1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
molecule keywords PROTEIN FARNESYLTRANSFERASE
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
1O1SA 1N4PA 3PZ1A 2R2LA 1TNYA 1O5MA 2H6FA 1QBQA 2IEJA 4GTQA 4EHMA 1SA4A 4GTVA 3HXBA 4LNGA 4GTMA 3SFXA 1MZCA 1JCQA 1N9AA 1KZOA 1FT2A 1FPPA 1TNBA 3E30A 1NI1A 1D8DA 1TN8A 3HXFA 3Q73A 4GTOA 1DCEA 4MBGA 4GTPA 1N4QA 1LTXA 1N95A 1D8EA 1N4RA 1S63A 4L9PA 3HXEA 1N94A 3HXDA 1NL4A 1N4SA 3DSVA 3PZ4A 3E37A 3PZ3A 4YDEA 1JCSA 3C72A 3DSUA 4LNBA 2H6IA 4GTSA 1O1TA 2H6HA 1TNUA 3DSXA 3DRAA 1LD8A 3E33A 3Q75A 3KSLA 2H6GA 1KZPA 3SFYA 4GTTA 3DSWA 3HXCA 1TN6A 3PZ2A 3Q7AA 1FT1A 2BEDA 3E32A 3EU5A 1O1RA 2F0YA 3Q78A 1JCRA 4GTRA 1S64A 1TN7A 4YDOA 2ZIRA 3Q7FA 3E34A 1TNOA 1X81A 3EUVA 3Q79A 2ZISA 3DSTA 3KSQA 1TNZA 3DPYA 1SA5A 3DSSA 1LD7A
chains in the Genus database with same CATH superfamily
1SW6A 3LPZA 4CT4A 1BI7B 2Y1LE 2P58C 1TNYA 2VSYA 1MX2A 3T9KA 1QBQA 1E7UA 1SA4A 1Z5SC 5ARFA 1JCQA 3KD7A 4G24A 4PDXA 3SO8A 4I9CA 5C2YA 1E8ZA 1HO8A 4BFRA 4FU3A 4C48B 2LSUA 1DNPA 3JCKC 1OWNA 5AQBA 4JA7A 2E2EA 1N94A 1NL4A 1VDYA 5KCMA 3APFA 4NIKA 1V55E 3PZ3A 2LSVA 3UPVA 2I2OA 3ABME 2WXQA 2H6IA 3PZDA 4A1SA 3T5XA 3JUEA 2R17C 5J08A 4TUUA 4F7AA 3OTNA 3DSWA 3LY7A 4FP7A 3QWPA 4L23A 3CEQA 5FQ4A 1LF8A 3CIAA 3TGOA 1DC2A 1KPSB 2HE0A 1OCRE 2WQ7A 3IXEA 2X3MA 3LY8A 3ZIMA 1E90A 4BT9A 2ETAA 3ML8A 3Q9NC 2ZISA 4N5CA 3FUMA 3CK9A 3BUAA 2GGFA 3BU8A 2V0PA 3PEVB 4UUCA 5ANLA 2J49A 5AAOA 4GZDA 3C5RA 3L54A 4KBQA 4RG9A 5DBKA 1INZA 4RSYA 3GZSA 1E8YA 1N9AA 1N11A 2P9NG 4YDWA 3L17A 5LFAA 4J7WA 4JXTA 4XI0A 2WXPA 2ZGDA 3HDXA 5D2MC 3FY4A 4K03A 4M7CA 5AJLA 2P9UG 1NA3A 5A7DB 1HH8A 1KT1A 4BSZB 5BT1A 3ABKE 5E76A 4U7EB 2LUHA 2MYOA 5HQ8A 1AP7A 3CVPA 2IOLA 3N71A 3AJIA 3BG0B 5A6CA 4AY6A 1QYMA 4UWGA 3Q47B 2YHEA 4GCNA 2YHCA 3CSTA 3E32A 2XCCA 1O1RA 4F3VA 4KZCA 5FQ8A 5BNWA 4DJAA 4XZ4A 4JW1A 1MX4A 3FH8A 3IHYA 4U96D 3PUJA 5ENSD 3FFLA 2PM6A 3MV2B 3L13A 2P9SG 4MS6A 2VSOE 2L6JA 2BKGA 4OYSA 4APOA 1H2TC 3APCA 4RLYA 4AOFA 2EQXA 3ZUVB 3AG2E 2P9KG 5KBAA 4I1MA 2B0OE 1EYHA 1D8DA 1WDYA 4WWOA 1TN8A 1DCEA 1SZ9A 4JA9A 3RO3A 3CQCB 4I6EA 1SQMA 3TWXA 2VSXE 2I6HA 2IO3C 3PEUB 5EKQD 4AEZC 3PZ4A 4CT0A 3E37A 3X2QE 4K5AB 3D3MA 3CVNA 3CR3A 3T8MA 2H6HA 4I9EA 1N54A 4I2ZA 3BEEA 4WUYA 4RG6A 4CZ2D 3QK0A 4O1PA 1MQSA 3D9LA 3S7FA 4U0SA 2V8SE 3UM3A 2XHEA 3AS4A 4HLEA 1HU3A 1ZB1A 1FT1A 2V4LA 4YVQC 2WXFA 1K1AA 5LX8A 4BX9A 5G05J 2BF0X 2VGEA 4H7YA 3LEWA 3RK6A 5J90A 1S64A 2MOWA 3QNKA 3LVRE 1IHBA 4KVOA 2R03A 3E34A 4JC8A 4B0ZA 4EZLA 3PE4A 3TG5A 4N2SA 3KSQA 3ISMC 3PZ1A 4UQZA 3B7BA 3OXLA 2X6JA 4L7TA 2FF4A 2Y0BG 5FTPA 3CK7A 2KZTB 4JL0A 1IQRA 3KEAA 4JEUA 4XEIG 5EDSA 3QOUA 5EN5D 2OV8A 5EIDA 4HORA 2C2LA 3RO2A 5G2NA 4BY6A 1JPLA 5CBNA 3MCXA 5ANRA 3EDTB 2GROB 4MBGA 5ITZF 4F53A 3FU0A 1ELRA 5G04J 4KXKB 5FQ6A 1N4SA 3MKQA 3ZXSA 2XEEA 4NACA 3C72A 2AXUA 3DSUA 3ZFWA 2V4HC 4N5QA 4TV3A 3S7DA 3NOCD 1FCHA 3RJVA 4XKBA 1TNUA 3OXFA 3IEGA 3KSLA 5BXOA 1KZPA 4YDYA 3I5PA 1UN9A 5EYPF 2F8YA 2J8SD 3Q7AA 3L9TA 4MKTA 2Q7FA 3GZ1A 5FINA 5CHEE 3RRNB 2XPYA 2WB2A 3SD5A 4DK5A 3SFZA 4APFA 3NOGD 2JEKA 3SF4A 1TN7A 2RKKA 3D9IA 5G05C 3ZVVA 1K8KG 1X81A 3TWSA 5CECB 3AG1E 4EBAA 2JLBA 4UQYA 5AYWD 5EX3A 5ENNA 1E8XA 4LEUA 4JB8P 