1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
molecule keywords PROTEIN FARNESYLTRANSFERASE
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
1TNBA 3E33A 3E34A 1JCSA 1S63A 1N4SA 1O1TA 1TNYA 4GTPA 4GTMA 1O5MA 4GTSA 1N94A 3PZ2A 2ZISA 1KZOA 1FPPA 1N4QA 2F0YA 3SFYA 2H6IA 1TNOA 3Q7AA 3Q75A 3DSWA 3KSLA 4GTTA 1DCEA 1D8DA 1JCRA 1KZPA 1D8EA 1N4PA 4GTVA 3DSUA 1X81A 3DSVA 3DSXA 3E37A 1O1RA 1TN8A 1SA5A 4L9PA 3DRAA 3Q79A 1TN7A 3KSQA 3Q78A 1TN6A 2H6HA 3HXFA 3Q7FA 4YDEA 3HXBA 4YDOA 1QBQA 3E32A 3DSTA 1O1SA 3PZ1A 1JCQA 1FT1A 1LTXA 3C72A 1N4RA 2BEDA 1SA4A 4LNGA 3HXEA 1LD8A 4GTOA 3EU5A 3EUVA 1TNUA 4GTRA 2H6FA 1MZCA 4GTQA 3SFXA 1FT2A 1N95A 4MBGA 3E30A 3DSSA 1LD7A 3HXCA 2R2LA 1TNZA 3Q73A 3PZ4A 3DPYA 4EHMA 1S64A 3HXDA 1NI1A 4LNBA 1NL4A 2IEJA 3PZ3A 1N9AA 2ZIRA 2H6GA
chains in the Genus database with same CATH superfamily
5FQ8A 1E7UA 3URZA 4IN3B 3ZN3A 3FUDA 2VQ2A 4HXIA 3OTNA 2Y0BG 3D9IA 3PZ2A 2NC9A 5BV1A 4P29A 5EN5D 2VSNA 3P2BA 2JEKA 1DNPA 4OVVA 3CVXA 3Q7AA 4J0UA 4IULA 2XQ0A 2ZGGA 3OXLA 4XI0A 4QQIA 5ARFA 3FTWA 3NOCD 5CEDB 1TN8A 3BQOA 4JZYA 4BWRA 4L9PA 2PM7A 4C0MA 3MEKA 3DRAA 2VSXE 2H6HA 2P9PG 3Q7FA 4RQIA 4YDEA 3APDA 1H2VC 3AS5A 4U8YD 3ULEG 3PZ1A 1FT1A 4LEUA 3LCAA 3CQGB 2J49A 2YQ8A 1OCRE 4PDXA 5ANLA 2L6JA 3RJVA 4JL0A 3L16A 3MKRA 5D2MC 5JMND 4BSZB 4CCAA 3SF4A 2UY1A 2L0IA 3CKBA 5DIZA 2XZDG 4LERA 1N95A 3RRMB 4MBGA 4GAAA 5BPPA 4GA1A 2IOSA 3ZHEB 5B1AE 3JYSA 2C2LA 3CVQA 3O48A 1U2VG 2P9NG 2OV8A 3UMVA 2IY0C 3O4ZA 3FUKA 2J09A 4DX1A 2CHWA 3FTZA 4U7EB 3CHMA 5HRYA 2FEZA 3NQPA 2BTDA 4RG6A 3RK6A 4I1AA 3VLDA 4N3AA 5EKQD 5KJKA 4Y6WA 1XGWA 4L7TA 4GTTA 1U3CA 2L6BA 2VGXB 4ANWA 3FFLA 5CBOA 4HORA 1JCRA 3WG7E 1BI7B 3HIZA 4BX8A 3F6QA 2GRMA 3DSUA 1L5JA 2M63A 3FUJA 4I6EA 3TWWA 3ASFA 1TJFA 3Q79A 1KT0A 4HVBA 5AAOA 4EZLA 3KSQA 2FF4A 1WM5A 3CVWA 2OCCE 3CVLA 4EECA 3I4GA 2VGXA 4GYYA 3TL5A 3V30A 4Z68A 4JEHA 3KEAA 3UIOC 2LUHA 3AG4E 4YVOA 2V0PA 1BU9A 4ATZD 2C0MA 5CRVA 4CDNA 3MKQA 3FTSA 3T5XA 5FZSA 2E2EA 4I9CA 3AS8A 3HVEB 1TNZA 3VTXA 3L6AA 1IQUA 4B89A 4I9EA 1FVFA 3QOUA 4F7AA 2VGEA 2ETBA 5CBNA 1K8KG 1YCSB 2NSZA 4TXPA 4GYWA 5B3SE 1HH8A 4BFRA 5BXUA 2YINA 4J8YA 3W9FA 3L54A 5A23A 1SZAA 2KATA 3CVUA 3HG0D 4DLOA 3S2AA 3AJIA 4NIKA 3KSLA 2DVWA 3TWTA 2DWZA 4L23A 5KJNA 3SBTB 4TUMA 2AVPA 2X6JA 3JXJA 3ZRHA 1EYHA 5CCMA 1UJKA 3FUIA 5EIBE 4K5CA 2L0TB 2PM6A 1MQSA 1A17A 4CGWA 1X5BA 3KS2A 3Q49B 4K0RA 4KXKB 1Z3YA 2WXGA 2EINE 5JJ6A 1UN8A 4XX5A 2XEVA 4K5AB 3HXEA 3RSEG 3CK8A 3FTUA 3PRZA 5LFAA 4GTOA 3UQ3A 4BX9A 4AIFA 2GRLA 4G2VA 4WWNA 3ZUVB 5EILA 3VTYA 3G2SA 3FP3A 4K03A 3QNKA 4GZ6A 5CEAA 3ULQA 3R9MA 4Q69A 3CHSA 2RD0A 4AM9A 4HQDA 3FDHA 5ENSD 2WMNA 2J9QA 4N2QA 4O6FA 3J5QB 3AG1E 3UIPC 2R59A 3Q5MA 1OCOE 3OXGA 5FINA 5IY5E 4GZDA 2H6IA 3JXIA 4BY6A 3TG4A 1NP7A 4BT8A 1E8YA 2EIJE 2LAIA 3APCA 3Q9NC 5CHEE 3MV3B 2EILE 3LXUX 5M72A 2J4DA 3GZ1A 3RKVA 3PUJA 3UKRG 1K1BA 4BT9A 3BU8A 2XGMA 2QZAA 4NACA 2UY1B 3T5VA 1TR4A 1OCZE 3LVRE 5FZRA 2X6IA 5KJLA 3MZLB 3AU5A 4HB5A 4GMLA 3ZYLA 5BXOA 3EUVA 4HOSA 1TNUA 2QFCA 4O1PA 3TWSA 5KWDA 4GTRA 4U63A 4BTAA 3NZUA 4KMOA 4B8AA 4C9BB 2P2CP 4L1BA 3GW4A 3SQVA 2ILRA 2NXPA 3C3RA 2XGSA 4ANUA 3E30A 1MX4A 3UUXA 5KBAA 4YDWA 2R5SA 4R7LA 3CHOA 2DCPA 5ITZF 4PUCA 