1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
molecule keywords PROTEIN FARNESYLTRANSFERASE
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
2H6HA 1FT2A 2ZIRA 4GTPA 4EHMA 3HXCA 1S63A 3E33A 3KSLA 4GTTA 4GTOA 3EU5A 2H6FA 1SA5A 4GTVA 4GTRA 1N4QA 2H6GA 4LNBA 1TN8A 3DSUA 1LD7A 1D8DA 1TNZA 1TNOA 3DPYA 2IEJA 2H6IA 3E30A 1N95A 3DSXA 3DSVA 3E34A 3KSQA 3E32A 1O1RA 3PZ2A 1FPPA 1JCRA 1O5MA 1KZPA 3Q7AA 1LD8A 1QBQA 2F0YA 1LTXA 1X81A 1N4RA 1NI1A 3HXEA 1TN6A 4YDOA 4MBGA 3HXDA 1O1TA 3PZ1A 1TNYA 1N9AA 3DSTA 3EUVA 4GTSA 1FT1A 3Q78A 1TNBA 4LNGA 1TN7A 3Q79A 1NL4A 3SFYA 3SFXA 1KZOA 4L9PA 3PZ4A 2R2LA 1O1SA 1SA4A 3HXFA 4YDEA 4GTMA 1S64A 3DSWA 1DCEA 3Q7FA 3HXBA 1N4SA 3C72A 1N4PA 3PZ3A 1N94A 3Q75A 3E37A 1JCSA 3DSSA 1D8EA 2ZISA 3DRAA 4GTQA 2BEDA 1MZCA 1TNUA 1JCQA 3Q73A
chains in the Genus database with same CATH superfamily
3BEEA 4C48B 3MKQB 2KXPC 4HI8A 1VDYA 2XRZA 4GTOA 4XZ4A 4UI9C 1HZ4A 2Y0BG 3FTUA 4JC8A 1EYHA 3JYSA 4E6HA 3UKRG 1G3NB 3AG3E 3FUHA 3S7BA 1P5QA 4I1OB 3E30A 1IHGA 3FUNA 3QOUA 3PZ2A 4BX9A 3D9PA 4G1TA 4ILHB 4AP2A 5HS0A 4J6IA 3VTXA 3NAWA 4JB8P 4HXIA 2GRQB 2P58C 4ME2A 4AV7A 4N3BA 1DCQA 4QFVA 5B3SE 1JWFA 4HOSA 1O1SA 3FEYA 2I9CA 2I1JA 3HXFA 3S7FA 2AJAA 2PQNA 3DWLG 3T5XA 2E0IA 5JMND 2YHCA 2PL2A 2X6JA 3CK8A 1N4PA 3D9JA 2XHEA 4DUIA 3OXLA 3U3WA 2I2OA 3DSSA 3EHNA 5AYWD 3CKBA 2DZNA 5EX0A 2J09A 2XPIA 3FH8A 2IQCA 4IYPA 3JXJA 1KT0A 5FTPA 4ACLA 4EECA 2VSNA 1SZ9A 5FQ7A 3CVVA 4BEPA 2FF4A 4O1PA 4UWFA 3FU3A 4GTRA 3R9AB 3EDTB 1N4QA 4N3CA 4HB5A 3RKVA 5BV0A 4NACA 2WQHA 3CVPA 4EZLA 2H6IA 4GB9A 3V30A 1B89A 4DPRA 4LUNU 3E32A 3L82A 2RFAA 4U07A 3TWTA 3TWSA 4CGWA 1TJCA 4BFRA 3FH5A 1S0PA 2EQXA 3LPZA 5ENNA 3SY2A 1KLXA 4AY6A 3LVQE 5EX3A 4JZYA 3CSFA 2DCPA 3D3MA 2QZAA 4APFA 3L22A 3EUVA 3KEZA 2DWZA 3BUAA 4NURA 3ASGA 4K5BA 4BT9A 2OV8A 3L6AA 2IF4A 4HORA 3SBTB 4UWHA 4F3VA 3SI5A 1TEZA 3C98A 4TXQA 1OUVA 3IKOB 3O4ZA 2KC7A 3ASDA 3OXFA 3Q75A 3NF1A 2XENA 3CVQA 1NA0A 4HBDA 3DRAA 3IHVA 5G2NA 3I4RB 2DVWA 1OWOA 1V55E 4M3OA 3X2QE 5LX8A 2GRLA 3HHMA 3E33A 2QFCA 5EIDA 4DI3A 2V5FA 2ZGGA 3ZEFA 3S7DA 3TG5A 4I6GA 2IJGX 3EHRA 5KCMA 2NSZA 2EIME 1MJ0A 2KZTB 5BW8C 4Y6WA 5LP0A 2QC9A 3FU5A 3I3NA 1SZAA 1H2UA 5A23A 1WDYA 1OT8A 4HS2A 4AJWA 3LS8A 2WXRA 5FQ8A 5C1DA 4IULA 2WVIA 1MX2A 4G8KA 4KZ0A 1JWGA 3ONKA 5A6CA 2PZIA 4V3IA 2PM6A 1IXVA 4U8HA 1ELKA 5EKQD 3C5RA 5FQ4A 4HRLA 4GCNA 1MYOA 4GMJA 5ENQD 3D9HA 3SFXA 4AXHA 4HRNA 3B7BA 2F8XK 2NYJA 1Z5SC 4YVOA 5BNWA 4DX2A 3VLDA 3UMVA 1K1BA 3I5PA 5BV1A 2A5UA 2C0LA 3SD5A 2LSUA 1H19A 5T3RA 3NZSA 5AQ7A 3TWVA 3IBEA 4BSXA 4PS8A 4A63B 1EPUA 5E76A 2L6JA 3CHMA 3ESKA 4A3VA 3AS5A 2AWIA 3GYZA 1ZB1A 3CVLA 4XI9A 1D8DA 4LNUD 3PEVB 2IONA 1IQRA 4AEZC 3ML8A 3L08A 1E8XA 2WM9A 4GPMA 1O1RA 4ABNA 4U96D 5EDSA 4UWKA 3PRZA 3FFLA 4FLHA 4K5AB 1LD8A 3RK6A 4KBQA 3AU5A 3TWUA 1A5EA 4BY6A 3CQGB 1HG2A 2V4LA 2EIJE 3MKRA 4WNDA 3RO2A 3HRAA 4OAVB 2XEHA 3I4GA 1K3ZD 1KZOA 5EYPF 5EILA 3MEKA 1UJJA 5CCMA 3ISMC 1Y8MA 5JJ7A 1N11A 2BTDA 3LKUA 3U4TA 3CV0A 4GZDA 2LXLA 1TYQG 3OXGA 3PZ3A 4ILGA 4RSYA 1UN8A 2P9NG 1W3BA 3LY8A 3ZYLA 2V8SE 4BETA 5CECB 4C9BB 4PH4B 3JUIA 5EYLA 4FHKA 4ANUA 3C3OA 2YNQA 5ENOD 1S63A 3ZVVA 1GW6A 3RJVA 5KJMA 5CBOA 4YDYA 4H7XA 1SA5A 4I2ZA 3C3QA 2VGXA 