3C98A 5CMWA 5C1DA 4OAUC 2OVFA 3ML9A 1XNFA 4BTBA 4WNDA 5E75A 4GB9A 2LO6A 4G8KA 3E30A 2ILRA 3UMVA 3CQGB 1X5BA 4HRMB 3CKCA 2OEVA 5CMYA 3L16A 3CLJA 5FZRA 4LRZA 3NB2A 2MHKA 4ZHBA 3U64A 5KJMA 1NA0A 4TXPA 3VTYA 3FUEA 2DYRE 4A63B 4IULA 4XX5A 3FULA 3JXJA 4XKCA 3J5PA 4JHRA 5AENA 1H2VC 1Z3XA 4CEMA 2H6GA 4N2QA 4FHKA 3ULYA 2V5QC 4IRUA 1TN6A 2KCVA 1IQUA 2C0MA 2EIKE 2JABA 2VGYA 3S2AA 1HS6A 3CVQA 4CGVA 5CCLA 4G25A 1N0RA 2GRNB 2DIWA 2WXGA 3Q7FA 2P9PG 4WNEA 3SY2A 4FULA 2QC9A 3FTUA 3UIPC 2ZU6B 1SA5A 4DX7D 1O1SA 3U3WA 2WMNA 3HRAA 4UI9J 2L6BA 3PS6A 4U0ZA 5HS0A 2ZGGA 3L08A 4CDMA 4J8FA 4E6HA 4HRNA 5AN8A 3R7QA 1EPUA 1TEZA 5FQ7A 3Q15A 2B6CA 3B13A 1N4RA 3UKUG 5AJDA 1H19A 4MLPA 3TL5A 2PQNA 3FTZA 3URZA 3CHRA 4BSXA 3R9MA 4B8CB 2RFAA 3FH7A 2C0LA 3APDA 4ZFHA 5CERB 4Q69A 1PY1A 2GRMA 5T3RA 4GYYA 3U4TA 3U66A 2BKKB 4LCTA 3D9NA 5T4YA 5JJTA 3PE3A 4KT6B 5B3SE 3DXKG 5LOZA 5AARA 4OVVA 3S7BA 4N39A 2PNNA 4I6GA 5AQAA 2XGSA 3ONKA 3ZNGA 2XPIA 3UX4A 4A3TA 2KCKA 3D9HA 3AS5A 2FO1E 2A4ZA 3SNXA 5BW8C 3GZ2A 3TAXA 4E85A 3MA5A 4AV7A 1OT8A 2PL2A 3GYZA 3CHQA 3SGHA 1UG3A 4EECA 3TWTA 3RAUA 3MYVA 3CVVA 1RW2A 4HLLA 4XI9A 4N3AA 4HB5A 5BUZA 3AU5A 1TJCA 2IOSA 4ILHB 1LTXA 4K5BA 1WY6A 3HXEA 1UW4B 4B8AA 2R5SA 1YYHA 4ILIA 2X6KA 3PUKA 1H2UA 2VYIA 5FJYA 3I3NA 4GA1A 3SQVA 3CSFA 3ZU7B 3DRAA 3HG0D 3ASNE 4B93B 4NURA 2AW6A 2CG2A 2YINA 3VLFA 2QY7A 1OWOA 1BU9A 1ZBPA 1Z3YA 4OAVB 4GCOA 5JHBA 2BUGA 3LKUA 3RRUA 2HM8A 4JD2G 1EDUA 4DRXE 2XS8A 4X8QA 1UOHA 2L9BA 3EUVA 3FTWA 2R05A 4G11A 5BV1A 3UM0A 3EIJA 3AU4A 3PNLB 4IN3B 3SZ7A 1OCZE 2X38A 4I17A 2LNIA 4N3BA 1SZAA 4GTQA 3CVWA 4GTVA 3LYAA 3HXBA 2DWZA 2PM7A 2KBXA 3LY9A 1DCQA 3FWVA 3LCAA 2PZIA 2HR2A 5ENRD 5BPPA 3QAQA 4J0UA 3UI2A 4LUNU 4HFGA 2GW1A 4FLBA 1N4QA 4GTPA 4RQIA 2LAHA 3LJ3A 2EILE 1HG5A 2LAIA 2XCBA 2CHZA 4AJWA 4A55A 3G2SA 4GTSA 1O1TA 4G1TA 1QZ2A 4M3OA 1Y6IA 4ABNA 4A3VA 4F1PA 4CRWA 3MV3B 3Q9UC 2QZAA 2IY0C 3ZYLA 5CEDB 2OOEA 3FTXA 4GPKA 3C3RA 3FU6A 4B94A 4Y6CA 3L82A 3CKBA 4GA0A 1IXVA 4G26A 1ELKA 3Q78A 2X6FA 1JCRA 5HI7A 3L6AA 4CCAA 4GTRA 3AAAC 3EHQA 4LERA 1N0QA 3TWQA 2DYSE 4FHJA 4CDRA 3CVYA 2ETCA 1MHQA 1LD7A 3CVUA 4JZYA 4CDNA 2H6FA 3IHVA 3W9GA 3ASGA 4LSZE 3K9IA 4C0EA 2XEVA 3EJNA 3DXMG 5FIOA 4LG6A 2KATA 1NI1A 3AG4E 2WXOA 3IV0A 1BD8A 4DUIA 1UJKA 1HFAA 4J8YA 4EZJA 4HOSA 5FZQA 4GYOA 2DBAA 1Z6TA 4F1SA 2IFUA 4HRLA 3CHPA 3ULQA 4L2YA 5EYLA 1S70B 4JEHA 4L2LA 4HS2A 3Q5MA 1QQEA 4HVBA 3O4ZA 4I1AA 1FVFA 2GRPB 3FEYA 4V3IA 3RSEG 4UWHA 3RKVA 3NBNB 2DCPA 3SBTB 2GRQB 4MRUA 4EPZA 4FADA 2UWJG 1Q2ZA 1V54E 1SVXA 2DVWA 1TR4A 3Q79A 4G2VA 4JHKA 2UY1B 3G2VA 1H6OA 3CVXA 1BI8B 2Y4TA 2NSZA 3LVQE 3VTXA 4F6RD 3FUJA 2P2CP 2WXMA 2CHWA 3CHMA 3ZEFA 3ZYKA 5ARGA 1MZCA 2XRZA 3ESLA 3P2BA 3I4GA 1OWLA 2I1KA 5KWDA 3LDZA 2VJ8A 3FHEA 2OCCE 3MKQB 2J4BA 3QWVA 1N95A 1D8EA 4U8HA 2IU1A 3I4RB 3UT8A 3HXDA 1EF1C 3OXGA 2QYJA 2WXNA 4XE0A 4U63A 1JCSA 1WAO1 2J09A 2WVIA 3BG1B 4FA6A 4Y6WA 2WXRA 4U95D 2J07A 3ESKA 3FU5A 4DLOA 1H0AA 3VLDA 1DVPA 3O48A 4KYOB 1Y8MA 4HOUA 1HF8A 4C0MA 2QFCA 4UI9K 5BV0A 3ASFA 4HOQA 4U0UA 4FJYA 4DLQA 4J8EA 1E7VA 4KVMA 4GZ5A 2EINE 5G55A 3DPYA 3PVLA 4KZ0A 4Q94A 3L22A 3D9JA 4PS3A 5JJ7A 3CVLA 4J8SA 2XZTG 5JHAA 4HOTA 3PNTB 3QC1A 4EHMA 3CHSA 3NAWA 5LP0A 3AG3E 3B95A 