3Q4AB 2I1KA 5LCWJ 3EHRA 2WXKA 4HLEA 4G1TA 4LG6A 5ENPD 2IQCA 4JVSA 3SNXA 1JCSA 3QWWA 1NFIE 3UX4A 4GMRA 1TNYA 2A4ZA 5AQBA 5AYWD 1YMPA 3MGBA 4FHKA 1Y6IA 1H6KA 4XEIG 2XGOA 3TXMA 1KLXA 1KZPA 4DX2A 5AJDA 1PAQA 3APFA 5AARA 3CSTA 2Y4UA 4LSZE 3D3MA 4GPKA 3PNTB 1OWPA 3ABME 2AWIA 5H7PA 5CMWA 3ZPJA 1TEZA 2IO3C 2J8SD 3HXBA 3DBSA 3FY4A 3I5PA 2ETCA 5CRUA 4OVUA 3V2XA 3RIBA 4W9RA 4EZKA 4XI9A 3RO2A 4CDRA 3S7FA 2GW1A 4GTQA 1MJ0A 3CHPA 2FO1E 4YDYA 2R2LA 1E8XA 3UM0A 4F1PA 2CG3A 3L82A 2B0OE 1N9AA 3FTVA 4H7XA 2P9SG 1H6OA 3E33A 4ABNA 3LJ3A 2HE0A 3CK7A 4RG9A 3SBSA 2XPZA 3CVVA 5D66A 4EBAG 4KBQA 2ZISA 1KZOA 2KZTA 2CFZA 3ONKA 2J4BA 4I2WA 1H19A 4GZ3A 3QWVA 2E0IA 2RFMA 2GRNB 2I6HA 3ESKA 4CEMA 3UXGA 4N3BA 3DSVA 3E37A 3ASNE 3ISMC 1FVHA 2X6FA 3KAEA 5LCWC 4LCTA 1ELWA 3SI5A 3DSTA 3HVEA 3RRUA 4KVMA 1N4RA 2BEDA 4QFVA 3N71A 2Q7FA 5ANRA 1HE8A 4I1OB 4WNDA 4ANVA 3DXKG 4UWLA 4G25A 1MZCA 2DZOA 4FHJA 2WXLA 4LRZA 2GRRB 4B93B 1ZBPA 4JXTA 4UWKA 4FJYA 1XNFA 3S7JA 4AP2A 2X6KA 2ZGDA 4OAVB 1TJCA 4U0ZA 1SVXA 2BF0X 2WXMA 4U8VD 1DVPA 4DI4A 4PH4B 1N52A 3ASGA 3NF1A 3NZSA 3EHMA 4JHRA 1ZB1A 4LUNU 5G05C 1O5MA 4U8HA 3LY9A 3NAWA 3L9TA 4E85A 3ZHEA 1N54A 2WXPA 2WXHA 5EX0A 2MHKA 3TWVA 4F6RD 2C0LA 4TXRA 4ACLA 2IU1A 3FH5A 3ZXSA 2OVFA 2AXZA 3PE4A 2HO1A 3RU0A 1O1RA 2X38A 2VSYA 4B94A 1UW4B 3ABKE 5JA4D 4HOUA 1Z3XA 2KBXA 3CVNA 5KCMA 4JD2G 3RAUA 2WXJA 3CV0A 4GA0A 3EHNA 1N11A 5EYPF 4GZ5A 4HRNA 3FUNA 4GCNA 4V3IA 4JPSA 2XHEA 5T8IA 1DC2A 1JWGA 4EPZA 5AENA 4J7WA 2P9LG 4CYMD 3SD5A 4DX5D 1BI8B 1HXIA 3RO3A 3B7TA 3G2UA 3PS6A 4MLPA 2ETAA 3DSSA 3IXEA 3FULA 3MCXA 4E6HA 3CEQA 3HXDA 4LNBA 1K3ZD 2FI7A 2FO7A 1UJJA 1EDUA 5BW8C 3JQ1A 5G55A 2CHXA 4WAFA 3FUFA 4RVBA 4GTPA 4A1SA 4OAUC 4Q96A 4MS6A 3KD7A 4HOQA 2DYRE 5D0OD 5A7DB 4J8SA 3PEUB 3CR3A 3C98A 3PZDA 2X6HA 1PC2A 2MOWA 3LJNA 3NB2A 1JWFA 4UI9C 1V54E 4J8EA 2X3MA 3D9LA 3SFZA 1E7VA 3NBNB 1YYHA 1U3DA 5KNGA 3B95A 2J08A 3B7BA 4BESA 1TN7A 2A5EA 2UWJG 4ACKA 5JJ7A 4CT4A 3HHMA 2XENA 2WMOA 3ASDA 3JUIA 4ILHB 4AY6A 4RSYA 4I6GA 2XS8A 4WNEA 3LPZA 4GPMA 4HRLA 4XIFA 4A55A 2P9KG 2PNNA 3AG2E 2R03A 1JUQA 1SZ9A 1HS6A 1TYQG 4I43A 2R05A 4BTBA 3QARA 3HXCA 2OVBA 5J08A 4APFA 2KC7A 3LY8A 2ZIRA 3TG5A 1H2TC 3E34A 4A63B 3LKUA 3ZIMA 5EYLA 2Y4TA 5AJLA 2CHZA 3QK0A 3ONLA 1N94A 5CCLA 5G04J 4FLHA 5C1DA 4L2YA 1QQEA 3QB2A 1UN9A 4ILGA 3U4TA 4HI9A 3CQCB 1UG3A 4HOTA 4U0UA 3R7RA 4I1MA 2ZU6B 3ENEA 3I3NA 4ILIA 3DSXA 3UKUG 2R02A 1SA5A 3FEXA 1HG2A 2WXOA 2LAHA 1NA3A 4KVOA 1SW6A 1IHGA 1RZ4A 4YDOA 4XKBA 3MYVA 3UT4A 1JCQA 4B8CB 3BG1B 3ZFWA 3IHYA 2AXVA 4APOA 4LNGA 3ZXPA 2XPIA 1IYGA 2V8SE 4NQ0A 1HZ4A 4UWGA 3ULYA 1E8WA 3FEYA 3FU3A 1GW6A 1AP7A 2HM8A 1HU3A 5FT9A 5G04C 2R17C 4HLLA 3Q73A 3DPYA 3QJZA 3DXMG 1S64A 3PZ3A 3LY7A 3FU5A 3U64A 3MV2B 2H6GA 3EHQA 1TNBA 4N39A 3IEGA 3L17A 5CECB 3UPVA 2XEEA 3TAXA 4U96D 4EZJA 3FU0A 2HYZA 4URKA 3ZYMA 5KJMA 4DLQA 5LX8A 3J5PA 3PVLA 3TWUA 4M7CA 3B7RL 3Q15A 1ELRA 1D8DA 2JABA 1D8EA 4JHJA 4ZHBA 5FTPA 1N0RA 1BLXB 5LP0A 2WXIA 3EIQC 3K9IA 2WVIA 3LYAA 2P9UG 4HBDA 3JUEA 3AG3E 2RKKA 4TRQA 3SY2A 4EQFA 2IONA 3QC1A 4FJZA 3FU6A 3EJNA 2XRYA 2WQ7A 2IF4A 2WXRA 1OT8A 1IHBA 4JC8A 2QC9A 3EU9A 2KXPC 1HO8A 4MRUA 3PZ4A 1Q2ZA 4F3VA 4HI8A 1NL4A 2IEJA 3MKQB 3VLFA 4UWHA 4N3CA 5AN8A 