1H2VC 3UIOC 4I17A 4EZKA 2VGEA 3MX3A 3ZHEB 4L2YA 4DRXE 5JA4D 4B89A 3DSVA 2IOLA 3MKQA 4XKCA 3BQOA 1JCRA 4JXTA 5BXUA 3UM3A 3APFA 4J0UA 4RLYA 3T8KA 3Q7AA 1KPSB 2GRRB 5KJNA 2WXMA 2DZOA 3TXNA 4N5CA 3J5PA 5HRYA 3LY9A 5ARFA 2WXJA 2XPYA 1N9AA 2I1KA 4A55A 4JW1A 4K03A 4GYWA 3CVWA 5IY5E 5FINA 2L9BA 4DX5D 5AJDA 1AWCB 3C3RA 2M63A 4HQDA 2PM7A 3ABKE 3CHRA 3PUJA 2WXOA 3ZW3A 1N94A 3DXKG 2LAHA 2E2EA 2VTBA 1OWMA 4JL0A 4GTQA 4GZCA 4W9RA 2X6IA 5BXOA 2V4HC 3K9IA 3QJZA 3LXUX 4Q69A 4I2WA 3CKCA 4UI9K 5KJKA 5CCLA 2PQRA 1SVXA 2Y4TA 4I43A 1TNZA 2WXFA 3DSXA 4HI9A 3E34A 2JEKA 3FULA 4ILIA 4O6FA 4F6RD 5G55A 3ZU7B 3MGBA 3URZA 4YNDA 4ATZD 4GZ5A 3IEGA 2HM8A 3EJNA 3HG0D 2VSYA 5ENTD 2RG8A 2WXKA 2V5QC 4ANWA 2JLBA 5ENSD 3Q15A 4U63A 1NFIE 3UT8A 1HO8A 2DYSE 2F8YA 3TXMA 1WG0A 3PZ4A 4WNGA 3QNKA 4YDEA 4HRMB 5CEDB 4GTMA 2AW6A 3DXMG 3HVEB 4UI9J 3FP3A 2A4ZA 2EINE 1Z3XA 3MA5A 2ETBA 5KJLA 4AY5A 5G04C 4K5CA 4KVOA 3MCXA 3PH0C 1UJKA 5CHEE 3CQCB 4XE0A 4APOA 1ZU2A 1MX4A 1S70B 2R59A 5G05J 4HVBA 3DBSA 3RIBA 4TXPA 3ULEG 3VLEA 2F37A 1OCZE 3WG7E 2H6GA 5G04J 4BERA 1L5JA 2UY1A 4UWLA 2VJ8A 5FT9A 3RSEG 5A7DB 3NQPA 3FY4A 5FZQA 4KYOB 2EILE 1OXJA 4U04A 3LCAA 1HFAA 2VGYA 4FLBA 3D9KA 2IY0C 3UM1A 4G23A 5FWQA 3QKYA 1IHBA 5FJYA 1E8YA 4OVUA 3E4BA 2WXIA 3IV0A 5B1BE 2P9UG 4MLPA 3NOCD 1N52A 3FTXA 2J8SD 3KD7A 1JPLA 1PAQA 3TWRA 1MQSA 1TNBA 1DNPA 1TN7A 1ELWA 1HG5A 1OWLA 4GAAA 4EBAA 4GA1A 2OOEA 3G2WA 2ONDA 3ESLA 3NZUA 2KBXA 3D9LA 4Z68A 4RG9A 2OEWA 2WXQA 1WAO1 1OY3D 1BI7B 3SBSA 2Y69E 3QWVA 4D10C 1N0RA 3R9MA 5AQ9A 3SO8A 1BLXB 2WPVA 1OWNA 5DBKA 2H6HA 3CHSA 3P1UA 2XS8A 3FTWA 3QARA 4LRZA 4CCAA 3LVRE 4GZ3A 5CEAA 5T4YA 3HIZA 2L6BA 2XQ0A 2KCKA 4LEUA 2QYJA 3DSUA 1LD7A 4B8CB 1H0AA 4J8YA 1TNOA 2WMOA 3DPYA 4G11A 4G26A 5C2YA 5J90A 4IN3B 3TJPA 1SQMA 1HE8A 1NZNA 3ZNGA 1DC2A 3DPDA 1X5BA 3T9KA 4UWGA 1QBQA 2MHKA 2WXPA 1NI1A 4OAUC 1LF8A 3BU8A 1Z3YA 3GZ1A 1ZBPA 4B0ZA 3ML9A 4U0UA 3HDXA 1AP7A 4A1GA 3PNTB 3CHOA 2ILRA 2R5SA 2VSOE 4CDNA 2J9QA 4CT0A 2Y4UA 1OCRE 2XZDG 1U2VG 1IYGA 3SFZA 4N39A 4B93B 2CHWA 2AXUA 3S2AA 3V31A 3TWWA 3NOGD 4Q96A 1JCSA 1D8EA 2ZISA 4TUUA 4HFGA 4J8DA 4J8FA 3V2OA 4KVMA 4L2LA 2WQ7A 3FUDA 1H6PA 4N3AA 2HE0A 2JABA 4FADA 3DEOA 5ANRA 4LCTA 2Y3AA 3UI2A 2FBNA 3EHQA 2XGMA 4U8YD 4E85A 2VGXB 3EIQC 3MZLB 3APDA 1N95A 3UT4A 1E96B 2HR2A 5FZSA 3W9GA 3ASFA 4BTAA 3L17A 4U0ZA 4JHJA 3T8MA 4HLEA 1E7VA 3JQ0A 2XGOA 3B95A 3MV2B 5AQAA 4MBGA 3AAAC 3OTNA 4GTSA 3TWXA 1FT1A 5BPPA 5KBAA 3G2UA 4L9PA 2P9IG 3F6QA 2MYOA 3L54A 4FULA 3UM2A 2R17C 2XCCA 1S64A 2XGSA 1HX8A 4KMOA 4J8SA 2XS1A 1UW4B 4CRWA 3UKUG 4CZ2D 1YYHA 1TNUA 2FI7A 2B6CA 5AARA 3N71A 5D0QD 4OYSA 3FTYA 4BT8A 2R02A 4I9CA 4NIKA 3QB2A 4IRUA 4TUMA 3HVEA 3PE3A 3GZSA 4FP7A 1OCOE 2WQ6A 4LNBA 4ANVA 2WXNA 4WWNA 3SGHA 4PS7A 2UY1B 3R7RA 3RRUA 3JQ1A 4PDXA 2IEJA 3SZ7A 4OVVA 2IO2C 5AIJA 1WY6A 5ITZF 5ENPD 3CVUA 1FPPA 4JEUA 2KCVA 1BU9A 3LY7A 3P2BA 1D9SA 5JJTA 2A5EA 4YVQC 4I1MA 4L23A 1LTXA 4R7LA 1BPOA 4PS3A 3JCKC 3L13A 3CGHA 5G05C 2VYIA 4A1SA 1QQEA 2IU1A 1MX6A 3Q79A 1NL4A 4JEHA 5AAOA 5M72A 3SNXA 2J4DA 4C0MA 4X8QA 4FHJA 1XGWA 4AIFA 3LDZA 4NQ0A 2NC9A 4I6EA 4BX8A 2OEVA 2ETAA 3Q7FA 5HKPA 4GCOA 3HXBA 4XX5A 2AXVA 3FUEA 2BEDA 2GROB 4K0RA 2HYZA 2IOSA 4J8EA 1NA3A 3GW4A 2ZIRA 