2IO2C 2RFMA 4IYPA 1AWCB 4G8LA 4JPSA 3ZYQA 4BWRA 3LXUX 3G2UA 4CGWA 5D66A 1OXJA 2V5FA 3ENEA 3QB2A 4GTOA 3S7JA 3KS2A 4TXQA 1OCOE 4K5CA 2F37A 2KC7A 1IKND 4PS8A 3MX3A 5ENPD 3TG4A 5B1BE 5LCWC 2R02A 3FEXA 4U07A 3UIOC 3DBSA 2RD0A 1UJJA 3CHOA 4XIFA 5G04C 1QNFA 1L5JA 3EIQC 3LS8A 4Q96A 3FUFA 4ANUA 4R7LA 3QDNA 4I1OB 1OUVA 3FDHA 3FU3A 3ZRHA 3V2OA 2WXIA 3EHMA 3ZKJA 3TWUA 4AIFA 4UWLA 3ZW3A 3TWWA 3FUIA 4BEPA 4Z68A 4ANXA 2XZDG 3IBEA 2WXKA 2CHXA 4A1GA 3UKRG 2XQ0A 3FUHA 5KJKA 3DSSA 2FEZA 2IJGX 5B1AE 4HI9A 1E96B 3TJPA 2MRIA 3U9WA 2XPZA 3W9FA 3SFXA 4J6IA 4GMJA 3B7SA 3G2WA 4I2WA 1PC2A 4GAAA 2XS1A 3NQPA 4TXRA 4GA2A 4J8DA 4BETA 2IQCA 3IKOB 4G23A 3UT4A 5KNGA 2ETBA 1HXIA 4UI9C 4WWNA 4C9BB 4UQXA 1WG0A 3DWLG 4P29A 5CEAA 1OY3D 2NC9A 4FC8A 3FTYA 3HVEA 3SHFA 4ATGA 2EIJE 4U8VD 4FLHA 4U8YD 3Q75A 1FVHA 3LJNA 4GMLA 3SFYA 2A5UA 1NZNA 3PDNA 5JJ6A 5D0QD 1K1BA 2WPVA 2IF4A 1G3NB 1OWMA 4GU5A 3GW4A 3EU5A 5KJLA 3FTSA 1OWPA 5AIJA 3B7UX 3WXXA 5HKPA 4BERA 3ZYMA 2ZXWE 1WM5A 3UTMA 2M63A 5D0OD 1U2VG 5IY5E 5DIZA 2UY1A 1O5MA 3R7RA 4NRHB 2AXVA 3JXIA 4GTMA 4O60A 4TUMA 4HXIA 5LCWJ 2XGOA 3DEPA 3KEZA 1A17A 4QQIA 5ENTD 2Y3AA 4TRQA 1HG2A 4DPRA 1TJFA 2KZTA 3G2TA 3J5QB 3KAEA 3QJZA 4L9PA 3TWRA 4ACKA 1IYGA 3AS8A 4DX2A 2RG8A 5FZSA 2VGXB 1U3CA 2WXHA 3ZGQA 4YDEA 3PREA 4QFVA 1RZ4A 4LNBA 4H7XA 3UT7A 3DSXA 2P9LG 5HRYA 2YQ8A 4ANWA 2WMOA 3CGHA 3FUNA 3JQ1A 3ASDA 1IHGA 1OCCE 3ZHEA 4JHJA 2OEWA 1MJ0A 4O1OA 5JA4D 4EQFA 5M72A 4AM9A 4ANVA 3UQ3A 3EHNA 3SI5A 2XRYA 4YNDA 2CG3A 3E4BA 2VTBA 2AWIA 1JUQA 2Y69E 2CFZA 3V31A 3TXNA 4GYWA 4GZ3A 3MEKA 2NXPA 3QARA 3V30A 1N4PA 3NZUA 3CK8A 1W3BA 2R2LA 3MGBA 4L1BA 4ACLA 2QYUA 2AXZA 3JQ0A 2OVBA 4KMOA 5ENOD 3ULEG 1PAQA 1YCSB 5CCMA 1FT2A 3UM2A 4CYMD 4BX8A 4I43A 3RU0A 4WNFA 1NP7A 4HNAD 3V79K 4RVBA 3FH5A 3UUXA 2E0IA 2HYZA 2LXMA 4BESA 4DX6D 4JVSA 3DSVA 4UWFA 1YMPA 2KXPC 2LXLA 2AVPA 5BXUA 4GZ6A 4FJZA 5EIBE 2VGXA 3HVEB 1TYQG 2VQ2A 2X6IA 3HYMB 1ZU2A 3P1UA 1HZ4A 2FI7A 4GTTA 3HXCA 3NF1A 3PZ2A 2BTDA 3RRMB 3FUDA 3T5VA 3FP3A 3C3QA 2Y4UA 3ZN3A 4PS7A 2CFUA 3NZSA 3PH0C 2VSNA 3CV0A 4YDOA 1MYOA 4WNGA 1HE8A 2ZIRA 3DEOA 2GRRB 2A5EA 1TNOA 2HO1A 5JMND 3ONLA 1MX6A 2I9CA 5KJNA 4GZCA 2GRLA 3JYSA 1YA0A 4U04A 3ZXPA 4K0RA 4PUCA 3F6QA 3HHMA 4OVUA 3B7TA 1U3DA 2YNQA 3D9PA 1BLXB 4ILGA 4DI4A 4LNGA 3ZPJA 1K3ZD 3V2XA 3VLEA 1KZOA 5KNHD 3Q4AB 3TWVA 1S0PA 3UM1A 2ONDA 3WG7E 1TNBA 4AXHA 1NFIE 2L0IA 1ELWA 2WXLA 3Q73A 4I6JA 2EIME 1D9SA 2J9QA 3FUKA 3QKYA 3MJWA 3TXMA 1A5EA 3ASHA 4W9RA 4EZKA 3ABLE 4AVXA 1JWGA 2DZOA 2F8XK 2WM9A 3ASOE 2P9IG 1LD8A 3E33A 3OAWA 3D9KA 4HI8A 3D9OA 1XGWA 1H6PA 4NQ0A 5CRUA 3PRZA 1KLXA 3Q49B 2XEHA 3ZHEB 2XGMA 3C3OA 5CRVA 5T8IA 4URKA 2F0YA 4N3CA 1B89A 1HX8A 1JWFA 2FO7A 2NYJA 4ME2A 3JUIA 4D10C 3EU9A 2FULA 3MKRA 4HBDA 4WWPA 3T8KA 4GPMA 3BQOA 3QWWA 5H7PA 2FBNA 5FT9A 3HIZA 2L0TB 5FWQA 2IEJA 4BT8A 4PH4B 1BPOA 2DZNA 2J4DA 1FPPA 3FTVA 4LNUD 2KM4A 3HXFA 4AP2A 5AQ7A 5EX0A 4UWKA 1S63A 3RIBA 2PQRA 3MZLB 4GMRA 4WAFA 4DX5D 3DPDA 5CBOA 2AJAA 2WQHA 5AQ9A 3R9AB 4O6FA 1GW6A 2R59A 3SBSA 5ENQD 1H6KA 3UINC 4AY5A 2J08A 3EHRA 5A23A 1N52A 2WXJA 1KT0A 2BEDA 4EBAG 5EILA 3UXGA 3D9MA 4ATZD 2WQ6A 1P5QA 2VTBB 4YVOA 4B89A 1E8WA 4DX1A 2KCLA 2XENA 2X6HA 2I1JA 4DI3A 2IONA 4HQDA 4BTAA 3DSTA 1TNZA 3B7RL 1UN8A