3UTMA 3S7BA 1N4SA 4ZFHA 3MA5A 1DCQA 4A1GA 3V79K 5BT1A 1P5QA 4BSXA 1N4QA 2BKKB 4IYPA 4Y6CA 3T9KA 2YNQA 3LDZA 4WNFA 1WDYA 2WB2A 2PL2A 1H6PA 4U07A 5FQ6A 4UQXA 3PH0C 4DX7D 3FWVA 4G23A 4GTVA 4UI9K 3Q9UC 5EX3A 1B89A 3ZGQA 3IV0A 3Q78A 1TN6A 4N5CA 1QBQA 5CMYA 2LXMA 3ZYKA 1HFAA 1SA4A 3FTYA 4I6JA 4CT0A 2WPVA 3E4BA 3FUHA 4FU3A 1IQRA 2XPYA 4O1OA 5HI7A 2FBNA 3TWQA 3SFXA 4WWPA 3D9MA 4GYOA 2A5UA 1OWOA 3HDXA 4PS8A 2Y1LE 1QZ2A 4AOFA 4LNUD 3JCKC 4WNGA 1NA0A 3BG0B 5ENOD 4CRWA 2WQ6A 4G11A 3G2VA 3ASOE 5ENTD 2QYJA 5FQ7A 3UT7A 4BERA 2RFAA 1HX8A 3QAQA 5J90A 3DWLG 4TXQA 5KNHD 3JQ0A 4IRUA 3HRAA 2PQRA 2WM9A 3PUKA 2VYIA 3I4RB 4B0ZA 3EIJA 5JHAA 2F0YA 2XS1A 3DEOA 3SFYA 3QKYA 4G24A 4DPRA 2V5QC 4L2LA 2ONDA 2DZNA 4UI9J 3ZU7B 3PE3A 3ZKJA 2AXUA 1FCHA 1X81A 4DUIA 3HYMB 2DIWA 4KZCA 3PNLB 1EPUA 2DBAA 2VSOE 3E32A 3G2WA 3T8KA 4PS7A 1UOHA 1OXJA 1MHQA 5CERB 3ZNGA 4A3VA 3UM1A 3EU5A 5EDSA 3D9HA 2LSUA 1E96B 1HG5A 3ML9A 3TGOA 4U95D 4MKTA 1FT2A 1H2UA 3ZVVA 4HS2A 4Q94A 4WWOA 3Q47B 1OWLA 1LF8A 2DYSE 3W9GA 2GGFA 3P1UA 2QY7A 3ML8A 3VLEA 4PS3A 5AQAA 5BNWA 4O60A 1G3NB 1ZU2A 2EIKE 5JHBA 1INZA 4UUCA 4GMJA 2V4HC 5ENQD 1O1TA 3UT8A 2LXLA 4GTMA 4RLYA 1HF8A 2LNIA 3FH7A 1IKND 2NYJA 2FULA 2F8XK 4G8KA 1SQMA 1BPOA 4AEZC 3FTXA 4CGVA 1A5EA 4OYSA 2GRPB 4A3TA 4UQZA 2B6CA 3G2TA 5BV0A 3V2OA 4GB9A 3UI2A 3FHEA 4JEUA 3HXFA 1E90A 4H7YA 3R9AB 3SGHA 4C0EA 3IBEA 4TV3A 1O1SA 1KT1A 2XEHA 4BEPA 4XZ4A 5T3RA 3TJPA 2BKGA 3CVPA 1MYOA 5D0QD 2LSVA 3T8MA 1OWNA 2H6FA 4CZ2D 4XKCA 4GA2A 5FIOA 4N2SA 4CDMA 3ZEFA 3V31A 3BEEA 3GZ2A 3LEWA 4XE0A 3B7UX 4UQYA 1OWMA 3FUMA 4DK5A 1W3BA 3ZW3A 3C3QA 4N5QA 4AVXA 3ASHA 3L08A 1WY6A 2WXNA 4U0SA 3SO8A 5E76A 4JHKA 2F37A 2XZTG 1Z5SC 4YNDA 5DBKA 4GTSA 4DRXE 1RW2A 5T4YA 3TWRA 5HQ8A 4ME2A 1FPPA 4I17A 5AQ9A 2VTBA 2KCVA 1TNOA 2OEWA 3UM2A 2P58C 2IO2C 3SHFA 1S70B 3LS8A 3CSFA 1E8ZA 1QNFA 3AS4A 4HRMB 4C48B 2QYUA 3EDTB 1S0PA 3PEVB 1H0AA 5FQ4A 4AJWA 4FA6A 3D9NA 2HR2A 4JB8P 4X8QA 3R7QA 3FUEA 2OOEA 2I2OA 2IFUA 4WUYA 2BUGA 5G2NA 2J07A 2KZTB 1LD8A 2PQNA 3SZ7A 4FADA 4J6IA 5FWQA 3BUAA 3U66A 2CFUA 5ARGA 1D9SA 3KEZA 1IXVA 2XCCA 4DJAA 2JLBA 3ZYQA 2YHEA 5ENRD 2PZIA 4NRHB 3B7SA 2WQHA 5FZQA 3DEPA 2IJGX 1LD7A 3CLJA 3X2QE 3ABLE 1OUVA 4FLBA 2I9CA 3ESLA 4F1SA 1V55E 4ANXA 1S63A 3OXFA 5JJTA 2MYOA 4JW1A 2VJ8A 2Y3AA 4M3OA 5HKPA 2EIME 4KZ0A 4DX6D 3FH8A 2AW6A 3Q75A 3D9PA 5LOZA 1DCEA 2YHCA 3LVQE 2XCBA 1QYMA 1MX6A 4AXHA 3DPDA 3AU4A 3PREA 2L9BA 3CIAA 2OEVA 3AAAC 3GZSA 3UINC 4F53A 5FJYA 3TXNA 1KPSB 4DI3A 1AWCB 4GZCA 1OY3D 3D9JA 4I2ZA 1BD8A 3C72A 5EIDA 3D9KA 1ELKA 4J8DA 3RRNB 5E75A 3PDNA 3B13A 1EF1C 4UWFA 4D10C 4JA9A 3IHVA 3CHRA 3QDNA 2EQXA 2IOLA 4HFGA 2KCLA 3MX3A 3QWPA 5A6CA 1VDYA 4NURA 1YA0A 2KM4A 4U04A 2XRZA 4G8LA 5AIJA 4EBAA 4TUUA 4ATGA 4AY5A 2KCKA 1JPLA 1Y8MA 4J8FA 4GCOA 3CKCA 1PY1A 2WXQA 2V5FA 3U3WA 5ENNA 4KYOB 1NZNA 2GROB 2VTBB 1MX2A 2WXFA 3DSWA 2RG8A 3GYZA 4G26A 3CK9A 2ZXWE 4FC8A 4GU5A 2AJAA 3D9OA 3OAWA 3NOGD 4BETA 2Y69E 1N4PA 3L22A 3CGHA 5C2YA 3MJWA 4AV7A 2I1JA 2V4LA 3C3OA 1WAO1 3CVYA 4JA7A 1N0QA 1WG0A 2P9IG 5B1BE 5BUZA 3L13A 3C5RA 5G05J 4KT6B 1LTXA 3U9WA 3CHQA 4HNAD 3UM3A 4K5BA 4FP7A 1K1AA 4YVQC 2VGYA 3TWXA 5AQ7A 1Z6TA 3IKOB 1OCCE 4EHMA 2CG2A 2MRIA 5HS0A 2LO6A 2GRQB 1NI1A 3WXXA 3S7DA 4FULA 2F8YA