4L7TA 4HOQA 1JUQA 2P9SG 4GTTA 4LSZE 3D9OA 4GYYA 4AOFA 1UOHA 3Q49B 4FA6A 4G25A 2UWJG 2CG2A 3S7JA 5J08A 2OVBA 5AN8A 2PNNA 3AG2E 5KNGA 3AG4E 2WMNA 4N5QA 3CHQA 1BD8A 3AG1E 3RRNB 3EHMA 4J7WA 1N0QA 2P9KG 4O60A 1U3CA 3QWWA 4F1PA 5EIBE 3AU4A 4WNFA 3OAWA 5BUZA 3HXEA 3DEPA 1RW2A 4MKTA 3DSTA 3RU0A 2LUHA 3RO3A 3CEQA 3QC1A 1E8ZA 4U95D 1NP7A 2J08A 2WXHA 1YMPA 5FZRA 2BKKB 1DCEA 4N2QA 2WXGA 4UQXA 2L0IA 1IKND 4HOTA 3ASOE 5LCWJ 4YDWA 4DLQA 2DYRE 3UUXA 2ZGDA 4Y6CA 1FVHA 3KEAA 1BI8B 4GTPA 4MS6A 2J4BA 4JD2G 4L1BA 4RQIA 1Z6TA 3UPVA 3BG1B 2EIKE 4ZHBA 2P9PG 4DX1A 1UN9A 4G24A 3IHYA 4CEMA 2XEEA 4FU3A 2X6HA 2CFZA 3ABLE 3TWQA 4UUCA 4RG6A 3ABME 3HYMB 3ULYA 5HQ8A 2J49A 2X38A 2HO1A 3L9TA 4FJYA 3UIPC 4WWOA 5FQ6A 5LFAA 2L0TB 1N4RA 4XIFA 2R05A 1E7UA 2OVFA 4LERA 4JA9A 3QDNA 5AQBA 3SFYA 3ZN3A 4G2VA 1A17A 2R2LA 2LXMA 4AM9A 4HOUA 1N54A 1SA4A 4ATGA 3CSTA 1HF8A 3DSWA 1XNFA 3EU9A 3R7QA 2WXLA 1EF1C 3B7TA 5CMYA 1Q2ZA 4U0SA 4F53A 2LAIA 3RAUA 2KM4A 3UX4A 2C2LA 3Q5MA 3G2VA 1FT2A 3PZDA 4PUCA 4F1SA 2NXPA 3PEUB 1HH8A 4WWPA 3PVLA 4GTVA 3PDNA 3UM0A 1TR4A 3UTMA 3FTSA 3U9WA 3Q9NC 1TN8A 3TAXA 2X6KA 4RVBA 4O1OA 3FU6A 3AJIA 3CK9A 3CHPA 1YA0A 3CK7A 4XEIG 1QYMA 1KZPA 4DK5A 2KCLA 1OCCE 1ELRA 2RFMA 1U3DA 5CRUA 4XI0A 3Q47B 4YDOA 2I6HA 2P2CP 1O1TA 3LJ3A 3SF4A 2FO1E 3KAEA 3U66A 2FULA 3Q78A 2GGFA 1Y6IA 4URKA 4GPKA 3WXXA 3FTVA 3FU0A 3ZYKA 4DLOA 4GYOA 1HU3A 3FUJA 3AS8A 3L16A 4GA2A 2CFUA 2YINA 5T8IA 4GU5A 4GA0A 3G2SA 4KT6B 3CVXA 1TJFA 4I6JA 5LCWC 2V0PA 4WNEA 2GRNB 3ZIMA 4EZJA 4JPSA 3ASHA 4ACKA 3HXCA 3B7SA 4U8VD 3O48A 5B1AE 4CT4A 5CMWA 4BTBA 2H6FA 3PE4A 3ZGQA 2ZXWE 4BWRA 5D66A 3GZ2A 3ZXPA 5EN5D 2FEZA 3EIJA 3FTZA 4FC8A 1QNFA 4TRQA 5JJ6A 1H6OA 4NRHB 4B94A 1RZ4A 2XPZA 4QQIA 2CG3A 4WAFA 1INZA 5KWDA 3ZYQA 4WUYA 1V54E 1MHQA 3ZRHA 2OCCE 3FUIA 4TXRA 2F0YA 2CHZA 1X81A 3SQVA 3D9NA 2ZU6B 3PUKA 3Q4AB 2RD0A 1E90A 1TN6A 4HNAD 3Q9UC 2X6FA 3CVNA 4UQYA 2B0OE 2FO7A 5H7PA 4I1AA 4UQZA 3FWVA 4N2SA 4BESA 3D9IA 4A3TA 4KZCA 3APCA 1KT1A 3MYVA 4DI4A 3CIAA 3ZHEA 1N4SA 3C72A 4EPZA 2P9LG 3LYAA 3KS2A 5JHAA 4FJZA 4DX7D 2YQ8A 1WM5A 4CGVA 1JCQA 3Q73A 2C0MA 3B7UX 1FCHA 2IO3C 4I9EA 5AJLA 3KSLA 4EQFA 5ANLA 3EU5A 2VSXE 2RKKA 3FHEA 4MRUA 3SHFA 2IFUA 2QY7A 1UG3A 5LOZA 3CR3A 3UT7A 4BSZB 2DIWA 3FUFA 3MV3B 2YHEA 3NB2A 5DIZA 5AENA 3KSQA 4F7AA 3PNLB 3ZYMA 1QZ2A 4ZFHA 4LG6A 3UQ3A 3ENEA 3FUKA 3ZUVB 2QYUA 3TGOA 2GRPB 2DBAA 2J07A 5BT1A 3CLJA 1YCSB 1SW6A 3QAQA 5ENRD 2WB2A 4TV3A 2BF0X 5D2MC 1H2TC 3ASNE 1EDUA 4LNGA 4AVXA 1IQUA 3ULQA 1K1AA 4C0EA 3W9FA 4B8AA 3CVYA 1DVPA 4Q94A 1PC2A 2VQ2A 2CHXA 2XCBA 2GW1A 3ZFWA 4GMRA 3TL5A 3ONLA 4DJAA 2ETCA 2XRYA 3MJWA 4JVSA 4CYMD 4DX6D 3BG0B 2LSVA 2AXZA 4M7CA 3UINC 3AS4A 2R03A 4JHRA 3VTYA 4CDMA 3B13A 1H6KA 3ZKJA 4EHMA 3J5QB 3QWPA 5D0OD 2GRMA 4H7YA 5ARGA 1HS6A 1FVFA 3PS6A 3NBNB 4JA7A 2LNIA 1E8WA 2KZTA 3IXEA 3U64A 2XZTG 5CBNA 3JXIA 3ZPJA 3T5VA 3FEXA 1PY1A 5FIOA 2VTBB 2KATA 1O5MA 5CERB 5CRVA 4GMLA 4XKBA 4GZ6A 1HXIA 3QK0A 4HLLA 1K8KG 4ANXA 3V79K 3FDHA 2X3MA 5E75A 3HXDA 3PZ1A 1TNYA 5HI7A 3PREA 3TG4A 4CDRA 4U7EB 2AVPA 3UXGA 2MRIA 3LJNA 5JHBA 3V2XA 3VLFA 3JUEA 4KXKB 1OWPA 2Q7FA 3B7RL 4P29A 2MOWA 5KNHD 3LEWA 2Y1LE 3D9MA 4EBAG 3FH7A 2XEVA 2BKGA 4G8LA 2BUGA 3E37A 3ZXSA 3G2TA 4JHKA 1MZCA 2LO6A 3RRMB 3FUMA
