1FPPA

Protein farnesyltransferase complex with farnesyl diphosphate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
316
structure length
316
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Protein farnesyltransferase: structure and implications for substrate binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Prenyltransferase
total genus 121
structure length 316
sequence length 316
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1fppA00
3PZ1A 1O1RA 2IEJA 4GTPA 1JCRA 3KSLA 3Q73A 3HXDA 1JCQA 1N95A 1O5MA 1S63A 1LTXA 2H6GA 3HXBA 1LD7A 3Q7FA 1LD8A 2H6FA 4LNGA 1S64A 3EUVA 3PZ2A 3DSXA 1N94A 1NI1A 3DSSA 3HXEA 3DRAA 3E32A 3DSUA 1O1SA 4GTSA 1FT1A 3KSQA 2ZISA 4EHMA 1TNYA 3Q78A 4GTTA 3SFYA 4YDEA 2BEDA 1TNBA 3EU5A 3HXCA 3DSWA 2R2LA 1TN7A 3Q7AA 3E34A 1FT2A 1N9AA 3DPYA 3PZ3A 1QBQA 3DSTA 1TN8A 2F0YA 1DCEA 1N4RA 4LNBA 1MZCA 4GTVA 1SA4A 1X81A 1O1TA 1KZOA 1SA5A 2H6HA 4GTRA 1JCSA 1D8DA 1KZPA 1TNOA 3Q79A 3E33A 1TNZA 1N4PA 1TN6A 3HXFA 1TNUA 1N4SA 4L9PA 2ZIRA 3SFXA 4GTMA 1D8EA 1FPPA 4MBGA 4YDOA 4GTQA 3DSVA 3Q75A 4GTOA 3E37A 2H6IA 3PZ4A 1NL4A 3C72A 3E30A 1N4QA
chains in the Genus database with same CATH superfamily
3FY4A 4B0ZA 3MZLB 3UI2A 3AS5A 3EHMA 4EPZA 4F1PA 3FUDA 4IRUA 4GB9A 1BPOA 3D9KA 1SW6A 4EQFA 4FA6A 4UQZA 4J8EA 4OVVA 4M3OA 1OWPA 3DXMG 2L6JA 2AXVA 2A4ZA 3ML9A 3TWSA 2J07A 4N39A 1N54A 5KNGA 1ZU2A 4GTSA 4Y6WA 3T8KA 2KZTB 1TNYA 2J08A 4KBQA 5FZQA 1D9SA 2XGSA 1H2TC 3D9LA 5T8IA 3SI5A 2KATA 4JA7A 1BU9A 1DCEA 2LXMA 3R7QA 1H2UA 1JUQA 4AVXA 3FUHA 2H6HA 5C1DA 1K1BA 3IHYA 5BXUA 3G2VA 4FADA 4NACA 4RVBA 1OCOE 3ML8A 3QARA 4BTBA 1DC2A 5EN5D 2QZAA 1YMPA 3PZ4A 2R5SA 3C72A 3ZKJA 3G2SA 3PZ1A 2NSZA 3B95A 3Q9NC 4IYPA 3E4BA 3FHEA 2VSNA 4HOQA 2PL2A 4AXHA 5AQBA 5M72A 1SQMA 2P9UG 2XEHA 2X6HA 4OVUA 3KD7A 1IKND 3V31A 3NAWA 3LDZA 3V79K 4ILIA 2EIME 4UWHA 3EU9A 4H7XA 5EYLA 2WXNA 4XZ4A 2VGXA 3CHOA 5B3SE 2XGMA 2R17C 3FU3A 3U64A 5BT1A 4CCAA 3SNXA 4HI8A 2WQHA 2ZU6B 4FHKA 2Y1LE 4DRXE 1YYHA 4EZKA 1HZ4A 4YDWA 3ASHA 3UMVA 3CKCA 3LXUX 2XCCA 2PNNA 5JMND 1KZPA 1TNOA 3QC1A 2IOSA 4Y6CA 3B7RL 3HHMA 3FUFA 3NQPA 5EDSA 4C0EA 2I6HA 4GYWA 2MOWA 1FPPA 3QNKA 1TYQG 1EYHA 2CHXA 1HF8A 3JQ0A 2KC7A 1N4QA 4GA2A 4FJZA 1HS6A 4O1PA 