chains in the Genus database with same CATH topology
1TNBA 3E33A 3E34A 1JCSA 1S63A 1N4SA 1O1TA 1TNYA 4GTPA 4GTMA 1O5MA 4GTSA 1N94A 3PZ2A 2ZISA 1KZOA 1FPPA 1N4QA 2F0YA 3SFYA 2H6IA 1TNOA 3Q7AA 3Q75A 3DSWA 3KSLA 4GTTA 1DCEA 1D8DA 1JCRA 1KZPA 1D8EA 1N4PA 4GTVA 3DSUA 1X81A 3DSVA 3DSXA 3E37A 1O1RA 1TN8A 1SA5A 4L9PA 3DRAA 3Q79A 1TN7A 3KSQA 3Q78A 1TN6A 2H6HA 3HXFA 3Q7FA 4YDEA 3HXBA 4YDOA 1QBQA 3E32A 3DSTA 1O1SA 3PZ1A 1JCQA 1FT1A 1LTXA 3C72A 1N4RA 2BEDA 1SA4A 4LNGA 3HXEA 1LD8A 4GTOA 3EU5A 3EUVA 1TNUA 4GTRA 2H6FA 1MZCA 4GTQA 3SFXA 1FT2A 1N95A 4MBGA 3E30A 3DSSA 1LD7A 3HXCA 2R2LA 1TNZA 3Q73A 3PZ4A 3DPYA 4EHMA 1S64A 3HXDA 1NI1A 4LNBA 1NL4A 2IEJA 3PZ3A 1N9AA 2ZIRA 2H6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNB A;  3E33 A;  3E34 A;  1JCS A;  1S63 A;  1N4S A;  1O1T A;  1TNY A;  4GTP A;  4GTM A;  1O5M A;  4GTS A;  1N94 A;  3PZ2 A;  2ZIS A;  1KZO A;  1FPP A;  1N4Q A;  2F0Y A;  3SFY A;  2H6I A;  1TNO A;  3Q7A A;  3Q75 A;  3DSW A;  3KSL A;  4GTT A;  1DCE A;  1D8D A;  1JCR A;  1KZP A;  1D8E A;  1N4P A;  4GTV A;  3DSU A;  1X81 A;  3DSV A;  3DSX A;  3E37 A;  1O1R A;  1TN8 A;  1SA5 A;  4L9P A;  3DRA A;  3Q79 A;  1TN7 A;  3KSQ A;  3Q78 A;  1TN6 A;  2H6H A;  3HXF A;  3Q7F A;  4YDE A;  3HXB A;  4YDO A;  1QBQ A;  3E32 A;  3DST A;  1O1S A;  3PZ1 A;  1JCQ A;  1FT1 A;  1LTX A;  3C72 A;  1N4R A;  2BED A;  1SA4 A;  4LNG A;  3HXE A;  1LD8 A;  4GTO A;  3EU5 A;  3EUV A;  1TNU A;  4GTR A;  2H6F A;  1MZC A;  4GTQ A;  3SFX A;  1FT2 A;  1N95 A;  4MBG A;  3E30 A;  3DSS A;  1LD7 A;  3HXC A;  2R2L A;  1TNZ A;  3Q73 A;  3PZ4 A;  3DPY A;  4EHM A;  1S64 A;  3HXD A;  1NI1 A;  4LNB A;  1NL4 A;  2IEJ A;  3PZ3 A;  1N9A A;  2ZIR A;  2H6G A; 
#chains in the Genus database with same CATH topology
 5FQ8 A;  1E7U A;  3URZ A;  4IN3 B;  3ZN3 A;  3FUD A;  2VQ2 A;  4HXI A;  3OTN A;  2Y0B G;  3D9I A;  3PZ2 A;  2NC9 A;  5BV1 A;  4P29 A;  5EN5 D;  2VSN A;  3P2B A;  2JEK A;  1DNP A;  4OVV A;  3CVX A;  3Q7A A;  4J0U A;  4IUL A;  2XQ0 A;  2ZGG A;  3OXL A;  4XI0 A;  4QQI A;  5ARF A;  3FTW A;  3NOC D;  5CED B;  1TN8 A;  3BQO A;  4JZY A;  4BWR A;  4L9P A;  2PM7 A;  4C0M A;  3MEK A;  3DRA A;  2VSX E;  2H6H A;  2P9P G;  3Q7F A;  4RQI A;  4YDE A;  3APD A;  1H2V C;  3AS5 A;  4U8Y D;  3ULE G;  3PZ1 A;  1FT1 A;  4LEU A;  3LCA A;  3CQG B;  2J49 A;  2YQ8 A;  1OCR E;  4PDX A;  5ANL A;  2L6J A;  3RJV A;  4JL0 A;  3L16 A;  3MKR A;  5D2M C;  5JMN D;  4BSZ B;  4CCA A;  3SF4 A;  2UY1 A;  2L0I A;  3CKB A;  5DIZ A;  2XZD G;  4LER A;  1N95 A;  3RRM B;  4MBG A;  4GAA A;  5BPP A;  4GA1 A;  2IOS A;  3ZHE B;  5B1A E;  3JYS A;  2C2L A;  3CVQ A;  3O48 A;  1U2V G;  2P9N G;  2OV8 A;  3UMV A;  2IY0 C;  3O4Z A;  3FUK A;  2J09 A;  4DX1 A;  2CHW A;  3FTZ A;  4U7E B;  3CHM A;  5HRY A;  2FEZ A;  3NQP A;  2BTD A;  4RG6 A;  3RK6 A;  4I1A A;  3VLD A;  4N3A A;  5EKQ D;  5KJK A;  4Y6W A;  1XGW A;  4L7T A;  4GTT A;  1U3C A;  2L6B A;  2VGX B;  4ANW A;  3FFL A;  5CBO A;  4HOR A;  1JCR A;  3WG7 E;  1BI7 B;  3HIZ A;  4BX8 A;  3F6Q A;  2GRM A;  3DSU A;  1L5J A;  2M63 A;  3FUJ A;  4I6E A;  3TWW A;  3ASF A;  1TJF A;  3Q79 A;  1KT0 A;  4HVB A;  5AAO A;  4EZL A;  3KSQ A;  