chains in the Genus database with same CATH topology
2H6HA 1FT2A 2ZIRA 4GTPA 4EHMA 3HXCA 1S63A 3E33A 3KSLA 4GTTA 4GTOA 3EU5A 2H6FA 1SA5A 4GTVA 4GTRA 1N4QA 2H6GA 4LNBA 1TN8A 3DSUA 1LD7A 1D8DA 1TNZA 1TNOA 3DPYA 2IEJA 2H6IA 3E30A 1N95A 3DSXA 3DSVA 3E34A 3KSQA 3E32A 1O1RA 3PZ2A 1FPPA 1JCRA 1O5MA 1KZPA 3Q7AA 1LD8A 1QBQA 2F0YA 1LTXA 1X81A 1N4RA 1NI1A 3HXEA 1TN6A 4YDOA 4MBGA 3HXDA 1O1TA 3PZ1A 1TNYA 1N9AA 3DSTA 3EUVA 4GTSA 1FT1A 3Q78A 1TNBA 4LNGA 1TN7A 3Q79A 1NL4A 3SFYA 3SFXA 1KZOA 4L9PA 3PZ4A 2R2LA 1O1SA 1SA4A 3HXFA 4YDEA 4GTMA 1S64A 3DSWA 1DCEA 3Q7FA 3HXBA 1N4SA 3C72A 1N4PA 3PZ3A 1N94A 3Q75A 3E37A 1JCSA 3DSSA 1D8EA 2ZISA 3DRAA 4GTQA 2BEDA 1MZCA 1TNUA 1JCQA 3Q73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6H A;  1FT2 A;  2ZIR A;  4GTP A;  4EHM A;  3HXC A;  1S63 A;  3E33 A;  3KSL A;  4GTT A;  4GTO A;  3EU5 A;  2H6F A;  1SA5 A;  4GTV A;  4GTR A;  1N4Q A;  2H6G A;  4LNB A;  1TN8 A;  3DSU A;  1LD7 A;  1D8D A;  1TNZ A;  1TNO A;  3DPY A;  2IEJ A;  2H6I A;  3E30 A;  1N95 A;  3DSX A;  3DSV A;  3E34 A;  3KSQ A;  3E32 A;  1O1R A;  3PZ2 A;  1FPP A;  1JCR A;  1O5M A;  1KZP A;  3Q7A A;  1LD8 A;  1QBQ A;  2F0Y A;  1LTX A;  1X81 A;  1N4R A;  1NI1 A;  3HXE A;  1TN6 A;  4YDO A;  4MBG A;  3HXD A;  1O1T A;  3PZ1 A;  1TNY A;  1N9A A;  3DST A;  3EUV A;  4GTS A;  1FT1 A;  3Q78 A;  1TNB A;  4LNG A;  1TN7 A;  3Q79 A;  1NL4 A;  3SFY A;  3SFX A;  1KZO A;  4L9P A;  3PZ4 A;  2R2L A;  1O1S A;  1SA4 A;  3HXF A;  4YDE A;  4GTM A;  1S64 A;  3DSW A;  1DCE A;  3Q7F A;  3HXB A;  1N4S A;  3C72 A;  1N4P A;  3PZ3 A;  1N94 A;  3Q75 A;  3E37 A;  1JCS A;  3DSS A;  1D8E A;  2ZIS A;  3DRA A;  4GTQ A;  2BED A;  1MZC A;  1TNU A;  1JCQ A;  3Q73 A; 
#chains in the Genus database with same CATH topology
 3BEE A;  4C48 B;  3MKQ B;  2KXP C;  4HI8 A;  1VDY A;  2XRZ A;  4GTO A;  4XZ4 A;  4UI9 C;  1HZ4 A;  2Y0B G;  3FTU A;  4JC8 A;  1EYH A;  3JYS A;  4E6H A;  3UKR G;  1G3N B;  3AG3 E;  3FUH A;  3S7B A;  1P5Q A;  4I1O B;  3E30 A;  1IHG A;  3FUN A;  3QOU A;  3PZ2 A;  4BX9 A;  3D9P A;  4G1T A;  4ILH B;  4AP2 A;  5HS0 A;  4J6I A;  3VTX A;  3NAW A;  4JB8 P;  4HXI A;  2GRQ B;  2P58 C;  4ME2 A;  4AV7 A;  4N3B A;  1DCQ A;  4QFV A;  5B3S E;  1JWF A;  4HOS A;  1O1S A;  3FEY A;  2I9C A;  2I1J A;  3HXF A;  3S7F A;  2AJA A;  2PQN A;  3DWL G;  3T5X A;  2E0I A;  5JMN D;  2YHC A;  2PL2 A;  2X6J A;  3CK8 A;  1N4P A;  3D9J A;  2XHE A;  4DUI A;  3OXL A;  3U3W A;  2I2O A;  3DSS A;  3EHN A;  5AYW D;  3CKB A;  2DZN A;  5EX0 A;  2J09 A;  2XPI A;  3FH8 A;  2IQC A;  4IYP A;  3JXJ A;  1KT0 A;  5FTP A;  4ACL A;  4EEC A;  2VSN A;  1SZ9 A;  5FQ7 A;  3CVV A;  4BEP A;  2FF4 A;  4O1P A;  4UWF A;  3FU3 A;  4GTR A;  3R9A B;  3EDT B;  1N4Q A;  4N3C A;  4HB5 A;  3RKV A;  5BV0 A;  4NAC A;  2WQH A;  3CVP A;  4EZL A;  2H6I A;  4GB9 A;  3V30 A;  1B89 A;  4DPR A;  4LUN U;  3E32 A;  3L82 A;  2RFA A;  4U07 A;  3TWT A;  3TWS A;  4CGW A;  1TJC A;  4BFR A;  3FH5 A;  1S0P A;  2EQX A;  3LPZ A;  5ENN A;  3SY2 A;  1KLX A;  4AY6 A;  3LVQ E;  5EX3 A;  4JZY A;  3CSF A;  2DCP A;  3D3M A;  2QZA A;  4APF A;  3L22 A;  3EUV A;  3KEZ A;  2DWZ A;  3BUA A;  4NUR A;  3ASG A;  4K5B A;  