1HXIA 3OAWA 4GTPA 4B8CB 3LY9A 3L9TA 3D9IA 3IV0A 3FTZA 4APFA 2R02A 3D9MA 1A5EA 2V4LA 3FEYA 1LD8A 5JHBA 1WY6A 4ATZD 4DPRA 1LF8A 2P2CP 4JHKA 4C48B 3D9PA 3ONKA 4AJWA 4CEMA 4HLLA 2L0TB 5G04C 2B6CA 3DSUA 4MLPA 4K5BA 2VTBB 5ANRA 3TAXA 3TL5A 2NXPA 3ZYMA 3FUEA 2WVIA 2KCVA 4QFVA 3U4TA 4FJYA 5G55A 2GRNB 1TJFA 2ZGDA 5AN8A 2QYUA 2GRMA 4GZ3A 2WQ6A 4G11A 2PM6A 4ACLA 2QFCA 3B7BA 3N71A 5T4YA 1HO8A 1D8DA 5CCMA 1MX2A 5KJMA 4KYOB 1TNUA 1U3DA 5ENRD 4FHJA 3ZN3A 4U04A 3FTUA 4JW1A 2I9CA 2QYJA 4HRLA 4DX7D 4N3CA 4YDOA 3SD5A 2H6IA 4A1SA 4OYSA 5AJLA 3S7JA 4NRHB 4N3AA 3IBEA 2KZTA 2VSOE 2X3MA 2V4HC 2FEZA 3KSLA 3S7FA 2XPZA 1MX4A 3BUAA 4MS6A 4WUYA 3FH5A 3MEKA 1PAQA 4GMJA 3QAQA 3ZGQA 3GZ1A 1NFIE 3SFZA 4BX9A 2WXLA 4Q69A 4Q96A 3UM1A 2J49A 3DSSA 2RKKA 3LCAA 3EDTB 2WM9A 1UN9A 3APDA 5HQ8A 4LEUA 4UQYA 3V2XA 4DX2A 2VYIA 1OCCE 3KEZA 1U3CA 5LP0A 3ZNGA 4UQXA 1TN8A 3ZW3A 4UWLA 4HB5A 2VQ2A 4A3TA 1MZCA 4ME2A 1O1TA 2J8SD 1YA0A 2RFMA 3B7UX 3ZRHA 2UWJG 4LSZE 4TV3A 4L2YA 1OCRE 2X6KA 3B7TA 4CRWA 5ENNA 3HDXA 3TWUA 2KM4A 3WG7E 3FUNA 2GGFA 3ZXPA 4HVBA 4CYMD 2IONA 5FZSA 4K5AB 4JA9A 3QK0A 1K3ZD 5ENOD 3T8MA 5FJYA 5HKPA 3D3MA 5EIBE 3HXBA 3FEXA 3QWWA 2X6IA 3CK7A 4YVOA 3AG1E 4U95D 2IF4A 4TXQA 3ASGA 4U63A 4BESA 1INZA 3DRAA 1AWCB 3J5PA 3P2BA 4FULA 5CEAA 1E8YA 4FC8A 4LERA 3PUJA 2DZOA 3SFYA 2AW6A 3RK6A 1IHBA 2P9SG 4MKTA 2HO1A 1NP7A 3ZHEB 2IQCA 4N5CA 2EQXA 4DJAA 3ULYA 4JC8A 2FO7A 2WB2A 3D9NA 5DBKA 4N3BA 3AU5A 2PQRA 2P9PG 4GU5A 3O48A 2KXPC 3SF4A 2OEVA 4BFRA 5FINA 3PUKA 2WQ7A 4JHRA 3FU6A 4GZ6A 1G3NB 1A17A 3G2WA 5LCWJ 2WXJA 5JJ7A 1NA3A 3CHPA 4JXTA 3RO3A 4ABNA 5CMYA 2VTBA 3CHSA 4AV7A 3HG0D 3J5QB 2CFUA 2F37A 2V5FA 3NOGD 3PEUB 3ZXSA 1UG3A 3AJIA 3FFLA 3PNTB 3MKRA 3ESKA 3EHRA 3RO2A 4BERA 1H2VC 3C3RA 2GRRB 3UX4A 3MCXA 3HXEA 3TWXA 3ESLA 5G05C 3ASOE 3CSFA 4GA1A 4K0RA 3HIZA 3PH0C 3I4RB 2OVFA 4GPMA 2CHWA 1K1AA 2BEDA 4L7TA 5CBOA 3W9FA 4CGWA 3E34A 2DYSE 2WXPA 3MV3B 1XGWA 4XI9A 5D66A 3VTYA 3LPZA 5A23A 4APOA 3FULA 4N5QA 4RSYA 1RZ4A 4U7EB 4WNGA 3U66A 3T9KA 3D9OA 1TJCA 3UM2A 2EINE 2DYRE 2NYJA 5J08A 1H19A 1EDUA 1N4SA 5G05J 4F3VA 2QY7A 4UI9J 1HX8A 3CEQA 2DWZA 4WWNA 2OCCE 4J8YA 5EYPF 3DEPA 3S2AA 3CVUA 1E7UA 3C3QA 3ENEA 3EIQC 1QZ2A 4I2WA 3QOUA 2WMNA 4CGVA 5CCLA 3JQ1A 