2FF4 A;  1WM5 A;  3CVW A;  2OCC E;  3CVL A;  4EEC A;  3I4G A;  2VGX A;  4GYY A;  3TL5 A;  3V30 A;  4Z68 A;  4JEH A;  3KEA A;  3UIO C;  2LUH A;  3AG4 E;  4YVO A;  2V0P A;  1BU9 A;  4ATZ D;  2C0M A;  5CRV A;  4CDN A;  3MKQ A;  3FTS A;  3T5X A;  5FZS A;  2E2E A;  4I9C A;  3AS8 A;  3HVE B;  1TNZ A;  3VTX A;  3L6A A;  1IQU A;  4B89 A;  4I9E A;  1FVF A;  3QOU A;  4F7A A;  2VGE A;  2ETB A;  5CBN A;  1K8K G;  1YCS B;  2NSZ A;  4TXP A;  4GYW A;  5B3S E;  1HH8 A;  4BFR A;  5BXU A;  2YIN A;  4J8Y A;  3W9F A;  3L54 A;  5A23 A;  1SZA A;  2KAT A;  3CVU A;  3HG0 D;  4DLO A;  3S2A A;  3AJI A;  4NIK A;  3KSL A;  2DVW A;  3TWT A;  2DWZ A;  4L23 A;  5KJN A;  3SBT B;  4TUM A;  2AVP A;  2X6J A;  3JXJ A;  3ZRH A;  1EYH A;  5CCM A;  1UJK A;  3FUI A;  5EIB E;  4K5C A;  2L0T B;  2PM6 A;  1MQS A;  1A17 A;  4CGW A;  1X5B A;  3KS2 A;  3Q49 B;  4K0R A;  4KXK B;  1Z3Y A;  2WXG A;  2EIN E;  5JJ6 A;  1UN8 A;  4XX5 A;  2XEV A;  4K5A B;  3HXE A;  3RSE G;  3CK8 A;  3FTU A;  3PRZ A;  5LFA A;  4GTO A;  3UQ3 A;  4BX9 A;  4AIF A;  2GRL A;  4G2V A;  4WWN A;  3ZUV B;  5EIL A;  3VTY A;  3G2S A;  3FP3 A;  4K03 A;  3QNK A;  4GZ6 A;  5CEA A;  3ULQ A;  3R9M A;  4Q69 A;  3CHS A;  2RD0 A;  4AM9 A;  4HQD A;  3FDH A;  5ENS D;  2WMN A;  2J9Q A;  4N2Q A;  4O6F A;  3J5Q B;  3AG1 E;  3UIP C;  2R59 A;  3Q5M A;  1OCO E;  3OXG A;  5FIN A;  5IY5 E;  4GZD A;  2H6I A;  3JXI A;  4BY6 A;  3TG4 A;  1NP7 A;  4BT8 A;  1E8Y A;  2EIJ E;  2LAI A;  3APC A;  3Q9N C;  5CHE E;  3MV3 B;  2EIL E;  3LXU X;  5M72 A;  2J4D A;  3GZ1 A;  3RKV A;  3PUJ A;  3UKR G;  1K1B A;  4BT9 A;  3BU8 A;  2XGM A;  2QZA A;  4NAC A;  2UY1 B;  3T5V A;  1TR4 A;  1OCZ E;  3LVR E;  5FZR A;  2X6I A;  5KJL A;  3MZL B;  3AU5 A;  4HB5 A;  4GML A;  3ZYL A;  5BXO A;  3EUV A;  4HOS A;  1TNU A;  2QFC A;  4O1P A;  3TWS A;  5KWD A;  4GTR A;  4U63 A;  4BTA A;  3NZU A;  4KMO A;  4B8A A;  4C9B B;  2P2C P;  4L1B A;  3GW4 A;  3SQV A;  2ILR A;  2NXP A;  3C3R A;  2XGS A;  4ANU A;  3E30 A;  1MX4 A;  3UUX A;  5KBA A;  4YDW A;  2R5S A;  4R7L A;  3CHO A;  2DCP A;  5ITZ F;  4PUC A;  3Q4A B;  2I1K A;  5LCW J;  3EHR A;  2WXK A;  4HLE A;  4G1T A;  4LG6 A;  5ENP D;  2IQC A;  4JVS A;  3SNX A;  1JCS A;  3QWW A;  1NFI E;  3UX4 A;  4GMR A;  1TNY A;  2A4Z A;  5AQB A;  5AYW D;  1YMP A;  3MGB A;  4FHK A;  1Y6I A;  1H6K A;  4XEI G;  2XGO A;  3TXM A;  1KLX A;  1KZP A;  4DX2 A;  5AJD A;  1PAQ A;  3APF A;  5AAR A;  3CST A;  2Y4U A;  4LSZ E;  3D3M A;  4GPK A;  3PNT B;  1OWP A;  3ABM E;  2AWI A;  5H7P A;  5CMW A;  3ZPJ A;  1TEZ A;  2IO3 C;  2J8S D;  3HXB A;  3DBS A;  3FY4 A;  3I5P A;  2ETC A;  5CRU A;  4OVU A;  3V2X A;  3RIB A;  4W9R A;  4EZK A;  4XI9 A;  3RO2 A;  4CDR A;  3S7F A;  2GW1 A;  4GTQ A;  1MJ0 A;  3CHP A;  2FO1 E;  4YDY A;  2R2L A;  1E8X A;  3UM0 A;  4F1P A;  2CG3 A;  3L82 A;  2B0O E;  1N9A A;  3FTV A;  4H7X A;  2P9S G;  1H6O A;  3E33 A;  4ABN A;  3LJ3 A;  2HE0 A;  3CK7 A;  4RG9 A;  3SBS A;  2XPZ A;  3CVV A;  5D66 A;  4EBA G;  4KBQ A;  2ZIS A;  1KZO A;  2KZT A;  2CFZ A;  3ONK A;  2J4B A;  4I2W A;  1H19 A;  4GZ3 A;  3QWV A;  2E0I A;  2RFM A;  2GRN B;  2I6H A;  3ESK A;  4CEM A;  3UXG A;  4N3B A;  3DSV A;  3E37 A;  3ASN