chains in the Genus database with same CATH topology
1O1SA 1N4PA 3PZ1A 2R2LA 1TNYA 1O5MA 2H6FA 1QBQA 2IEJA 4GTQA 4EHMA 1SA4A 4GTVA 3HXBA 4LNGA 4GTMA 3SFXA 1MZCA 1JCQA 1N9AA 1KZOA 1FT2A 1FPPA 1TNBA 3E30A 1NI1A 1D8DA 1TN8A 3HXFA 3Q73A 4GTOA 1DCEA 4MBGA 4GTPA 1N4QA 1LTXA 1N95A 1D8EA 1N4RA 1S63A 4L9PA 3HXEA 1N94A 3HXDA 1NL4A 1N4SA 3DSVA 3PZ4A 3E37A 3PZ3A 4YDEA 1JCSA 3C72A 3DSUA 4LNBA 2H6IA 4GTSA 1O1TA 2H6HA 1TNUA 3DSXA 3DRAA 1LD8A 3E33A 3Q75A 3KSLA 2H6GA 1KZPA 3SFYA 4GTTA 3DSWA 3HXCA 1TN6A 3PZ2A 3Q7AA 1FT1A 2BEDA 3E32A 3EU5A 1O1RA 2F0YA 3Q78A 1JCRA 4GTRA 1S64A 1TN7A 4YDOA 2ZIRA 3Q7FA 3E34A 1TNOA 1X81A 3EUVA 3Q79A 2ZISA 3DSTA 3KSQA 1TNZA 3DPYA 1SA5A 3DSSA 1LD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1S A;  1N4P A;  3PZ1 A;  2R2L A;  1TNY A;  1O5M A;  2H6F A;  1QBQ A;  2IEJ A;  4GTQ A;  4EHM A;  1SA4 A;  4GTV A;  3HXB A;  4LNG A;  4GTM A;  3SFX A;  1MZC A;  1JCQ A;  1N9A A;  1KZO A;  1FT2 A;  1FPP A;  1TNB A;  3E30 A;  1NI1 A;  1D8D A;  1TN8 A;  3HXF A;  3Q73 A;  4GTO A;  1DCE A;  4MBG A;  4GTP A;  1N4Q A;  1LTX A;  1N95 A;  1D8E A;  1N4R A;  1S63 A;  4L9P A;  3HXE A;  1N94 A;  3HXD A;  1NL4 A;  1N4S A;  3DSV A;  3PZ4 A;  3E37 A;  3PZ3 A;  4YDE A;  1JCS A;  3C72 A;  3DSU A;  4LNB A;  2H6I A;  4GTS A;  1O1T A;  2H6H A;  1TNU A;  3DSX A;  3DRA A;  1LD8 A;  3E33 A;  3Q75 A;  3KSL A;  2H6G A;  1KZP A;  3SFY A;  4GTT A;  3DSW A;  3HXC A;  1TN6 A;  3PZ2 A;  3Q7A A;  1FT1 A;  2BED A;  3E32 A;  3EU5 A;  1O1R A;  2F0Y A;  3Q78 A;  1JCR A;  4GTR A;  1S64 A;  1TN7 A;  4YDO A;  2ZIR A;  3Q7F A;  3E34 A;  1TNO A;  1X81 A;  3EUV A;  3Q79 A;  2ZIS A;  3DST A;  3KSQ A;  1TNZ A;  3DPY A;  1SA5 A;  3DSS A;  1LD7 A; 
#chains in the Genus database with same CATH topology
 1SW6 A;  3LPZ A;  4CT4 A;  1BI7 B;  2Y1L E;  2P58 C;  1TNY A;  2VSY A;  1MX2 A;  3T9K A;  1QBQ A;  1E7U A;  1SA4 A;  1Z5S C;  5ARF A;  1JCQ A;  3KD7 A;  4G24 A;  4PDX A;  3SO8 A;  4I9C A;  5C2Y A;  1E8Z A;  1HO8 A;  4BFR A;  4FU3 A;  4C48 B;  2LSU A;  1DNP A;  3JCK C;  1OWN A;  5AQB A;  4JA7 A;  2E2E A;  1N94 A;  1NL4 A;  1VDY A;  5KCM A;  3APF A;  4NIK A;  1V55 E;  3PZ3 A;  2LSV A;  3UPV A;  2I2O A;  3ABM E;  2WXQ A;  2H6I A;  3PZD A;  4A1S A;  3T5X A;  3JUE A;  2R17 C;  5J08 A;  4TUU A;  4F7A A;  3OTN A;  3DSW A;  3LY7 A;  4FP7 A;  3QWP A;  4L23 A;  3CEQ A;  5FQ4 A;  1LF8 A;  3CIA A;  3TGO A;  1DC2 A;  1KPS B;  2HE0 A;  1OCR E;  2WQ7 A;  3IXE A;  2X3M A;  3LY8 A;  3ZIM A;  1E90 A;  4BT9 A;  2ETA A;  3ML8 A;  3Q9N C;  2ZIS A;  4N5C A;  3FUM A;  3CK9 A;  3BUA A;  2GGF A;  3BU8 A;  2V0P A;  3PEV B;  4UUC A;  5ANL A;  2J49 A;  5AAO A;  4GZD A;  3C5R A;  3L54 A;  4KBQ A;  4RG9 A;  5DBK A;  1INZ A;  4RSY A;  3GZS A;  1E8Y A;  1N9A A;  1N11 A;  2P9N G;  4YDW A;  3L17 A;  5LFA A;  4J7W A;  4JXT A;  4XI0 A;  2WXP A;  2ZGD A;  3HDX A;  5D2M C;  3FY4 A;  4K03 A;  4M7C A;  5AJL A;  2P9U G;  1NA3 A;  5A7D B;  1HH8 A;  1KT1 A;  4BSZ B;  5BT1 A;  3ABK E;  5E76 A;  4U7E B;  2LUH A;  2MYO A;  5HQ8 A;  1AP7 A;  3CVP A;  2IOL A;  3N71 A;  3AJI A;  3BG0 B;  5A6C A;  4AY6 A;  1QYM A;  4UWG A;  3Q47 B;  2YHE A;  4GCN A;  2YHC A;  3CST A;  