4BT9 A;  2OV8 A;  3L6A A;  2IF4 A;  4HOR A;  3SBT B;  4UWH A;  4F3V A;  3SI5 A;  1TEZ A;  3C98 A;  4TXQ A;  1OUV A;  3IKO B;  3O4Z A;  2KC7 A;  3ASD A;  3OXF A;  3Q75 A;  3NF1 A;  2XEN A;  3CVQ A;  1NA0 A;  4HBD A;  3DRA A;  3IHV A;  5G2N A;  3I4R B;  2DVW A;  1OWO A;  1V55 E;  4M3O A;  3X2Q E;  5LX8 A;  2GRL A;  3HHM A;  3E33 A;  2QFC A;  5EID A;  4DI3 A;  2V5F A;  2ZGG A;  3ZEF A;  3S7D A;  3TG5 A;  4I6G A;  2IJG X;  3EHR A;  5KCM A;  2NSZ A;  2EIM E;  1MJ0 A;  2KZT B;  5BW8 C;  4Y6W A;  5LP0 A;  2QC9 A;  3FU5 A;  3I3N A;  1SZA A;  1H2U A;  5A23 A;  1WDY A;  1OT8 A;  4HS2 A;  4AJW A;  3LS8 A;  2WXR A;  5FQ8 A;  5C1D A;  4IUL A;  2WVI A;  1MX2 A;  4G8K A;  4KZ0 A;  1JWG A;  3ONK A;  5A6C A;  2PZI A;  4V3I A;  2PM6 A;  1IXV A;  4U8H A;  1ELK A;  5EKQ D;  3C5R A;  5FQ4 A;  4HRL A;  4GCN A;  1MYO A;  4GMJ A;  5ENQ D;  3D9H A;  3SFX A;  4AXH A;  4HRN A;  3B7B A;  2F8X K;  2NYJ A;  1Z5S C;  4YVO A;  5BNW A;  4DX2 A;  3VLD A;  3UMV A;  1K1B A;  3I5P A;  5BV1 A;  2A5U A;  2C0L A;  3SD5 A;  2LSU A;  1H19 A;  5T3R A;  3NZS A;  5AQ7 A;  3TWV A;  3IBE A;  4BSX A;  4PS8 A;  4A63 B;  1EPU A;  5E76 A;  2L6J A;  3CHM A;  3ESK A;  4A3V A;  3AS5 A;  2AWI A;  3GYZ A;  1ZB1 A;  3CVL A;  4XI9 A;  1D8D A;  4LNU D;  3PEV B;  2ION A;  1IQR A;  4AEZ C;  3ML8 A;  3L08 A;  1E8X A;  2WM9 A;  4GPM A;  1O1R A;  4ABN A;  4U96 D;  5EDS A;  4UWK A;  3PRZ A;  3FFL A;  4FLH A;  4K5A B;  1LD8 A;  3RK6 A;  4KBQ A;  3AU5 A;  3TWU A;  1A5E A;  4BY6 A;  3CQG B;  1HG2 A;  2V4L A;  2EIJ E;  3MKR A;  4WND A;  3RO2 A;  3HRA A;  4OAV B;  2XEH A;  3I4G A;  1K3Z D;  1KZO A;  5EYP F;  5EIL A;  3MEK A;  1UJJ A;  5CCM A;  3ISM C;  1Y8M A;  5JJ7 A;  1N11 A;  2BTD A;  3LKU A;  3U4T A;  3CV0 A;  4GZD A;  2LXL A;  1TYQ G;  3OXG A;  3PZ3 A;  4ILG A;  4RSY A;  1UN8 A;  2P9N G;  1W3B A;  3LY8 A;  3ZYL A;  2V8S E;  4BET A;  5CEC B;  4C9B B;  4PH4 B;  3JUI A;  5EYL A;  4FHK A;  4ANU A;  3C3O A;  2YNQ A;  5ENO D;  1S63 A;  3ZVV A;  1GW6 A;  3RJV A;  5KJM A;  5CBO A;  4YDY A;  4H7X A;  1SA5 A;  4I2Z A;  3C3Q A;  2VGX A;  1H2V C;  3UIO C;  4I17 A;  4EZK A;  2VGE A;  3MX3 A;  3ZHE B;  4L2Y A;  4DRX E;  5JA4 D;  4B89 A;  3DSV A;  2IOL A;  3MKQ A;  4XKC A;  3BQO A;  1JCR A;  4JXT A;  5BXU A;  3UM3 A;  3APF A;  4J0U A;  4RLY A;  3T8K A;  3Q7A A;  1KPS B;  2GRR B;  5KJN A;  2WXM A;  2DZO A;  3TXN A;  4N5C A;  3J5P A;  5HRY A;  3LY9 A;  5ARF A;  2WXJ A;  2XPY A;  1N9A A;  2I1K A;  4A55 A;  4JW1 A;  4K03 A;  4GYW A;  3CVW A;  5IY5 E;  5FIN A;  2L9B A;  4DX5 D;  5AJD A;  1AWC B;  3C3R A;  2M63 A;  4HQD A;  2PM7 A;  3ABK E;  3CHR A;  3PUJ A;  2WXO A;  3ZW3 A;  1N94 A;  3DXK G;  2LAH A;  2E2E A;  2VTB A;  1OWM A;  4JL0 A;  4GTQ A;  4GZC A;  4W9R A;  2X6I A;  5BXO A;  2V4H C;  3K9I A;  3QJZ A;  3LXU X;  4Q69 A;  4I2W A;  3CKC A;  4UI9 K;  5KJK A;  5CCL A;  2PQR A;  1SVX A;  2Y4T A;  4I43 A;  1TNZ A;  2WXF A;  3DSX A;  4HI9 A;  3E34 A;  2JEK A;  3FUL A;  4ILI A;  4O6F A;  4F6R D;  5G55 A;  3ZU7 B;  3MGB A;  3URZ A;  4YND A;  4ATZ D;  4GZ5 A;  3IEG A;  2HM8 A;  3EJN A;  3HG0 D;  2VSY A;  5ENT D;  2RG8 A;  2WXK A;  2V5Q C;  4ANW A;  2JLB A;  5ENS D;  3Q15 A;  4U63 