5BW8C 2XEEA 1O5MA 3FTWA 4PS3A 2HE0A 3B13A 2IFUA 1OUVA 3HRAA 5FQ4A 1N94A 1RW2A 1WDYA 3ZEFA 2OOEA 3VLEA 4DLQA 1MX6A 3ZYLA 2FBNA 5CECB 3BEEA 4M7CA 3MKQB 4X8QA 1P5QA 1UJKA 3AU4A 3JXJA 5CHEE 3QJZA 5EX0A 4YVQC 3VLFA 3C3OA 4EBAG 4HS2A 5T3RA 1N9AA 2Q7FA 2XCBA 3DSTA 1HFAA 4UI9K 4BSXA 3RAUA 4N2SA 1OT8A 5AENA 1KZOA 3GZSA 4L1BA 2LXLA 1DNPA 3L54A 4GTRA 2X6FA 4IN3B 4XIFA 2XENA 4IULA 3E33A 2A5UA 3JXIA 3B7SA 4WNEA 4LNUD 2L0IA 4JD2G 3Q75A 3E37A 4O6FA 5G2NA 3EHNA 3L08A 2F8XK 2WXKA 4W9RA 4QQIA 3JCKC 4DX6D 4U96D 4GCOA 3GYZA 4B89A 2XPIA 3ZHEA 5ENQD 3D9JA 1S63A 2P9IG 3UKRG 2DIWA 2L6BA 1N11A 2HM8A 1IXVA 2YINA 3TWWA 3IXEA 4I6EA 3EUVA 5ARGA 2V8SE 2Y69E 2I2OA 2CG3A 2YNQA 3L82A 2R05A 3URZA 1OWOA 4GYOA 2FI7A 3OXFA 3UTMA 2F8YA 4R7LA 2WPVA 3MA5A 3DBSA 3DSWA 5ENPD 2GRQB 3RSEG 3KS2A 4RLYA 3I3NA 2IY0C 2Y0BG 1FT2A 2BKGA 3FH7A 3RJVA 3LEWA 1N52A 3F6QA 1SVXA 3UT8A 3RRUA 3P1UA 3UINC 3ABKE 3LVRE 4G23A 3UM3A 1ELKA 2LSVA 2DVWA 4AM9A 3MV2B 4YDYA 3ZFWA 3HVEA 5A7DB 1EPUA 2WXIA 4HRNA 1IQUA 2RD0A 4FLBA 2PM7A 4ILGA 2IO3C 4GTOA 2AXUA 4DI3A 1NL4A 4TRQA 2ILRA 3NZSA 5AARA 2VSXE 4BX8A 1JCRA 3PNLB 3QWVA 1N0QA 3U9WA 2LAHA 3L13A 3Q73A 3T5XA 5D0QD 2P9LG 2L9BA 4I1AA 3PZDA 5ITZF 2XS1A 1E7VA 4CDMA 4KZ0A 3TGOA 3CK9A 3SBSA 1IHGA 2XZDG 3CVYA 1BI7B 2ONDA 1Z6TA 4G24A 2P58C 2P9KG 3Q78A 1WG0A 3JYSA 4YDEA 3LS8A 4BSZB 2R59A 4I1MA 1HE8A 3ZYKA 2AWIA 1JWGA 4A55A 5BUZA 4URKA 5FTPA 3R7RA 1QBQA 2XS8A 4HFGA 1DVPA 1Z3XA 3L16A 1SA4A 5AQ7A 2CHZA 1E96B 2XPYA 3T5VA 4D10C 5FIOA 1JCSA 5CRUA 5AAOA 3AG4E 4HBDA 3IHVA 5CRVA 4HORA 1V54E 3O4ZA 1TN6A 4PS7A 4F1SA 1XNFA 1UJJA 5ENTD 2WXFA 1S0PA 3FTYA 4MBGA 3PE3A 2KCLA 1KT0A 4EZLA 3FWVA 4U8VD 5KJKA 1AP7A 3PVLA 5KCMA 4GZDA 4AOFA 1UN8A 3TWQA 3UQ3A 4U07A 3SGHA 2Y4TA 2YHEA 1VDYA 5JJTA 1PC2A 3TJPA 3AG2E 2AXZA 2H6FA 4C9BB 1Y8MA 3PDNA 2E0IA 2LAIA 2XRYA 1JPLA 4G8LA 1QNFA 5FWQA 3I4GA 4WNFA 4WAFA 2I1JA 3CV0A 4ILHB 1HG2A 5FQ8A 3KSQA 2I1KA 4LRZA 3Q9UC 3QKYA 2WXRA 4F53A 4PS8A 4LCTA 4PDXA 2GROB 3AG3E 5LCWC 2R03A 4RQIA 3SO8A 1KT1A 1N4RA 4LNBA 2VGXB 5BXOA 3ASFA 2CG2A 2MYOA 2C2LA 1UW4B 4U0ZA 3K9IA 3ISMC 4TUMA 4I9EA 4GMLA 2LUHA 4CDNA 1FVHA 2VGYA 2FF4A 1D8EA 4GTMA 4GTQA 5LX8A 3L6AA 3R9AB 4O1OA 5AJDA 4ATGA 2UY1B 4XEIG 5CEDB 1MJ0A 3E30A 3RKVA 