3E32 A;  2XCC A;  1O1R A;  4F3V A;  4KZC A;  5FQ8 A;  5BNW A;  4DJA A;  4XZ4 A;  4JW1 A;  1MX4 A;  3FH8 A;  3IHY A;  4U96 D;  3PUJ A;  5ENS D;  3FFL A;  2PM6 A;  3MV2 B;  3L13 A;  2P9S G;  4MS6 A;  2VSO E;  2L6J A;  2BKG A;  4OYS A;  4APO A;  1H2T C;  3APC A;  4RLY A;  4AOF A;  2EQX A;  3ZUV B;  3AG2 E;  2P9K G;  5KBA A;  4I1M A;  2B0O E;  1EYH A;  1D8D A;  1WDY A;  4WWO A;  1TN8 A;  1DCE A;  1SZ9 A;  4JA9 A;  3RO3 A;  3CQC B;  4I6E A;  1SQM A;  3TWX A;  2VSX E;  2I6H A;  2IO3 C;  3PEU B;  5EKQ D;  4AEZ C;  3PZ4 A;  4CT0 A;  3E37 A;  3X2Q E;  4K5A B;  3D3M A;  3CVN A;  3CR3 A;  3T8M A;  2H6H A;  4I9E A;  1N54 A;  4I2Z A;  3BEE A;  4WUY A;  4RG6 A;  4CZ2 D;  3QK0 A;  4O1P A;  1MQS A;  3D9L A;  3S7F A;  4U0S A;  2V8S E;  3UM3 A;  2XHE A;  3AS4 A;  4HLE A;  1HU3 A;  1ZB1 A;  1FT1 A;  2V4L A;  4YVQ C;  2WXF A;  1K1A A;  5LX8 A;  4BX9 A;  5G05 J;  2BF0 X;  2VGE A;  4H7Y A;  3LEW A;  3RK6 A;  5J90 A;  1S64 A;  2MOW A;  3QNK A;  3LVR E;  1IHB A;  4KVO A;  2R03 A;  3E34 A;  4JC8 A;  4B0Z A;  4EZL A;  3PE4 A;  3TG5 A;  4N2S A;  3KSQ A;  3ISM C;  3PZ1 A;  4UQZ A;  3B7B A;  3OXL A;  2X6J A;  4L7T A;  2FF4 A;  2Y0B G;  5FTP A;  3CK7 A;  2KZT B;  4JL0 A;  1IQR A;  3KEA A;  4JEU A;  4XEI G;  5EDS A;  3QOU A;  5EN5 D;  2OV8 A;  5EID A;  4HOR A;  2C2L A;  3RO2 A;  5G2N A;  4BY6 A;  1JPL A;  5CBN A;  3MCX A;  5ANR A;  3EDT B;  2GRO B;  4MBG A;  5ITZ F;  4F53 A;  3FU0 A;  1ELR A;  5G04 J;  4KXK B;  5FQ6 A;  1N4S A;  3MKQ A;  3ZXS A;  2XEE A;  4NAC A;  3C72 A;  2AXU A;  3DSU A;  3ZFW A;  2V4H C;  4N5Q A;  4TV3 A;  3S7D A;  3NOC D;  1FCH A;  3RJV A;  4XKB A;  1TNU A;  3OXF A;  3IEG A;  3KSL A;  5BXO A;  1KZP A;  4YDY A;  3I5P A;  1UN9 A;  5EYP F;  2F8Y A;  2J8S D;  3Q7A A;  3L9T A;  4MKT A;  2Q7F A;  3GZ1 A;  5FIN A;  5CHE E;  3RRN B;  2XPY A;  2WB2 A;  3SD5 A;  4DK5 A;  3SFZ A;  4APF A;  3NOG D;  2JEK A;  3SF4 A;  1TN7 A;  2RKK A;  3D9I A;  5G05 C;  3ZVV A;  1K8K G;  1X81 A;  3TWS A;  5CEC B;  3AG1 E;  4EBA A;  2JLB A;  4UQY A;  5AYW D;  5EX3 A;  5ENN A;  1E8X A;  4LEU A;  4JB8 P;  3C98 A;  5CMW A;  5C1D A;  4OAU C;  2OVF A;  3ML9 A;  1XNF A;  4BTB A;  4WND A;  5E75 A;  4GB9 A;  2LO6 A;  4G8K A;  3E30 A;  2ILR A;  3UMV A;  3CQG B;  1X5B A;  4HRM B;  3CKC A;  2OEV A;  5CMY A;  3L16 A;  3CLJ A;  5FZR A;  4LRZ A;  3NB2 A;  2MHK A;  4ZHB A;  3U64 A;  5KJM A;  1NA0 A;  4TXP A;  3VTY A;  3FUE A;  2DYR E;  4A63 B;  4IUL A;  4XX5 A;  3FUL A;  3JXJ A;  4XKC A;  3J5P A;  4JHR A;  5AEN A;  1H2V C;  1Z3X A;  4CEM A;  2H6G A;  4N2Q A;  4FHK A;  3ULY A;  2V5Q C;  4IRU A;  1TN6 A;  2KCV A;  1IQU A;  2C0M A;  2EIK E;  2JAB A;  2VGY A;  3S2A A;  1HS6 A;  3CVQ A;  4CGV A;  5CCL A;  4G25 A;  1N0R A;  2GRN B;  2DIW A;  2WXG A;  3Q7F A;  2P9P G;  4WNE A;  3SY2 A;  4FUL A;  2QC9 A;  3FTU A;  3UIP C;  2ZU6 B;  1SA5 A;  4DX7 D;  1O1S A;  3U3W A;  2WMN A;  3HRA A;  4UI9 J;  2L6B A;  3PS6 A;  4U0Z A;  5HS0 A;  2ZGG A;  3L08 A;  4CDM A;  4J8F A;  4E6H A;  4HRN A;  5AN8 A;  3R7Q A;  1EPU A;  1TEZ A;  5FQ7 A;  3Q15 A;  2B6C A;  3B13 A;  1N4R A;  3UKU G;  5AJD A;  1H19 A;  4MLP A;  3TL5 A;  2PQN A;  3FTZ A;  3URZ A;  3CHR A;  4BSX A;  3R9M