E;  3ISM C;  1FVH A;  2X6F A;  3KAE A;  5LCW C;  4LCT A;  1ELW A;  3SI5 A;  3DST A;  3HVE A;  3RRU A;  4KVM A;  1N4R A;  2BED A;  4QFV A;  3N71 A;  2Q7F A;  5ANR A;  1HE8 A;  4I1O B;  4WND A;  4ANV A;  3DXK G;  4UWL A;  4G25 A;  1MZC A;  2DZO A;  4FHJ A;  2WXL A;  4LRZ A;  2GRR B;  4B93 B;  1ZBP A;  4JXT A;  4UWK A;  4FJY A;  1XNF A;  3S7J A;  4AP2 A;  2X6K A;  2ZGD A;  4OAV B;  1TJC A;  4U0Z A;  1SVX A;  2BF0 X;  2WXM A;  4U8V D;  1DVP A;  4DI4 A;  4PH4 B;  1N52 A;  3ASG A;  3NF1 A;  3NZS A;  3EHM A;  4JHR A;  1ZB1 A;  4LUN U;  5G05 C;  1O5M A;  4U8H A;  3LY9 A;  3NAW A;  3L9T A;  4E85 A;  3ZHE A;  1N54 A;  2WXP A;  2WXH A;  5EX0 A;  2MHK A;  3TWV A;  4F6R D;  2C0L A;  4TXR A;  4ACL A;  2IU1 A;  3FH5 A;  3ZXS A;  2OVF A;  2AXZ A;  3PE4 A;  2HO1 A;  3RU0 A;  1O1R A;  2X38 A;  2VSY A;  4B94 A;  1UW4 B;  3ABK E;  5JA4 D;  4HOU A;  1Z3X A;  2KBX A;  3CVN A;  5KCM A;  4JD2 G;  3RAU A;  2WXJ A;  3CV0 A;  4GA0 A;  3EHN A;  1N11 A;  5EYP F;  4GZ5 A;  4HRN A;  3FUN A;  4GCN A;  4V3I A;  4JPS A;  2XHE A;  5T8I A;  1DC2 A;  1JWG A;  4EPZ A;  5AEN A;  4J7W A;  2P9L G;  4CYM D;  3SD5 A;  4DX5 D;  1BI8 B;  1HXI A;  3RO3 A;  3B7T A;  3G2U A;  3PS6 A;  4MLP A;  2ETA A;  3DSS A;  3IXE A;  3FUL A;  3MCX A;  4E6H A;  3CEQ A;  3HXD A;  4LNB A;  1K3Z D;  2FI7 A;  2FO7 A;  1UJJ A;  1EDU A;  5BW8 C;  3JQ1 A;  5G55 A;  2CHX A;  4WAF A;  3FUF A;  4RVB A;  4GTP A;  4A1S A;  4OAU C;  4Q96 A;  4MS6 A;  3KD7 A;  4HOQ A;  2DYR E;  5D0O D;  5A7D B;  4J8S A;  3PEU B;  3CR3 A;  3C98 A;  3PZD A;  2X6H A;  1PC2 A;  2MOW A;  3LJN A;  3NB2 A;  1JWF A;  4UI9 C;  1V54 E;  4J8E A;  2X3M A;  3D9L A;  3SFZ A;  1E7V A;  3NBN B;  1YYH A;  1U3D A;  5KNG A;  3B95 A;  2J08 A;  3B7B A;  4BES A;  1TN7 A;  2A5E A;  2UWJ G;  4ACK A;  5JJ7 A;  4CT4 A;  3HHM A;  2XEN A;  2WMO A;  3ASD A;  3JUI A;  4ILH B;  4AY6 A;  4RSY A;  4I6G A;  2XS8 A;  4WNE A;  3LPZ A;  4GPM A;  4HRL A;  4XIF A;  4A55 A;  2P9K G;  2PNN A;  3AG2 E;  2R03 A;  1JUQ A;  1SZ9 A;  1HS6 A;  1TYQ G;  4I43 A;  2R05 A;  4BTB A;  3QAR A;  3HXC A;  2OVB A;  5J08 A;  4APF A;  2KC7 A;  3LY8 A;  2ZIR A;  3TG5 A;  1H2T C;  3E34 A;  4A63 B;  3LKU A;  3ZIM A;  5EYL A;  2Y4T A;  5AJL A;  2CHZ A;  3QK0 A;  3ONL A;  1N94 A;  5CCL A;  5G04 J;  4FLH A;  5C1D A;  4L2Y A;  1QQE A;  3QB2 A;  1UN9 A;  4ILG A;  3U4T A;  4HI9 A;  3CQC B;  1UG3 A;  4HOT A;  4U0U A;  3R7R A;  4I1M A;  2ZU6 B;  3ENE A;  3I3N A;  4ILI A;  3DSX A;  3UKU G;  2R02 A;  1SA5 A;  3FEX A;  1HG2 A;  2WXO A;  2LAH A;  1NA3 A;  4KVO A;  1SW6 A;  1IHG A;  1RZ4 A;  4YDO A;  4XKB A;  3MYV A;  3UT4 A;  1JCQ A;  4B8C B;  3BG1 B;  3ZFW A;  3IHY A;  2AXV A;  4APO A;  4LNG A;  3ZXP A;  2XPI A;  1IYG A;  2V8S E;  4NQ0 A;  1HZ4 A;  4UWG A;  3ULY A;  1E8W A;  3FEY A;  3FU3 A;  1GW6 A;  1AP7 A;  2HM8 A;  1HU3 A;  5FT9 A;  5G04 C;  2R17 C;  4HLL A;  3Q73 A;  3DPY A;  3QJZ A;  3DXM G;  1S64 A;  3PZ3 A;  3LY7 A;  3FU5 A;  3U64 A;  3MV2 B;  2H6G A;  3EHQ A;  1TNB A;  4N39 A;  3IEG A;  3L17 A;  5CEC B;  3UPV A;  2XEE A;  3TAX A;  4U96 D;  4EZJ A;  3FU0 A;  2HYZ A;  4URK A;  3ZYM A;  5KJM A;  4DLQ A;  5LX8 A;  3J5P A;  3PVL A;  3TWU A;  4M7C A;  3B7R