1LTX A;  1N95 A;  4GZ5 A;  4B8C B;  5ANR A;  1SQM A;  3N71 A;  5CHE E;  4GZ3 A;  4LER A;  4D10 C;  1JPL A;  1SZA A;  2YQ8 A;  4EPZ A;  2VGX B;  4Q94 A;  4PDX A;  3KEA A;  5DBK A;  2F8Y A;  3SFY A;  3D9L A;  5BW8 C;  4K5C A;  3AS8 A;  1N9A A;  1N4P A;  1E8X A;  3ZVV A;  5AAO A;  2CFZ A;  1GW6 A;  4I1A A;  2I2O A;  4IN3 B;  4HXI A;  4XI9 A;  4JEU A;  3DSX A;  4K0R A;  5EX3 A;  4KZC A;  2M63 A;  4HOU A;  1MX6 A;  4ANW A;  2V0P A;  3FUH A;  3URZ A;  4CT4 A;  1U2V G;  2WXG A;  3QJZ A;  1OT8 A;  1IXV A;  1FVF A;  5FTP A;  5KJK A;  4U63 A;  2XGM A;  2F8X K;  4N3C A;  2ZXW E;  3FUJ A;  4DRX E;  3TWT A;  2KAT A;  3TWW A;  3DXM G;  3HXC A;  3E30 A;  2E0I A;  4RVB A;  3OXG A;  3BG0 B;  3EHN A;  1NA3 A;  3RO3 A;  2R2L A;  3ZYK A;  4WAF A;  3ZXS A;  2VTB A;  1OWM A;  3Q5M A;  2X6F A;  2L0T B;  5CMY A;  5CBO A;  2CFU A;  2J8S D;  4DK5 A;  3GW4 A;  3UT7 A;  3DRA A;  3NF1 A;  2RKK A;  2GRO B;  4XIF A;  4A55 A;  3VTY A;  3Q78 A;  4KMO A;  4GTM A;  3MGB A;  4GYO A;  4DLO A;  1BD8 A;  3RKV A;  5BXU A;  3V2O A;  4FAD A;  3B7U X;  3G2S A;  2R05 A;  3TXM A;  2ETA A;  3D9O A;  3U4T A;  3ONL A;  3LEW A;  1EF1 C;  2WXP A;  3TL5 A;  3J5Q B;  1P5Q A;  4AP2 A;  5JMN D;  3V30 A;  3CVN A;  4NUR A;  2MHK A;  3FUM A;  3IEG A;  1H6O A;  4NRH B;  3JXI A;  1HFA A;  1JWG A;  2XPI A;  1E8Z A;  2AXU A;  4I6J A;  4J8F A;  1FVH A;  2BUG A;  4JD2 G;  4AIF A;  3L54 A;  2V5Q C;  4AJW A;  2FEZ A;  3JQ1 A;  3IBE A;  1SA4 A;  3DBS A;  4U0U A;  3MKQ B;  4IRU A;  5BV0 A;  3FTU A;  4DUI A;  2WXK A;  2DCP A;  4TXQ A;  1EPU A;  4YDO A;  3MCX A;  3PEU B;  2P9P G;  1N4Q A;  4HOT A;  5EIL A;  3S2A A;  3O48 A;  3ULQ A;  2AW6 A;  2KZT B;  2IU1 A;  5HKP A;  4G8K A;  4BTA A;  1NP7 A;  3R9A B;  1N11 A;  3KSQ A;  2AVP A;  4A1S A;  4HI9 A;  4UI9 C;  3RJV A;  2ZIS A;  4DX2 A;  1IYG A;  4FHJ A;  4DI3 A;  4F6R D;  3LCA A;  4NIK A;  4Q69 A;  4TXP A;  3BG1 B;  1QNF A;  3PVL A;  3SD5 A;  3C3O A;  3PE3 A;  4LEU A;  3GZ1 A;  4LG6 A;  3FH5 A;  3LYA A;  1BLX B;  2KXP C;  3ENE A;  2PNN A;  1H2V C;  4HVB A;  5AQB A;  3FUN A;  3ASF A;  5LCW J;  2YHC A;  1TNZ A;  3D3M A;  5FWQ A;  2R5S A;  4DI4 A;  3TJP A;  3ESK A;  3NAW A;  3FUD A;  4U8H A;  4G1T A;  3PNT B;  3ZEF A;  3IHY A;  3CV0 A;  4V3I A;  3D9H A;  3PDN A;  3APF A;  4RSY A;  4AXH A;  4Q96 A;  2NSZ A;  3R7Q A;  4JC8 A;  3ZFW A;  3PZ4 A;  2GRQ B;  4L9P