5E76A 4BT8A 1OWLA 3MJWA 3SY2A 1O1RA 2IEJA 4AIFA 2GW1A 2HYZA 3EIJA 4CT4A 5FZRA 3NOCD 4J0UA 5D2MC 1LTXA 3Q4AB 1U2VG 4NURA 3CR3A 4J8DA 1PY1A 4G1TA 3NBNB 3UT7A 3W9GA 4HLEA 5AYWD 4XX5A 5ENSD 4I9CA 5AIJA 5EKQD 4KT6B 4JEHA 3UT4A 4O60A 2JLBA 1FCHA 3EHQA 4FP7A 5IY5E 3HXCA 1MQSA 3APCA 3SZ7A 1ZBPA 3DXKG 1H0AA 2XZTG 3CHMA 4UI9C 2QC9A 3ZVVA 1X81A 3CVQA 3LJNA 4J7WA 4JVSA 5KJNA 4JB8P 3CGHA 3PREA 5H7PA 4BTAA 2CFZA 3LY7A 4A63B 1E8XA 1TR4A 3KAEA 3CSTA 4J8FA 4FU3A 4OAUC 1ELWA 3HXFA 4DI4A 4BEPA 4TXPA 4WNDA 3FUKA 2DZNA 2HR2A 3MYVA 1KLXA 4WWOA 5D0OD 2YHCA 4GZ5A 2BTDA 3BQOA 4HOSA 1H6KA 2LO6A 3LKUA 4I1OB 4J8SA 4ANXA 4KMOA 4NIKA 3TWVA 4ANUA 4HRMB 2BF0X 2C0MA 3LYAA 1QYMA 1BD8A 2ZGGA 4GPKA 4E6HA 1Z5SC 4DLOA 5CMWA 4CDRA 3GZ2A 4L2LA 4J6IA 2FULA 3DSXA 3PEVB 4FLHA 3CVNA 5HS0A 1FT1A 3DWLG 1Y6IA 4EHMA 3X2QE 3SBTB 2XGOA 4XE0A 3ULEG 3CVVA 3SHFA 3AS8A 2Y4UA 3EU5A 5KWDA 3QWPA 4TXRA 5B1AE 1TN7A 4JEUA 5JJ6A 2M63A 3PZ3A 4AY5A 4F7AA 3APFA 2EIJE 4MRUA 4KXKB 5J90A 2PQNA 4PUCA 1E8ZA 5LOZA 4I6GA 3JUIA 3ULQA 5LFAA 4WWPA 3FUJA 1Q2ZA 5DIZA 3FP3A 3UKUG 4U8HA 3BG1B 4UWGA 3OTNA 3TXNA 3ABLE 3BU8A 4KVMA 3D9HA 3EJNA 3LVQE 2AJAA 2VGEA 3ZYQA 4DX1A 3Q5MA 4ANVA 2MRIA 5EX3A 3SQVA 4GAAA 3CQGB 2MHKA 4C0MA 4U8YD 4LUNU 4NQ0A 2PZIA 5CBNA 3TXMA 3UM0A 3FUMA 5BV0A 4I6JA 2DCPA 2OV8A 3AAAC 2E2EA 4GYYA 5BV1A 3VLDA 3IKOB 1SZ9A 4GZCA 2GRLA 1IYGA 4HXIA 2X6JA 4JPSA 1ELRA 4KZCA 1FVFA 3QDNA 4GTTA 3CK8A 4GCNA 5KNHD 1TNBA 5ANLA 3LJ3A 4BETA 3DPDA 2UY1A 3C5RA 2P9NG 1NA0A 2AVPA 1IQRA 1EF1C 3S7DA 4K5CA 2IOLA 2YQ8A 4B94A 2V5QC 3ABME 5JHAA 1Z3YA 1OY3D 3CVPA 4EECA 4HOTA 3AS4A 5JA4D 4BWRA 5KJLA 4G25A 1YCSB 3NZUA 2WXOA 2XEVA 4A1GA 2B0OE 3PS6A 4GA0A 4CT0A 1BLXB 2DBAA 3OXLA 5BNWA 1JCQA 1N95A 1OWNA 3BG0B 4Q94A 2H6GA 5AQAA 3CHRA 1KPSB 4XKBA 1UOHA 2ZXWE 5HRYA 1HH8A 1HU3A 3G2UA 3PZ2A 3MX3A 1NI1A 1E8WA 3E32A 5ARFA 4PH4B 3CVLA 4N2QA 5BPPA 3FH8A 4EZJA 3FTSA 5FQ7A 4ZHBA 4KVOA 2XQ0A 1O1SA 1H6OA 2BUGA 4RG9A 2NC9A 3U3WA 2Y3AA 5E75A 3Q47B 2FO1E 3PRZA 4K03A 1MYOA 4F6RD 2R2LA 5G04J 4OAVB 3CIAA 3ZUVB 4BT9A 2X38A 3FU0A 4HQDA 4V3IA 1NZNA 4G26A 3CLJA 3IEGA 1SA5A 2J4BA 3CQCB 4UUCA 4RG6A 1ZB1A 1OXJA 1E90A 2XRZA 1S70B 1WAO1 2KBXA 4G2VA 2WXMA 4L9PA 4Z68A 2EIKE 4A3VA 3ASDA 3DEOA 2ETCA 