A;  4B8C B;  2RFA A;  3FH7 A;  2C0L A;  3APD A;  4ZFH A;  5CER B;  4Q69 A;  1PY1 A;  2GRM A;  5T3R A;  4GYY A;  3U4T A;  3U66 A;  2BKK B;  4LCT A;  3D9N A;  5T4Y A;  5JJT A;  3PE3 A;  4KT6 B;  5B3S E;  3DXK G;  5LOZ A;  5AAR A;  4OVV A;  3S7B A;  4N39 A;  2PNN A;  4I6G A;  5AQA A;  2XGS A;  3ONK A;  3ZNG A;  2XPI A;  3UX4 A;  4A3T A;  2KCK A;  3D9H A;  3AS5 A;  2FO1 E;  2A4Z A;  3SNX A;  5BW8 C;  3GZ2 A;  3TAX A;  4E85 A;  3MA5 A;  4AV7 A;  1OT8 A;  2PL2 A;  3GYZ A;  3CHQ A;  3SGH A;  1UG3 A;  4EEC A;  3TWT A;  3RAU A;  3MYV A;  3CVV A;  1RW2 A;  4HLL A;  4XI9 A;  4N3A A;  4HB5 A;  5BUZ A;  3AU5 A;  1TJC A;  2IOS A;  4ILH B;  1LTX A;  4K5B A;  1WY6 A;  3HXE A;  1UW4 B;  4B8A A;  2R5S A;  1YYH A;  4ILI A;  2X6K A;  3PUK A;  1H2U A;  2VYI A;  5FJY A;  3I3N A;  4GA1 A;  3SQV A;  3CSF A;  3ZU7 B;  3DRA A;  3HG0 D;  3ASN E;  4B93 B;  4NUR A;  2AW6 A;  2CG2 A;  2YIN A;  3VLF A;  2QY7 A;  1OWO A;  1BU9 A;  1ZBP A;  1Z3Y A;  4OAV B;  4GCO A;  5JHB A;  2BUG A;  3LKU A;  3RRU A;  2HM8 A;  4JD2 G;  1EDU A;  4DRX E;  2XS8 A;  4X8Q A;  1UOH A;  2L9B A;  3EUV A;  3FTW A;  2R05 A;  4G11 A;  5BV1 A;  3UM0 A;  3EIJ A;  3AU4 A;  3PNL B;  4IN3 B;  3SZ7 A;  1OCZ E;  2X38 A;  4I17 A;  2LNI A;  4N3B A;  1SZA A;  4GTQ A;  3CVW A;  4GTV A;  3LYA A;  3HXB A;  2DWZ A;  2PM7 A;  2KBX A;  3LY9 A;  1DCQ A;  3FWV A;  3LCA A;  2PZI A;  2HR2 A;  5ENR D;  5BPP A;  3QAQ A;  4J0U A;  3UI2 A;  4LUN U;  4HFG A;  2GW1 A;  4FLB A;  1N4Q A;  4GTP A;  4RQI A;  2LAH A;  3LJ3 A;  2EIL E;  1HG5 A;  2LAI A;  2XCB A;  2CHZ A;  4AJW A;  4A55 A;  3G2S A;  4GTS A;  1O1T A;  4G1T A;  1QZ2 A;  4M3O A;  1Y6I A;  4ABN A;  4A3V A;  4F1P A;  4CRW A;  3MV3 B;  3Q9U C;  2QZA A;  2IY0 C;  3ZYL A;  5CED B;  2OOE A;  3FTX A;  4GPK A;  3C3R A;  3FU6 A;  4B94 A;  4Y6C A;  3L82 A;  3CKB A;  4GA0 A;  1IXV A;  4G26 A;  1ELK A;  3Q78 A;  2X6F A;  1JCR A;  5HI7 A;  3L6A A;  4CCA A;  4GTR A;  3AAA C;  3EHQ A;  4LER A;  1N0Q A;  3TWQ A;  2DYS E;  4FHJ A;  4CDR A;  3CVY A;  2ETC A;  1MHQ A;  1LD7 A;  3CVU A;  4JZY A;  4CDN A;  2H6F A;  3IHV A;  3W9G A;  3ASG A;  4LSZ E;  3K9I A;  4C0E A;  2XEV A;  3EJN A;  3DXM G;  5FIO A;  4LG6 A;  2KAT A;  1NI1 A;  3AG4 E;  2WXO A;  3IV0 A;  1BD8 A;  4DUI A;  1UJK A;  1HFA A;  4J8Y A;  4EZJ A;  4HOS A;  5FZQ A;  4GYO A;  2DBA A;  1Z6T A;  4F1S A;  2IFU A;  4HRL A;  3CHP A;  3ULQ A;  4L2Y A;  5EYL A;  1S70 B;  4JEH A;  4L2L A;  4HS2 A;  3Q5M A;  1QQE A;  4HVB A;  3O4Z A;  4I1A A;  1FVF A;  2GRP B;  3FEY A;  4V3I A;  3RSE G;  4UWH A;  3RKV A;  3NBN B;  2DCP A;  3SBT B;  2GRQ B;  4MRU A;  4EPZ A;  4FAD A;  2UWJ G;  1Q2Z A;  1V54 E;  1SVX A;  2DVW A;  1TR4 A;  3Q79 A;  4G2V A;  4JHK A;  2UY1 B;  3G2V A;  1H6O A;  3CVX A;  1BI8 B;  2Y4T A;  2NSZ A;  3LVQ E;  3VTX A;  4F6R D;  3FUJ A;  2P2C P;  2WXM A;  2CHW A;  3CHM A;  3ZEF A;  3ZYK A;  5ARG A;  1MZC A;  2XRZ A;  3ESL A;  3P2B A;  3I4G A;  1OWL A;  2I1K A;  5KWD A;  3LDZ A;  2VJ8 A;  3FHE A;  2OCC E;  3MKQ B;  2J4B A;  3QWV A;  1N95 A;  1D8E A;  4U8H A;  2IU1 A;  3I4R B;  3UT8 A;  3HXD A;  1EF1 C;  3OXG A;  2QYJ A;  2WXN A;  4XE0 A;  4U63 A;  1JCS A;  1WAO 1;  2J09 A;  2WVI A;  3BG1 