L;  3Q15 A;  1ELR A;  1D8D A;  2JAB A;  1D8E A;  4JHJ A;  4ZHB A;  5FTP A;  1N0R A;  1BLX B;  5LP0 A;  2WXI A;  3EIQ C;  3K9I A;  2WVI A;  3LYA A;  2P9U G;  4HBD A;  3JUE A;  3AG3 E;  2RKK A;  4TRQ A;  3SY2 A;  4EQF A;  2ION A;  3QC1 A;  4FJZ A;  3FU6 A;  3EJN A;  2XRY A;  2WQ7 A;  2IF4 A;  2WXR A;  1OT8 A;  1IHB A;  4JC8 A;  2QC9 A;  3EU9 A;  2KXP C;  1HO8 A;  4MRU A;  3PZ4 A;  1Q2Z A;  4F3V A;  4HI8 A;  1NL4 A;  2IEJ A;  3MKQ B;  3VLF A;  4UWH A;  4N3C A;  5AN8 A;  3UTM A;  3S7B A;  1N4S A;  4ZFH A;  3MA5 A;  1DCQ A;  4A1G A;  3V79 K;  5BT1 A;  1P5Q A;  4BSX A;  1N4Q A;  2BKK B;  4IYP A;  4Y6C A;  3T9K A;  2YNQ A;  3LDZ A;  4WNF A;  1WDY A;  2WB2 A;  2PL2 A;  1H6P A;  4U07 A;  5FQ6 A;  4UQX A;  3PH0 C;  4DX7 D;  3FWV A;  4G23 A;  4GTV A;  4UI9 K;  3Q9U C;  5EX3 A;  1B89 A;  3ZGQ A;  3IV0 A;  3Q78 A;  1TN6 A;  4N5C A;  1QBQ A;  5CMY A;  2LXM A;  3ZYK A;  1HFA A;  1SA4 A;  3FTY A;  4I6J A;  4CT0 A;  2WPV A;  3E4B A;  3FUH A;  4FU3 A;  1IQR A;  2XPY A;  4O1O A;  5HI7 A;  2FBN A;  3TWQ A;  3SFX A;  4WWP A;  3D9M A;  4GYO A;  2A5U A;  1OWO A;  3HDX A;  4PS8 A;  2Y1L E;  1QZ2 A;  4AOF A;  4LNU D;  3JCK C;  4WNG A;  1NA0 A;  3BG0 B;  5ENO D;  4CRW A;  2WQ6 A;  4G11 A;  3G2V A;  3ASO E;  5ENT D;  2QYJ A;  5FQ7 A;  3UT7 A;  4BER A;  2RFA A;  1HX8 A;  3QAQ A;  5J90 A;  3DWL G;  4TXQ A;  5KNH D;  3JQ0 A;  4IRU A;  3HRA A;  2PQR A;  2WM9 A;  3PUK A;  2VYI A;  3I4R B;  4B0Z A;  3EIJ A;  5JHA A;  2F0Y A;  2XS1 A;  3DEO A;  3SFY A;  3QKY A;  4G24 A;  4DPR A;  2V5Q C;  4L2L A;  2OND A;  2DZN A;  4UI9 J;  3ZU7 B;  3PE3 A;  3ZKJ A;  2AXU A;  1FCH A;  1X81 A;  4DUI A;  3HYM B;  2DIW A;  4KZC A;  3PNL B;  1EPU A;  2DBA A;  2VSO E;  3E32 A;  3G2W A;  3T8K A;  4PS7 A;  1UOH A;  1OXJ A;  1MHQ A;  5CER B;  3ZNG A;  4A3V A;  3UM1 A;  3EU5 A;  5EDS A;  3D9H A;  2LSU A;  1E96 B;  1HG5 A;  3ML9 A;  3TGO A;  4U95 D;  4MKT A;  1FT2 A;  1H2U A;  3ZVV A;  4HS2 A;  4Q94 A;  4WWO A;  3Q47 B;  1OWL A;  1LF8 A;  2DYS E;  3W9G A;  2GGF A;  3P1U A;  2QY7 A;  3ML8 A;  3VLE A;  4PS3 A;  5AQA A;  5BNW A;  4O60 A;  1G3N B;  1ZU2 A;  2EIK E;  5JHB A;  1INZ A;  4UUC A;  4GMJ A;  2V4H C;  5ENQ D;  1O1T A;  3UT8 A;  2LXL A;  4GTM A;  4RLY A;  1HF8 A;  2LNI A;  3FH7 A;  1IKN D;  2NYJ A;  2FUL A;  2F8X K;  4G8K A;  1SQM A;  1BPO A;  4AEZ C;  3FTX A;  4CGV A;  1A5E A;  4OYS A;  2GRP B;  4A3T A;  4UQZ A;  2B6C A;  3G2T A;  5BV0 A;  3V2O A;  4GB9 A;  3UI2 A;  3FHE A;  4JEU A;  3HXF A;  1E90 A;  4H7Y A;  3R9A B;  3SGH A;  4C0E A;  3IBE A;  4TV3 A;  1O1S A;  1KT1 A;  2XEH A;  4BEP A;  4XZ4 A;  5T3R A;  3TJP A;  2BKG A;  3CVP A;  1MYO A;  5D0Q D;  2LSV A;  3T8M A;  1OWN A;  2H6F A;  4CZ2 D;  4XKC A;  4GA2 A;  5FIO A;  4N2S A;  4CDM A;  3ZEF A;  3V31 A;  3BEE A;  3GZ2 A;  3LEW A;  4XE0 A;  3B7U X;  4UQY A;  1OWM A;  3FUM A;  4DK5 A;  1W3B A;  3ZW3 A;  3C3Q A;  4N5Q A;  4AVX A;  3ASH A;  3L08 A;  1WY6 A;  2WXN A;  4U0S A;  3SO8 A;  5E76 A;  4JHK A;  2F37 A;  2XZT G;  1Z5S C;  4YND A;  5DBK A;  4GTS A;  4DRX E;  1RW2 A;  5T4Y A;  3TWR A;  5HQ8 A;  4ME2 A;  1FPP A;  4I17 A;  5AQ9 A;  2VTB A;  2KCV A;  1TNO A;  2OEW A;  3UM2 A;  2P58 C;  2IO2 C;  