1HG5A 4ACKA 3DSVA 3S7BA 1X5BA 3TWRA 3MGBA 2IJGX 1QQEA 1JWFA 2WXQA 4H7YA 3TG4A 2LSUA 4HNAD 4UWKA 3L22A 2V0PA 5FT9A 3HXDA 4AY6A 2WXHA 4YNDA 3LY8A 3ASNE 3Q7FA 5CERB 3UIOC 2RG8A 1S64A 3MKQA 1GW6A 5EIDA 4I17A 4U0UA 5HI7A 4E85A 2IO2C 3KEAA 1OWMA 3NF1A 3PE4A 1OCZE 2JEKA 2IU1A 4TUUA 2EILE 3CHQA 4BY6A 2LNIA 3Q7AA 3DPYA 3C98A 4EBAA 4L23A 4I43A 4G8KA 2F0YA 2OVBA 1MHQA 5AQ9A 5KBAA 2ETBA 2KCKA 1B89A 3TG5A 4JHJA 4CZ2D 3FDHA 1K8KG 5A6CA 3WXXA 2C0LA 3FTXA 1N4PA 3G2TA 3SFXA 1WM5A 4XI0A 4AP2A 4JL0A 2XHEA 4DX5D 2VJ8A 3OXGA 2GRPB 2J9QA 4GMRA 3QB2A 3ZIMA 4LG6A 3CVWA 3RU0A 4HI9A 3ZPJA 1LD7A 3Q15A 3CKBA 3R9MA 4LNGA 3GW4A 4DUIA 2WMOA 4ZFHA 5C2YA 4U0SA 3RIBA 4JZYA 4P29A 3V2OA 2A5EA 2WXGA 3ZU7B 2ZISA 2J4DA 3FUIA 2ETAA 3JUEA 4I2ZA 5EILA 4B93B 3CVXA 2RFAA 3RRMB 4ANWA 4GTVA 5FQ6A 1BI8B 2VSYA 3UUXA 1H6PA 2J09A 4B8AA 1TEZA 5B1BE 4HOUA 3UPVA 3ONLA 3UXGA 4XKCA 3Q79A 2BKKB 3UIPC 1V55E 1TNZA 2JABA 3VTXA 1W3BA 3FU5A 3L17A 1N0RA 2ZIRA 3I5PA 4UWFA 3NB2A 1SZAA 3TWTA 3HYMB 3RRNB 3FTVA 1DCQA 3V30A 1L5JA 2OEWA 3Q49B 3HVEB 4AEZC 4DK5A
chains in the Genus database with same CATH topology
3PZ1A 1O1RA 2IEJA 4GTPA 1JCRA 3KSLA 3Q73A 3HXDA 1JCQA 1N95A 1O5MA 1S63A 1LTXA 2H6GA 3HXBA 1LD7A 3Q7FA 1LD8A 2H6FA 4LNGA 1S64A 3EUVA 3PZ2A 3DSXA 1N94A 1NI1A 3DSSA 3HXEA 3DRAA 3E32A 3DSUA 1O1SA 4GTSA 1FT1A 3KSQA 2ZISA 4EHMA 1TNYA 3Q78A 4GTTA 3SFYA 4YDEA 2BEDA 1TNBA 3EU5A 3HXCA 3DSWA 2R2LA 1TN7A 3Q7AA 3E34A 1FT2A 1N9AA 3DPYA 3PZ3A 1QBQA 3DSTA 1TN8A 2F0YA 1DCEA 1N4RA 4LNBA 1MZCA 4GTVA 1SA4A 1X81A 1O1TA 1KZOA 1SA5A 2H6HA 4GTRA 1JCSA 1D8DA 1KZPA 1TNOA 3Q79A 3E33A 1TNZA 1N4PA 1TN6A 3HXFA 1TNUA 1N4SA 4L9PA 2ZIRA 3SFXA 4GTMA 1D8EA 1FPPA 4MBGA 4YDOA 4GTQA 3DSVA 3Q75A 4GTOA 3E37A 2H6IA 3PZ4A 1NL4A 3C72A 3E30A 1N4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ1 A;  1O1R A;  2IEJ A;  4GTP A;  1JCR A;  3KSL A;  3Q73 A;  3HXD A;  1JCQ A;  1N95 A;  1O5M A;  1S63 A;  1LTX A;  2H6G A;  3HXB A;  1LD7 A;  3Q7F A;  1LD8 A;  2H6F A;  4LNG A;  1S64 A;  3EUV A;  3PZ2 A;  3DSX A;  1N94 A;  1NI1 A;  3DSS A;  3HXE A;  3DRA A;  3E32 A;  3DSU A;  1O1S A;  4GTS A;  1FT1 A;  3KSQ A;  2ZIS A;  4EHM A;  1TNY A;  3Q78 A;  4GTT A;  3SFY A;  4YDE A;  2BED A;  1TNB A;  