A;  3QAQ A;  3QWW A;  4NAC A;  5KBA A;  3P2B A;  1PAQ A;  4HOQ A;  1AP7 A;  4XZ4 A;  3CKB A;  3MEK A;  1UW4 B;  4UQY A;  2LSU A;  3CVX A;  3BU8 A;  3FEX A;  1UJK A;  2EIM E;  3OXF A;  1HU3 A;  3IHV A;  2WMN A;  3LY9 A;  5ARF A;  2VSY A;  4CDR A;  4JA7 A;  3AS4 A;  5D66 A;  4GMR A;  1BPO A;  1WY6 A;  3CK9 A;  4A3T A;  4E6H A;  3RIB A;  3FTZ A;  1D8D A;  3FU0 A;  3NZS A;  2R02 A;  4MRU A;  1NZN A;  3CQG B;  1KLX A;  4WNF A;  2VSO E;  2LSV A;  1OCZ E;  2XRY A;  1XGW A;  1Z3X A;  4L2L A;  3PUJ A;  4EHM A;  3AU5 A;  4U07 A;  3ZPJ A;  2GRN B;  4O1P A;  5ENT D;  2PQN A;  3EHM A;  5AIJ A;  1OY3 D;  2XGO A;  4U96 D;  1TNU A;  5IY5 E;  2VGE A;  4CGW A;  4ABN A;  2VSN A;  3JXJ A;  5HS0 A;  1PY1 A;  4ACK A;  3QWP A;  4X8Q A;  3FTV A;  2V5F A;  2XZT G;  2JAB A;  4Y6C A;  5CCM A;  2F37 A;  2XGS A;  3NOG D;  3CEQ A;  1LD7 A;  4FC8 A;  2WXI A;  3SFZ A;  4JPS A;  2C0M A;  2IFU A;  1RW2 A;  4EZK A;  4H7Y A;  5BPP A;  1QYM A;  3ONK A;  3QKY A;  3Q75 A;  1DC2 A;  1HG2 A;  3RRN B;  4OAU C;  3D9J A;  5G2N A;  2PQR A;  1S64 A;  2PM6 A;  2JLB A;  4H7X A;  2IQC A;  4ME2 A;  3W9F A;  3SQV A;  4FJY A;  4TUM A;  3QOU A;  2DYR E;  4XEI G;  3FP3 A;  4KBQ A;  1MZC A;  1SZ9 A;  1TNO A;  1TN6 A;  2WB2 A;  2V4L A;  4PH4 B;  4GMJ A;  3LS8 A;  4C48 B;  3KEZ A;  1K8K G;  3FU3 A;  3MKR A;  3B7T A;  5KJM A;  5FQ6 A;  1FT2 A;  5A6C A;  3HXF A;  4BSX A;  2C2L A;  3NOC D;  4GCO A;  2XRZ A;  4HOR A;  2IOL A;  3QWV A;  5ENP D;  1YCS B;  2Y69 E;  3EIQ C;  1WG0 A;  2IO2 C;  3PZD A;  2FO1 E;  1UN8 A;  2VTB B;  4F1S A;  1BI8 B;  3E33 A;  1HO8 A;  2A4Z A;  4GZD A;  4YDE A;  2MRI A;  3PRE A;  3T8M A;  1K1A A;  3S7D A;  3HXB A;  4KVO A;  1ZU2 A;  2BED A;  4FLH A;  4XKB A;  3ZYM A;  3DEO A;  5EKQ D;  4HLE A;  1O1T A;  3UM0 A;  1JCS A;  2I1J A;  4GA0 A;  4J7W A;  5A7D B;  5G04 C;  4CGV A;  3OAW A;  3ISM C;  1ZB1 A;  2AJA A;  3FUK A;  3ZN3 A;  1IHB A;  4GTS A;  2EIJ E;  2VYI A;  2FBN A;  3I3N A;  1UOH A;  5CEA A;  5AQ7 A;  1E7V A;  2J4B A;  2OVF A;  3JQ0 A;  1ELK A;  4HNA D;  4PS3 A;  2VSX E;  3DST A;  5EX0 A;  3SBT B;  4U95 D;  2L0I A;  2Y4U A;  3TXN A;  3ZRH A;  1LD8 A;  3GYZ A;  2WPV A;  3E34 A;  5ITZ F;  3MV2 B;  3UTM A;  2X3M A;  4DJA A;  3LVQ E;  3TWV A;  3ZU7 B;  4ILH B;  2XEN A;  2NC9 A;  3HRA A;  3SHF A;  5ANL A;  1E96 B;  3UX4 A;  2I9C A;  2P9I G;  3EJN A;  4EBA A;  1D9S A;  