A;  1NFI E;  3UT8 A;  1HO8 A;  2DYS E;  2F8Y A;  3TXM A;  1WG0 A;  3PZ4 A;  4WNG A;  3QNK A;  4YDE A;  4HRM B;  5CED B;  4GTM A;  2AW6 A;  3DXM G;  3HVE B;  4UI9 J;  3FP3 A;  2A4Z A;  2EIN E;  1Z3X A;  3MA5 A;  2ETB A;  5KJL A;  4AY5 A;  5G04 C;  4K5C A;  4KVO A;  3MCX A;  3PH0 C;  1UJK A;  5CHE E;  3CQC B;  4XE0 A;  4APO A;  1ZU2 A;  1MX4 A;  1S70 B;  2R59 A;  5G05 J;  4HVB A;  3DBS A;  3RIB A;  4TXP A;  3ULE G;  3VLE A;  2F37 A;  1OCZ E;  3WG7 E;  2H6G A;  5G04 J;  4BER A;  1L5J A;  2UY1 A;  4UWL A;  2VJ8 A;  5FT9 A;  3RSE G;  5A7D B;  3NQP A;  3FY4 A;  5FZQ A;  4KYO B;  2EIL E;  1OXJ A;  4U04 A;  3LCA A;  1HFA A;  2VGY A;  4FLB A;  3D9K A;  2IY0 C;  3UM1 A;  4G23 A;  5FWQ A;  3QKY A;  1IHB A;  5FJY A;  1E8Y A;  4OVU A;  3E4B A;  2WXI A;  3IV0 A;  5B1B E;  2P9U G;  4MLP A;  3NOC D;  1N52 A;  3FTX A;  2J8S D;  3KD7 A;  1JPL A;  1PAQ A;  3TWR A;  1MQS A;  1TNB A;  1DNP A;  1TN7 A;  1ELW A;  1HG5 A;  1OWL A;  4GAA A;  4EBA A;  4GA1 A;  2OOE A;  3G2W A;  2OND A;  3ESL A;  3NZU A;  2KBX A;  3D9L A;  4Z68 A;  4RG9 A;  2OEW A;  2WXQ A;  1WAO 1;  1OY3 D;  1BI7 B;  3SBS A;  2Y69 E;  3QWV A;  4D10 C;  1N0R A;  3R9M A;  5AQ9 A;  3SO8 A;  1BLX B;  2WPV A;  1OWN A;  5DBK A;  2H6H A;  3CHS A;  3P1U A;  2XS8 A;  3FTW A;  3QAR A;  4LRZ A;  4CCA A;  3LVR E;  4GZ3 A;  5CEA A;  5T4Y A;  3HIZ A;  2L6B A;  2XQ0 A;  2KCK A;  4LEU A;  2QYJ A;  3DSU A;  1LD7 A;  4B8C B;  1H0A A;  4J8Y A;  1TNO A;  2WMO A;  3DPY A;  4G11 A;  4G26 A;  5C2Y A;  5J90 A;  4IN3 B;  3TJP A;  1SQM A;  1HE8 A;  1NZN A;  3ZNG A;  1DC2 A;  3DPD A;  1X5B A;  3T9K A;  4UWG A;  1QBQ A;  2MHK A;  2WXP A;  1NI1 A;  4OAU C;  1LF8 A;  3BU8 A;  1Z3Y A;  3GZ1 A;  1ZBP A;  4B0Z A;  3ML9 A;  4U0U A;  3HDX A;  1AP7 A;  4A1G A;  3PNT B;  3CHO A;  2ILR A;  2R5S A;  2VSO E;  4CDN A;  2J9Q A;  4CT0 A;  2Y4U A;  1OCR E;  2XZD G;  1U2V G;  1IYG A;  3SFZ A;  4N39 A;  4B93 B;  2CHW A;  2AXU A;  3S2A A;  3V31 A;  3TWW A;  3NOG D;  4Q96 A;  1JCS A;  1D8E A;  2ZIS A;  4TUU A;  4HFG A;  4J8D A;  4J8F A;  3V2O A;  4KVM A;  4L2L A;  2WQ7 A;  3FUD A;  1H6P A;  4N3A A;  2HE0 A;  2JAB A;  4FAD A;  3DEO A;  5ANR A;  4LCT A;  2Y3A A;  3UI2 A;  2FBN A;  3EHQ A;  2XGM A;  4U8Y D;  4E85 A;  2VGX B;  3EIQ C;  3MZL B;  3APD A;  1N95 A;  3UT4 A;  1E96 B;  2HR2 A;  5FZS A;  3W9G A;  3ASF A;  4BTA A;  3L17 A;  4U0Z A;  4JHJ A;  3T8M A;  4HLE A;  1E7V A;  3JQ0 A;  2XGO A;  3B95 A;  3MV2 B;  5AQA A;  4MBG A;  3AAA C;  3OTN A;  4GTS A;  3TWX A;  1FT1 A;  5BPP A;  5KBA A;  3G2U A;  4L9P A;  2P9I G;  3F6Q A;  2MYO A;  3L54 A;  4FUL A;  3UM2 A;  2R17 C;  2XCC A;  1S64 A;  2XGS A;  1HX8 A;  4KMO A;  4J8S A;  2XS1 A;  1UW4 B;  4CRW A;  3UKU G;  4CZ2 D;  1YYH A;  1TNU A;  2FI7 A;  2B6C A;  5AAR A;  3N71 A;  5D0Q D;  4OYS A;  3FTY A;  4BT8 A;  2R02 A;  4I9C A;  4NIK A;  3QB2 A;  4IRU A;  4TUM A;  3HVE A;  3PE3 A;  3GZS A;  4FP7 A;  1OCO E;  2WQ6 A;  4LNB A;  4ANV A;  2WXN A;  4WWN A;  3SGH A;  4PS7 A;  2UY1 B;  3R7R A;  3RRU A;  3JQ1 A;  4PDX A;  2IEJ A;  3SZ7 A;  4OVV A;  2IO2 C;  5AIJ A;  1WY6 A;  5ITZ F;  5ENP D;  3CVU A;  1FPP A;  4JEU A;  2KCV A;  1BU9 A;  3LY7 A;  3P2B A;  1D9S A;  5JJT