B;  4FA6 A;  4Y6W A;  2WXR A;  4U95 D;  2J07 A;  3ESK A;  3FU5 A;  4DLO A;  1H0A A;  3VLD A;  1DVP A;  3O48 A;  4KYO B;  1Y8M A;  4HOU A;  1HF8 A;  4C0M A;  2QFC A;  4UI9 K;  5BV0 A;  3ASF A;  4HOQ A;  4U0U A;  4FJY A;  4DLQ A;  4J8E A;  1E7V A;  4KVM A;  4GZ5 A;  2EIN E;  5G55 A;  3DPY A;  3PVL A;  4KZ0 A;  4Q94 A;  3L22 A;  3D9J A;  4PS3 A;  5JJ7 A;  3CVL A;  4J8S A;  2XZT G;  5JHA A;  4HOT A;  3PNT B;  3QC1 A;  4EHM A;  3CHS A;  3NAW A;  5LP0 A;  3AG3 E;  3B95 A;  2IO2 C;  2RFM A;  4IYP A;  1AWC B;  4G8L A;  4JPS A;  3ZYQ A;  4BWR A;  3LXU X;  3G2U A;  4CGW A;  5D66 A;  1OXJ A;  2V5F A;  3ENE A;  3QB2 A;  4GTO A;  3S7J A;  3KS2 A;  4TXQ A;  1OCO E;  4K5C A;  2F37 A;  2KC7 A;  1IKN D;  4PS8 A;  3MX3 A;  5ENP D;  3TG4 A;  5B1B E;  5LCW C;  2R02 A;  3FEX A;  4U07 A;  3UIO C;  3DBS A;  2RD0 A;  1UJJ A;  3CHO A;  4XIF A;  5G04 C;  1QNF A;  1L5J A;  3EIQ C;  3LS8 A;  4Q96 A;  3FUF A;  4ANU A;  4R7L A;  3QDN A;  4I1O B;  1OUV A;  3FDH A;  3FU3 A;  3ZRH A;  3V2O A;  2WXI A;  3EHM A;  3ZKJ A;  3TWU A;  4AIF A;  4UWL A;  3ZW3 A;  3TWW A;  3FUI A;  4BEP A;  4Z68 A;  4ANX A;  2XZD G;  3IBE A;  2WXK A;  2CHX A;  4A1G A;  3UKR G;  2XQ0 A;  3FUH A;  5KJK A;  3DSS A;  2FEZ A;  2IJG X;  5B1A E;  4HI9 A;  1E96 B;  3TJP A;  2MRI A;  3U9W A;  2XPZ A;  3W9F A;  3SFX A;  4J6I A;  4GMJ A;  3B7S A;  3G2W A;  4I2W A;  1PC2 A;  4GAA A;  2XS1 A;  3NQP A;  4TXR A;  4GA2 A;  4J8D A;  4BET A;  2IQC A;  3IKO B;  4G23 A;  3UT4 A;  5KNG A;  2ETB A;  1HXI A;  4UI9 C;  4WWN A;  4C9B B;  4UQX A;  1WG0 A;  3DWL G;  4P29 A;  5CEA A;  1OY3 D;  2NC9 A;  4FC8 A;  3FTY A;  3HVE A;  3SHF A;  4ATG A;  2EIJ E;  4U8V D;  4FLH A;  4U8Y D;  3Q75 A;  1FVH A;  3LJN A;  4GML A;  3SFY A;  2A5U A;  1NZN A;  3PDN A;  5JJ6 A;  5D0Q D;  1K1B A;  2WPV A;  2IF4 A;  1G3N B;  1OWM A;  4GU5 A;  3GW4 A;  3EU5 A;  5KJL A;  3FTS A;  1OWP A;  5AIJ A;  3B7U X;  3WXX A;  5HKP A;  4BER A;  3ZYM A;  2ZXW E;  1WM5 A;  3UTM A;  2M63 A;  5D0O D;  1U2V G;  5IY5 E;  5DIZ A;  2UY1 A;  1O5M A;  3R7R A;  4NRH B;  2AXV A;  3JXI A;  4GTM A;  4O60 A;  4TUM A;  4HXI A;  5LCW J;  2XGO A;  3DEP A;  3KEZ A;  1A17 A;  4QQI A;  5ENT D;  2Y3A A;  4TRQ A;  1HG2 A;  4DPR A;  1TJF A;  2KZT A;  3G2T A;  3J5Q B;  3KAE A;  3QJZ A;  4L9P A;  3TWR A;  4ACK A;  1IYG A;  3AS8 A;  4DX2 A;  2RG8 A;  5FZS A;  2VGX B;  1U3C A;  2WXH A;  3ZGQ A;  4YDE A;  3PRE A;  4QFV A;  1RZ4 A;  4LNB A;  4H7X A;  3UT7 A;  3DSX A;  2P9L G;  5HRY A;  2YQ8 A;  4ANW A;  2WMO A;  3CGH A;  3FUN A;  3JQ1 A;  3ASD A;  1IHG A;  1OCC E;  3ZHE A;  4JHJ A;  2OEW A;  1MJ0 A;  4O1O A;  5JA4 D;  4EQF A;  5M72 A;  4AM9 A;  4ANV A;  3UQ3 A;  3EHN A;  3SI5 A;  2XRY A;  4YND A;  2CG3 A;  3E4B A;  2VTB A;  2AWI A;  1JUQ A;  2Y69 E;  2CFZ A;  3V31 A;  3TXN A;  4GYW A;  4GZ3 A;  3MEK A;  2NXP A;  3QAR A;  3V30 A;  1N4P A;  3NZU A;  3CK8 A;  1W3B A;  2R2L A;  3MGB A;  4L1B A;  4ACL A;  2QYU A;  2AXZ A;  3JQ0 A;  2OVB A;  4KMO A;  5ENO D;  3ULE G;  1PAQ A;  1YCS B;  5CCM A;  1FT2 A;  3UM2 A;  4CYM D;  4BX8 A;  4I43 A;  3RU0 A;  4WNF A;  1NP7 A;  4HNA D;  3V79 K;  4RVB A;  3FH5 A;  3UUX A;  2E0I A;  2HYZ A;  2LXM A;  4BES A;  