3EU5 A;  3HXC A;  3DSW A;  2R2L A;  1TN7 A;  3Q7A A;  3E34 A;  1FT2 A;  1N9A A;  3DPY A;  3PZ3 A;  1QBQ A;  3DST A;  1TN8 A;  2F0Y A;  1DCE A;  1N4R A;  4LNB A;  1MZC A;  4GTV A;  1SA4 A;  1X81 A;  1O1T A;  1KZO A;  1SA5 A;  2H6H A;  4GTR A;  1JCS A;  1D8D A;  1KZP A;  1TNO A;  3Q79 A;  3E33 A;  1TNZ A;  1N4P A;  1TN6 A;  3HXF A;  1TNU A;  1N4S A;  4L9P A;  2ZIR A;  3SFX A;  4GTM A;  1D8E A;  1FPP A;  4MBG A;  4YDO A;  4GTQ A;  3DSV A;  3Q75 A;  4GTO A;  3E37 A;  2H6I A;  3PZ4 A;  1NL4 A;  3C72 A;  3E30 A;  1N4Q A; 
#chains in the Genus database with same CATH topology
 3FY4 A;  4B0Z A;  3MZL B;  3UI2 A;  3AS5 A;  3EHM A;  4EPZ A;  4F1P A;  3FUD A;  4IRU A;  4GB9 A;  1BPO A;  3D9K A;  1SW6 A;  4EQF A;  4FA6 A;  4UQZ A;  4J8E A;  4OVV A;  4M3O A;  1OWP A;  3DXM G;  2L6J A;  2AXV A;  2A4Z A;  3ML9 A;  3TWS A;  2J07 A;  4N39 A;  1N54 A;  5KNG A;  1ZU2 A;  4GTS A;  4Y6W A;  3T8K A;  2KZT B;  1TNY A;  2J08 A;  4KBQ A;  5FZQ A;  1D9S A;  2XGS A;  1H2T C;  3D9L A;  5T8I A;  3SI5 A;  2KAT A;  4JA7 A;  1BU9 A;  1DCE A;  2LXM A;  3R7Q A;  1H2U A;  1JUQ A;  4AVX A;  3FUH A;  2H6H A;  5C1D A;  1K1B A;  3IHY A;  5BXU A;  3G2V A;  4FAD A;  4NAC A;  4RVB A;  1OCO E;  3ML8 A;  3QAR A;  4BTB A;  1DC2 A;  5EN5 D;  2QZA A;  1YMP A;  3PZ4 A;  2R5S A;  3C72 A;  3ZKJ A;  3G2S A;  3PZ1 A;  2NSZ A;  3B95 A;  3Q9N C;  4IYP A;  3E4B A;  3FHE A;  2VSN A;  4HOQ A;  2PL2 A;  4AXH A;  5AQB A;  5M72 A;  1SQM A;  2P9U G;  2XEH A;  2X6H A;  4OVU A;  3KD7 A;  1IKN D;  3V31 A;  3NAW A;  3LDZ A;  3V79 K;  4ILI A;  2EIM E;  4UWH A;  3EU9 A;  4H7X A;  5EYL A;  2WXN A;  4XZ4 A;  2VGX A;  3CHO A;  5B3S E;  2XGM A;  2R17 C;  3FU3 A;  3U64 A;  5BT1 A;  4CCA A;  3SNX A;  4HI8 A;  2WQH A;  2ZU6 B;  4FHK A;  2Y1L E;  4DRX E;  1YYH A;  4EZK A;  1HZ4 A;  4YDW A;  3ASH A;  3UMV A;  3CKC A;  3LXU X;  2XCC A;  2PNN A;  5JMN D;  1KZP A;  1TNO A;  3QC1 A;  2IOS A;  4Y6C A;  3B7R L;  3HHM A;  3FUF A;  3NQP A;  5EDS A;  4C0E A;  2I6H A;  4GYW A;  2MOW A;  1FPP A;  3QNK A;  1TYQ G;  1EYH A;  2CHX A;  1HF8 A;  3JQ0 A;  2KC7 A;  1N4Q A;  4GA2 A;  4FJZ A;  1HS6 A;  4O1P A;  1HXI A;  3OAW A;  4GTP A;  4B8C B;  3LY9 A;  3L9T A;  3D9I A;  