A;  2A5E A;  4YVQ C;  4I1M A;  4L23 A;  1LTX A;  4R7L A;  1BPO A;  4PS3 A;  3JCK C;  3L13 A;  3CGH A;  5G05 C;  2VYI A;  4A1S A;  1QQE A;  2IU1 A;  1MX6 A;  3Q79 A;  1NL4 A;  4JEH A;  5AAO A;  5M72 A;  3SNX A;  2J4D A;  4C0M A;  4X8Q A;  4FHJ A;  1XGW A;  4AIF A;  3LDZ A;  4NQ0 A;  2NC9 A;  4I6E A;  4BX8 A;  2OEV A;  2ETA A;  3Q7F A;  5HKP A;  4GCO A;  3HXB A;  4XX5 A;  2AXV A;  3FUE A;  2BED A;  2GRO B;  4K0R A;  2HYZ A;  2IOS A;  4J8E A;  1NA3 A;  3GW4 A;  2ZIR A;  4L7T A;  4HOQ A;  1JUQ A;  2P9S G;  4GTT A;  4LSZ E;  3D9O A;  4GYY A;  4AOF A;  1UOH A;  3Q49 B;  4FA6 A;  4G25 A;  2UWJ G;  2CG2 A;  3S7J A;  5J08 A;  2OVB A;  5AN8 A;  2PNN A;  3AG2 E;  5KNG A;  3AG4 E;  2WMN A;  4N5Q A;  3CHQ A;  1BD8 A;  3AG1 E;  3RRN B;  3EHM A;  4J7W A;  1N0Q A;  2P9K G;  4O60 A;  1U3C A;  3QWW A;  4F1P A;  5EIB E;  3AU4 A;  4WNF A;  3OAW A;  5BUZ A;  3HXE A;  3DEP A;  1RW2 A;  4MKT A;  3DST A;  3RU0 A;  2LUH A;  3RO3 A;  3CEQ A;  3QC1 A;  1E8Z A;  4U95 D;  1NP7 A;  2J08 A;  2WXH A;  1YMP A;  5FZR A;  2BKK B;  1DCE A;  4N2Q A;  2WXG A;  4UQX A;  2L0I A;  1IKN D;  4HOT A;  3ASO E;  5LCW J;  4YDW A;  4DLQ A;  2DYR E;  3UUX A;  2ZGD A;  4Y6C A;  1FVH A;  3KEA A;  1BI8 B;  4GTP A;  4MS6 A;  2J4B A;  4JD2 G;  4L1B A;  4RQI A;  1Z6T A;  3UPV A;  3BG1 B;  2EIK E;  4ZHB A;  2P9P G;  4DX1 A;  1UN9 A;  4G24 A;  3IHY A;  4CEM A;  2XEE A;  4FU3 A;  2X6H A;  2CFZ A;  3ABL E;  3TWQ A;  4UUC A;  4RG6 A;  3ABM E;  3HYM B;  3ULY A;  5HQ8 A;  2J49 A;  2X38 A;  2HO1 A;  3L9T A;  4FJY A;  3UIP C;  4WWO A;  5FQ6 A;  5LFA A;  2L0T B;  1N4R A;  4XIF A;  2R05 A;  1E7U A;  2OVF A;  4LER A;  4JA9 A;  3QDN A;  5AQB A;  3SFY A;  3ZN3 A;  4G2V A;  1A17 A;  2R2L A;  2LXM A;  4AM9 A;  4HOU A;  1N54 A;  1SA4 A;  4ATG A;  3CST A;  1HF8 A;  3DSW A;  1XNF A;  3EU9 A;  3R7Q A;  2WXL A;  1EF1 C;  3B7T A;  5CMY A;  1Q2Z A;  4U0S A;  4F53 A;  2LAI A;  3RAU A;  2KM4 A;  3UX4 A;  2C2L A;  3Q5M A;  3G2V A;  1FT2 A;  3PZD A;  4PUC A;  4F1S A;  2NXP A;  3PEU B;  1HH8 A;  4WWP A;  3PVL A;  4GTV A;  3PDN A;  3UM0 A;  1TR4 A;  3UTM A;  3FTS A;  3U9W A;  3Q9N C;  1TN8 A;  3TAX A;  2X6K A;  4RVB A;  4O1O A;  3FU6 A;  3AJI A;  3CK9 A;  3CHP A;  1YA0 A;  3CK7 A;  4XEI G;  1QYM A;  1KZP A;  4DK5 A;  2KCL A;  1OCC E;  1ELR A;  2RFM A;  1U3D A;  5CRU A;  4XI0 A;  3Q47 B;  4YDO A;  2I6H A;  2P2C P;  1O1T A;  3LJ3 A;  3SF4 A;  2FO1 E;  3KAE A;  3U66 A;  2FUL A;  3Q78 A;  2GGF A;  1Y6I A;  4URK A;  4GPK A;  3WXX A;  3FTV A;  3FU0 A;  3ZYK A;  4DLO A;  4GYO A;  1HU3 A;  3FUJ A;  3AS8 A;  3L16 A;  4GA2 A;  2CFU A;  2YIN A;  5T8I A;  4GU5 A;  4GA0 A;  3G2S A;  4KT6 B;  3CVX A;  1TJF A;  4I6J A;  5LCW C;  2V0P A;  4WNE A;  2GRN B;  3ZIM A;  4EZJ A;  4JPS A;  3ASH A;  4ACK A;  3HXC A;  3B7S A;  4U8V D;  3O48 A;  5B1A E;  4CT4 A;  5CMW A;  4BTB A;  2H6F A;  3PE4 A;  3ZGQ A;  2ZXW E;  4BWR A;  5D66 A;  3GZ2 A;  3ZXP A;  5EN5 D;  2FEZ A;  3EIJ A;  3FTZ A;  4FC8 A;  1QNF A;  4TRQ A;  5JJ6 A;  1H6O A;  4NRH B;  4B94 A;  1RZ4 A;  2XPZ A;  4QQI A;  2CG3 A;  4WAF A;  1INZ A;  5KWD A;  3ZYQ A;  4WUY A;  1V54 E;  1MHQ A;  3ZRH A;  2OCC E;  3FUI A;  4TXR A;  2F0Y A;  2CHZ A;  