4DX6 D;  4JVS A;  3DSV A;  4UWF A;  1YMP A;  2KXP C;  2LXL A;  2AVP A;  5BXU A;  4GZ6 A;  4FJZ A;  5EIB E;  2VGX A;  3HVE B;  1TYQ G;  2VQ2 A;  2X6I A;  3HYM B;  1ZU2 A;  3P1U A;  1HZ4 A;  2FI7 A;  4GTT A;  3HXC A;  3NF1 A;  3PZ2 A;  2BTD A;  3RRM B;  3FUD A;  3T5V A;  3FP3 A;  3C3Q A;  2Y4U A;  3ZN3 A;  4PS7 A;  2CFU A;  3NZS A;  3PH0 C;  2VSN A;  3CV0 A;  4YDO A;  1MYO A;  4WNG A;  1HE8 A;  2ZIR A;  3DEO A;  2GRR B;  2A5E A;  1TNO A;  2HO1 A;  5JMN D;  3ONL A;  1MX6 A;  2I9C A;  5KJN A;  4GZC A;  2GRL A;  3JYS A;  1YA0 A;  4U04 A;  3ZXP A;  4K0R A;  4PUC A;  3F6Q A;  3HHM A;  4OVU A;  3B7T A;  1U3D A;  2YNQ A;  3D9P A;  1BLX B;  4ILG A;  4DI4 A;  4LNG A;  3ZPJ A;  1K3Z D;  3V2X A;  3VLE A;  1KZO A;  5KNH D;  3Q4A B;  3TWV A;  1S0P A;  3UM1 A;  2OND A;  3WG7 E;  1TNB A;  4AXH A;  1NFI E;  2L0I A;  1ELW A;  2WXL A;  3Q73 A;  4I6J A;  2EIM E;  1D9S A;  2J9Q A;  3FUK A;  3QKY A;  3MJW A;  3TXM A;  1A5E A;  3ASH A;  4W9R A;  4EZK A;  3ABL E;  4AVX A;  1JWG A;  2DZO A;  2F8X K;  2WM9 A;  3ASO E;  2P9I G;  1LD8 A;  3E33 A;  3OAW A;  3D9K A;  4HI8 A;  3D9O A;  1XGW A;  1H6P A;  4NQ0 A;  5CRU A;  3PRZ A;  1KLX A;  3Q49 B;  2XEH A;  3ZHE B;  2XGM A;  3C3O A;  5CRV A;  5T8I A;  4URK A;  2F0Y A;  4N3C A;  1B89 A;  1HX8 A;  1JWF A;  2FO7 A;  2NYJ A;  4ME2 A;  3JUI A;  4D10 C;  3EU9 A;  2FUL A;  3MKR A;  4HBD A;  4WWP A;  3T8K A;  4GPM A;  3BQO A;  3QWW A;  5H7P A;  2FBN A;  5FT9 A;  3HIZ A;  2L0T B;  5FWQ A;  2IEJ A;  4BT8 A;  4PH4 B;  1BPO A;  2DZN A;  2J4D A;  1FPP A;  3FTV A;  4LNU D;  2KM4 A;  3HXF A;  4AP2 A;  5AQ7 A;  5EX0 A;  4UWK A;  1S63 A;  3RIB A;  2PQR A;  3MZL B;  4GMR A;  4WAF A;  4DX5 D;  3DPD A;  5CBO A;  2AJA A;  2WQH A;  5AQ9 A;  3R9A B;  4O6F A;  1GW6 A;  2R59 A;  3SBS A;  5ENQ D;  1H6K A;  3UIN C;  4AY5 A;  2J08 A;  3EHR A;  5A23 A;  1N52 A;  2WXJ A;  1KT0 A;  2BED A;  4EBA G;  5EIL A;  3UXG A;  3D9M A;  4ATZ D;  2WQ6 A;  1P5Q A;  2VTB B;  4YVO A;  4B89 A;  1E8W A;  4DX1 A;  2KCL A;  2XEN A;  2X6H A;  2I1J A;  4DI3 A;  2ION A;  4HQD A;  4BTA A;  3DST A;  1TNZ A;  3B7R L;  1UN8 A; 
#chains in the Genus database with same CATH homology
 1O1S A;  1N4P A;  3PZ1 A;  2R2L A;  1TNY A;  1O5M A;  2H6F A;  1QBQ A;  2IEJ A;  4GTQ A;  4EHM A;  1SA4 A;  4GTV A;  3HXB A;  4LNG A;  4GTM A;  3SFX A;  1MZC A;  1JCQ A;  1N9A A;  1KZO A;  1FT2 A;  1FPP A;  1TNB A;  3E30 A;  1NI1 A;  1D8D A;  1TN8 A;  3HXF A;  3Q73 A;  4GTO A;  1DCE A;  4MBG A;  4GTP A;  1N4Q A;  1LTX A;  1N95 A;  1D8E A;  1N4R A;  1S63 A;  4L9P A;  3HXE A;  1N94 A;  3HXD A;  1NL4 A;  1N4S A;  3DSV A;  3PZ4 A;  3E37 A;  3PZ3 A;  4YDE A;  1JCS A;  3C72 A;  3DSU A;  4LNB A;  2H6I A;  4GTS A;  1O1T A;  2H6H A;  1TNU A;  3DSX A;  3DRA A;  1LD8 A;  3E33 A;  3Q75 A;  3KSL A;  2H6G A;  1KZP A;  3SFY A;  4GTT A;  3DSW A;  3HXC A;  1TN6 A;  3PZ2 A;  3Q7A A;  1FT1 A;  2BED A;  3E32 A;  3EU5 A;  1O1R A;  2F0Y A;  3Q78 A;  1JCR A;  4GTR A;  1S64 A;  1TN7 A;  4YDO A;  2ZIR A;  3Q7F A;  3E34 A;  1TNO A;  1X81 A;  3EUV A;  3Q79 A;  2ZIS A;  3DST A;  3KSQ A;  1TNZ A;  3DPY A;  1SA5 A;  3DSS A;  1LD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...