4LSZ E;  4BTB A;  4I9E A;  1HF8 A;  2IO3 C;  1MX4 A;  2ZIR A;  4CZ2 D;  3QAR A;  5T3R A;  2X6H A;  3BQO A;  1WAO 1;  5M72 A;  3S7B A;  3EHQ A;  4O1O A;  3CIA A;  3L17 A;  4GAA A;  4HRL A;  2BKG A;  3IKO B;  3B7S A;  1N94 A;  2PZI A;  3CHS A;  1JWF A;  5AJD A;  2HR2 A;  4JB8 P;  5KJN A;  2CG3 A;  2Y0B G;  2UY1 A;  1N4R A;  2R59 A;  2QYJ A;  5KNG A;  1HS6 A;  1QZ2 A;  4J6I A;  4KZ0 A;  3Q73 A;  1MYO A;  2LXL A;  4GTQ A;  3UQ3 A;  2ETB A;  3E32 A;  3MZL B;  4U8Y D;  3LY8 A;  5G55 A;  5FIN A;  3PNL B;  2NXP A;  1S0P A;  2H6H A;  1YMP A;  1FT1 A;  3BEE A;  2BTD A;  3UM3 A;  4FJZ A;  4N39 A;  4TUU A;  3CVQ A;  4LNB A;  2FF4 A;  4AEZ C;  2X6I A;  3V2X A;  2GGF A;  3S7F A;  1OCR E;  3AAA C;  5D0Q D;  4XI0 A;  3RU0 A;  3JYS A;  1EDU A;  4L7T A;  4GCN A;  4CEM A;  4UWK A;  1N4S A;  2DWZ A;  3KD7 A;  4APO A;  4KYO B;  3W9G A;  2DVW A;  2OCC E;  3DSU A;  5HQ8 A;  1BI7 B;  2ZU6 B;  3AG3 E;  3ASG A;  4B89 A;  4YDW A;  3MX3 A;  2XCC A;  2P58 C;  5BV1 A;  4K03 A;  2X6J A;  3G2T A;  4UI9 J;  3E37 A;  3U3W A;  4ANX A;  2A5E A;  3KS2 A;  2P2C P;  4BSZ B;  4CDN A;  2DZO A;  1LF8 A;  2OOE A;  4U7E B;  3ZYL A;  3OTN A;  2WXF A;  3QDN A;  4AY5 A;  5B1A E;  4OYS A;  4E85 A;  4C0E A;  3Q9N C;  4DPR A;  4RG6 A;  1MJ0 A;  3FU6 A;  2J08 A;  4GYY A;  4A63 B; 
#chains in the Genus database with same CATH homology
 1TN7 A;  4GTS A;  1N9A A;  3E32 A;  3KSL A;  1N4P A;  3C72 A;  1QBQ A;  3Q7A A;  4GTR A;  3Q7F A;  3PZ3 A;  1TNU A;  2H6H A;  1TNZ A;  1KZP A;  1FT1 A;  3DST A;  1D8E A;  1TNB A;  1TNY A;  3DSX A;  1FT2 A;  4GTV A;  1O1S A;  1O1R A;  1JCQ A;  1LD8 A;  3HXF A;  4LNB A;  4GTO A;  3HXD A;  2H6G A;  3E34 A;  2H6F A;  4GTT A;  3DSW A;  1DCE A;  1SA4 A;  3PZ1 A;  3PZ4 A;  3DSV A;  1KZO A;  4L9P A;  1N4S A;  3SFX A;  3PZ2 A;  4YDO A;  3DSU A;  3HXC A;  3E30 A;  1TN8 A;  1N4Q A;  1LD7 A;  2IEJ A;  2ZIR A;  3E33 A;  1X81 A;  2H6I A;  3EUV A;  1FPP A;  2R2L A;  4YDE A;  4MBG A;  1NL4 A;  3DPY A;  3E37 A;  3KSQ A;  1JCR A;  3Q75 A;  1LTX A;  1N95 A;  3HXE A;  2ZIS A;  1N94 A;  1SA5 A;  2F0Y A;  3EU5 A;  3DRA A;  3HXB A;  1D8D A;  1S64 A;  2BED A;  3Q78 A;  1NI1 A;  3Q79 A;  3DSS A;  4GTM A;  1N4R A;  4LNG A;  1O5M A;  1O1T A;  1JCS A;  1S63 A;  1MZC A;  4EHM A;  3SFY A;  3Q73 A;  1TNO A;  4GTP A;  1TN6 A;  4GTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...