3SHF A;  1S70 B;  3LS8 A;  3CSF A;  1E8Z A;  1QNF A;  3AS4 A;  4HRM B;  4C48 B;  2QYU A;  3EDT B;  1S0P A;  3PEV B;  1H0A A;  5FQ4 A;  4AJW A;  4FA6 A;  3D9N A;  2HR2 A;  4JB8 P;  4X8Q A;  3R7Q A;  3FUE A;  2OOE A;  2I2O A;  2IFU A;  4WUY A;  2BUG A;  5G2N A;  2J07 A;  2KZT B;  1LD8 A;  2PQN A;  3SZ7 A;  4FAD A;  4J6I A;  5FWQ A;  3BUA A;  3U66 A;  2CFU A;  5ARG A;  1D9S A;  3KEZ A;  1IXV A;  2XCC A;  4DJA A;  2JLB A;  3ZYQ A;  2YHE A;  5ENR D;  2PZI A;  4NRH B;  3B7S A;  2WQH A;  5FZQ A;  3DEP A;  2IJG X;  1LD7 A;  3CLJ A;  3X2Q E;  3ABL E;  1OUV A;  4FLB A;  2I9C A;  3ESL A;  4F1S A;  1V55 E;  4ANX A;  1S63 A;  3OXF A;  5JJT A;  2MYO A;  4JW1 A;  2VJ8 A;  2Y3A A;  4M3O A;  5HKP A;  2EIM E;  4KZ0 A;  4DX6 D;  3FH8 A;  2AW6 A;  3Q75 A;  3D9P A;  5LOZ A;  1DCE A;  2YHC A;  3LVQ E;  2XCB A;  1QYM A;  1MX6 A;  4AXH A;  3DPD A;  3AU4 A;  3PRE A;  2L9B A;  3CIA A;  2OEV A;  3AAA C;  3GZS A;  3UIN C;  4F53 A;  5FJY A;  3TXN A;  1KPS B;  4DI3 A;  1AWC B;  4GZC A;  1OY3 D;  3D9J A;  4I2Z A;  1BD8 A;  3C72 A;  5EID A;  3D9K A;  1ELK A;  4J8D A;  3RRN B;  5E75 A;  3PDN A;  3B13 A;  1EF1 C;  4UWF A;  4D10 C;  4JA9 A;  3IHV A;  3CHR A;  3QDN A;  2EQX A;  2IOL A;  4HFG A;  2KCL A;  3MX3 A;  3QWP A;  5A6C A;  1VDY A;  4NUR A;  1YA0 A;  2KM4 A;  4U04 A;  2XRZ A;  4G8L A;  5AIJ A;  4EBA A;  4TUU A;  4ATG A;  4AY5 A;  2KCK A;  1JPL A;  1Y8M A;  4J8F A;  4GCO A;  3CKC A;  1PY1 A;  2WXQ A;  2V5F A;  3U3W A;  5ENN A;  4KYO B;  1NZN A;  2GRO B;  2VTB B;  1MX2 A;  2WXF A;  3DSW A;  2RG8 A;  3GYZ A;  4G26 A;  3CK9 A;  2ZXW E;  4FC8 A;  4GU5 A;  2AJA A;  3D9O A;  3OAW A;  3NOG D;  4BET A;  2Y69 E;  1N4P A;  3L22 A;  3CGH A;  5C2Y A;  3MJW A;  4AV7 A;  2I1J A;  2V4L A;  3C3O A;  1WAO 1;  3CVY A;  4JA7 A;  1N0Q A;  1WG0 A;  2P9I G;  5B1B E;  5BUZ A;  3L13 A;  3C5R A;  5G05 J;  4KT6 B;  1LTX A;  3U9W A;  3CHQ A;  4HNA D;  3UM3 A;  4K5B A;  4FP7 A;  1K1A A;  4YVQ C;  2VGY A;  3TWX A;  5AQ7 A;  1Z6T A;  3IKO B;  1OCC E;  4EHM A;  2CG2 A;  2MRI A;  5HS0 A;  2LO6 A;  2GRQ B;  1NI1 A;  3WXX A;  3S7D A;  4FUL A;  2F8Y A; 
#chains in the Genus database with same CATH homology
 1TNB A;  3E33 A;  3E34 A;  1JCS A;  1S63 A;  1N4S A;  1O1T A;  1TNY A;  4GTP A;  4GTM A;  1O5M A;  4GTS A;  1N94 A;  3PZ2 A;  2ZIS A;  1KZO A;  1FPP A;  1N4Q A;  2F0Y A;  3SFY A;  2H6I A;  1TNO A;  3Q7A A;  3Q75 A;  3DSW A;  3KSL A;  4GTT A;  1DCE A;  1D8D A;  1JCR A;  1KZP A;  1D8E A;  1N4P A;  4GTV A;  3DSU A;  1X81 A;  3DSV A;  3DSX A;  3E37 A;  1O1R A;  1TN8 A;  1SA5 A;  4L9P A;  3DRA A;  3Q79 A;  1TN7 A;  3KSQ A;  3Q78 A;  1TN6 A;  2H6H A;  3HXF A;  3Q7F A;  4YDE A;  3HXB A;  4YDO A;  1QBQ A;  3E32 A;  3DST A;  1O1S A;  3PZ1 A;  1JCQ A;  1FT1 A;  1LTX A;  3C72 A;  1N4R A;  2BED A;  1SA4 A;  4LNG A;  3HXE A;  1LD8 A;  4GTO A;  3EU5 A;  3EUV A;  1TNU A;  4GTR A;  2H6F A;  1MZC A;  4GTQ A;  3SFX A;  1FT2 A;  1N95 A;  4MBG A;  3E30 A;  3DSS A;  1LD7 A;  3HXC A;  2R2L A;  1TNZ A;  3Q73 A;  3PZ4 A;  3DPY A;  4EHM A;  1S64 A;  3HXD A;  1NI1 A;  4LNB A;  1NL4 A;  2IEJ A;  3PZ3 A;  1N9A A;  2ZIR A;  2H6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...