1X81 A;  3SQV A;  3D9N A;  2ZU6 B;  3PUK A;  3Q4A B;  2RD0 A;  1E90 A;  1TN6 A;  4HNA D;  3Q9U C;  2X6F A;  3CVN A;  4UQY A;  2B0O E;  2FO7 A;  5H7P A;  4I1A A;  4UQZ A;  3FWV A;  4N2S A;  4BES A;  3D9I A;  4A3T A;  4KZC A;  3APC A;  1KT1 A;  3MYV A;  4DI4 A;  3CIA A;  3ZHE A;  1N4S A;  3C72 A;  4EPZ A;  2P9L G;  3LYA A;  3KS2 A;  5JHA A;  4FJZ A;  4DX7 D;  2YQ8 A;  1WM5 A;  4CGV A;  1JCQ A;  3Q73 A;  2C0M A;  3B7U X;  1FCH A;  2IO3 C;  4I9E A;  5AJL A;  3KSL A;  4EQF A;  5ANL A;  3EU5 A;  2VSX E;  2RKK A;  3FHE A;  4MRU A;  3SHF A;  2IFU A;  2QY7 A;  1UG3 A;  5LOZ A;  3CR3 A;  3UT7 A;  4BSZ B;  2DIW A;  3FUF A;  3MV3 B;  2YHE A;  3NB2 A;  5DIZ A;  5AEN A;  3KSQ A;  4F7A A;  3PNL B;  3ZYM A;  1QZ2 A;  4ZFH A;  4LG6 A;  3UQ3 A;  3ENE A;  3FUK A;  3ZUV B;  2QYU A;  3TGO A;  2GRP B;  2DBA A;  2J07 A;  5BT1 A;  3CLJ A;  1YCS B;  1SW6 A;  3QAQ A;  5ENR D;  2WB2 A;  4TV3 A;  2BF0 X;  5D2M C;  1H2T C;  3ASN E;  1EDU A;  4LNG A;  4AVX A;  1IQU A;  3ULQ A;  1K1A A;  4C0E A;  3W9F A;  4B8A A;  3CVY A;  1DVP A;  4Q94 A;  1PC2 A;  2VQ2 A;  2CHX A;  2XCB A;  2GW1 A;  3ZFW A;  4GMR A;  3TL5 A;  3ONL A;  4DJA A;  2ETC A;  2XRY A;  3MJW A;  4JVS A;  4CYM D;  4DX6 D;  3BG0 B;  2LSV A;  2AXZ A;  4M7C A;  3UIN C;  3AS4 A;  2R03 A;  4JHR A;  3VTY A;  4CDM A;  3B13 A;  1H6K A;  3ZKJ A;  4EHM A;  3J5Q B;  3QWP A;  5D0O D;  2GRM A;  4H7Y A;  5ARG A;  1HS6 A;  1FVF A;  3PS6 A;  3NBN B;  4JA7 A;  2LNI A;  1E8W A;  2KZT A;  3IXE A;  3U64 A;  2XZT G;  5CBN A;  3JXI A;  3ZPJ A;  3T5V A;  3FEX A;  1PY1 A;  5FIO A;  2VTB B;  2KAT A;  1O5M A;  5CER B;  5CRV A;  4GML A;  4XKB A;  4GZ6 A;  1HXI A;  3QK0 A;  4HLL A;  1K8K G;  4ANX A;  3V79 K;  3FDH A;  2X3M A;  5E75 A;  3HXD A;  3PZ1 A;  1TNY A;  5HI7 A;  3PRE A;  3TG4 A;  4CDR A;  4U7E B;  2AVP A;  3UXG A;  2MRI A;  3LJN A;  5JHB A;  3V2X A;  3VLF A;  3JUE A;  4KXK B;  1OWP A;  2Q7F A;  3B7R L;  4P29 A;  2MOW A;  5KNH D;  3LEW A;  2Y1L E;  3D9M A;  4EBA G;  3FH7 A;  2XEV A;  2BKG A;  4G8L A;  2BUG A;  3E37 A;  3ZXS A;  3G2T A;  4JHK A;  1MZC A;  2LO6 A;  3RRM B;  3FUM A; 
#chains in the Genus database with same CATH homology
 2H6H A;  1FT2 A;  2ZIR A;  4GTP A;  4EHM A;  3HXC A;  1S63 A;  3E33 A;  3KSL A;  4GTT A;  4GTO A;  3EU5 A;  2H6F A;  1SA5 A;  4GTV A;  4GTR A;  1N4Q A;  2H6G A;  4LNB A;  1TN8 A;  3DSU A;  1LD7 A;  1D8D A;  1TNZ A;  1TNO A;  3DPY A;  2IEJ A;  2H6I A;  3E30 A;  1N95 A;  3DSX A;  3DSV A;  3E34 A;  3KSQ A;  3E32 A;  1O1R A;  3PZ2 A;  1FPP A;  1JCR A;  1O5M A;  1KZP A;  3Q7A A;  1LD8 A;  1QBQ A;  2F0Y A;  1LTX A;  1X81 A;  1N4R A;  1NI1 A;  3HXE A;  1TN6 A;  4YDO A;  4MBG A;  3HXD A;  1O1T A;  3PZ1 A;  1TNY A;  1N9A A;  3DST A;  3EUV A;  4GTS A;  1FT1 A;  3Q78 A;  1TNB A;  4LNG A;  1TN7 A;  3Q79 A;  1NL4 A;  3SFY A;  3SFX A;  1KZO A;  4L9P A;  3PZ4 A;  2R2L A;  1O1S A;  1SA4 A;  3HXF A;  4YDE A;  4GTM A;  1S64 A;  3DSW A;  1DCE A;  3Q7F A;  3HXB A;  1N4S A;  3C72 A;  1N4P A;  3PZ3 A;  1N94 A;  3Q75 A;  3E37 A;  1JCS A;  3DSS A;  1D8E A;  2ZIS A;  3DRA A;  4GTQ A;  2BED A;  1MZC A;  1TNU A;  1JCQ A;  3Q73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...