3IV0 A;  3FTZ A;  4APF A;  2R02 A;  3D9M A;  1A5E A;  2V4L A;  3FEY A;  1LD8 A;  5JHB A;  1WY6 A;  4ATZ D;  4DPR A;  1LF8 A;  2P2C P;  4JHK A;  4C48 B;  3D9P A;  3ONK A;  4AJW A;  4CEM A;  4HLL A;  2L0T B;  5G04 C;  2B6C A;  3DSU A;  4MLP A;  4K5B A;  2VTB B;  5ANR A;  3TAX A;  3TL5 A;  2NXP A;  3ZYM A;  3FUE A;  2WVI A;  2KCV A;  4QFV A;  3U4T A;  4FJY A;  5G55 A;  2GRN B;  1TJF A;  2ZGD A;  5AN8 A;  2QYU A;  2GRM A;  4GZ3 A;  2WQ6 A;  4G11 A;  2PM6 A;  4ACL A;  2QFC A;  3B7B A;  3N71 A;  5T4Y A;  1HO8 A;  1D8D A;  5CCM A;  1MX2 A;  5KJM A;  4KYO B;  1TNU A;  1U3D A;  5ENR D;  4FHJ A;  3ZN3 A;  4U04 A;  3FTU A;  4JW1 A;  2I9C A;  2QYJ A;  4HRL A;  4DX7 D;  4N3C A;  4YDO A;  3SD5 A;  2H6I A;  4A1S A;  4OYS A;  5AJL A;  3S7J A;  4NRH B;  4N3A A;  3IBE A;  2KZT A;  2VSO E;  2X3M A;  2V4H C;  2FEZ A;  3KSL A;  3S7F A;  2XPZ A;  1MX4 A;  3BUA A;  4MS6 A;  4WUY A;  3FH5 A;  3MEK A;  1PAQ A;  4GMJ A;  3QAQ A;  3ZGQ A;  3GZ1 A;  1NFI E;  3SFZ A;  4BX9 A;  2WXL A;  4Q69 A;  4Q96 A;  3UM1 A;  2J49 A;  3DSS A;  2RKK A;  3LCA A;  3EDT B;  2WM9 A;  1UN9 A;  3APD A;  5HQ8 A;  4LEU A;  4UQY A;  3V2X A;  4DX2 A;  2VYI A;  1OCC E;  3KEZ A;  1U3C A;  5LP0 A;  3ZNG A;  4UQX A;  1TN8 A;  3ZW3 A;  4UWL A;  4HB5 A;  2VQ2 A;  4A3T A;  1MZC A;  4ME2 A;  1O1T A;  2J8S D;  1YA0 A;  2RFM A;  3B7U X;  3ZRH A;  2UWJ G;  4LSZ E;  4TV3 A;  4L2Y A;  1OCR E;  2X6K A;  3B7T A;  4CRW A;  5ENN A;  3HDX A;  3TWU A;  2KM4 A;  3WG7 E;  3FUN A;  2GGF A;  3ZXP A;  4HVB A;  4CYM D;  2ION A;  5FZS A;  4K5A B;  4JA9 A;  3QK0 A;  1K3Z D;  5ENO D;  3T8M A;  5FJY A;  5HKP A;  3D3M A;  5EIB E;  3HXB A;  3FEX A;  3QWW A;  2X6I A;  3CK7 A;  4YVO A;  3AG1 E;  4U95 D;  2IF4 A;  4TXQ A;  3ASG A;  4U63 A;  4BES A;  1INZ A;  3DRA A;  1AWC B;  3J5P A;  3P2B A;  4FUL A;  5CEA A;  1E8Y A;  4FC8 A;  4LER A;  3PUJ A;  2DZO A;  3SFY A;  2AW6 A;  3RK6 A;  1IHB A;  2P9S G;  4MKT A;  2HO1 A;  1NP7 A;  3ZHE B;  2IQC A;  4N5C A;  2EQX A;  4DJA A;  3ULY A;  4JC8 A;  2FO7 A;  2WB2 A;  3D9N A;  5DBK A;  4N3B A;  3AU5 A;  2PQR A;  2P9P G;  4GU5 A;  3O48 A;  2KXP C;  3SF4 A;  2OEV A;  4BFR A;  5FIN A;  3PUK A;  2WQ7 A;  4JHR A;  3FU6 A;  4GZ6 A;  1G3N B;  1A17 A;  3G2W A;  5LCW J;  2WXJ A;  5JJ7 A;  1NA3 A;  3CHP A;  4JXT A;  3RO3 A;  4ABN A;  5CMY A;  2VTB A;  3CHS A;  4AV7 A;  3HG0 D;  3J5Q B;  2CFU A;  2F37 A;  2V5F A;  3NOG D;  3PEU B;  3ZXS A;  1UG3 A;  3AJI A;  3FFL A;  3PNT B;  3MKR A;  3ESK A;  3EHR A;  3RO2 A;  4BER A;  1H2V C;  3C3R A;  2GRR B;  3UX4 A;  3MCX A;  3HXE A;  3TWX A;  3ESL A;  5G05 C;  3ASO E;  3CSF A;  4GA1 A;  4K0R A;  3HIZ A;  3PH0 C;  3I4R B;  2OVF A;  4GPM A;  2CHW A;  1K1A A;  2BED A;  4L7T A;  5CBO A;  3W9F A;  4CGW A;  3E34 A;  2DYS E;  2WXP A;  3MV3 B;  1XGW A;  4XI9 A;  5D66 A;  3VTY A;  3LPZ A;  5A23 A;  4APO A;  3FUL A;  4N5Q A;  4RSY A;  1RZ4 A;  4U7E B;  4WNG A;  3U66 A;  3T9K A;  3D9O A;  1TJC A;  3UM2 A;  2EIN E;  2DYR E;  2NYJ A;  5J08 A;  1H19 A;  1EDU A;  1N4S A;  5G05 J;  4F3V A;  2QY7 A;  4UI9 J;  1HX8 A;  3CEQ A;  2DWZ A;  4WWN A;  2OCC E;  4J8Y A;  5EYP F;  3DEP A;  3S2A A;  3CVU A;  1E7U A;  3C3Q A;  3ENE A;  3EIQ C;  1QZ2 A;  4I2W A;  3QOU A;  2WMN A;  4CGV A;  5CCL A;  3JQ1 A;  5BW8 C;  2XEE A;  1O5M A;  3FTW A;  4PS3 A;  2HE0 A;  3B13 A;  2IFU A;  1OUV A;  3HRA A;  5FQ4 A;  1N94 A;  1RW2 A;  1WDY A;  3ZEF A;  2OOE A;  3VLE A;  4DLQ A;  1MX6 A;  3ZYL A;  2FBN A;  5CEC B;  3BEE A;  4M7C A;  3MKQ B;  4X8Q A;  1P5Q A;  1UJK A;  3AU4 A;  3JXJ A;  5CHE E;  3QJZ A;  5EX0 A;  4YVQ C;  3VLF A;  3C3O A;  4EBA G;  4HS2 A;  5T3R A;  1N9A A;  2Q7F A;  2XCB A;  3DST A;  1HFA A;  4UI9 K;  4BSX A;  3RAU A;  4N2S A;  1OT8 A;  5AEN A;  1KZO A;  3GZS A;  4L1B A;  2LXL A;  1DNP A;  3L54 A;  4GTR A;  2X6F A;  4IN3 B;  4XIF A;  2XEN A;  4IUL A;  3E33 A;  2A5U A;  3JXI A;  3B7S A;  4WNE A;  4LNU D;  2L0I A;  4JD2 G;  3Q75 A;  3E37 A;  4O6F A;  5G2N A;  3EHN A;  3L08 A;  2F8X K;  2WXK A;  4W9R A;  4QQI A;  3JCK C;  4DX6 D;  4U96 D;  4GCO A;  3GYZ A;  4B89 A;  2XPI A;  3ZHE A;  5ENQ D;  3D9J A;  1S63 A;  2P9I G;  3UKR G;  2DIW A;  2L6B A;  1N11 A;  2HM8 A;  1IXV A;  2YIN A;  3TWW A;  3IXE A;  4I6E A;  3EUV A;  5ARG A;  2V8S E;  2Y69 E;  2I2O A;  2CG3 A;  2YNQ A;  3L82 A;  2R05 A;  3URZ A;  1OWO A;  4GYO A;  2FI7 A;  3OXF A;  3UTM A;  2F8Y A;  4R7L A;  2WPV A;  3MA5 A;  3DBS A;  3DSW A;  5ENP D;  2GRQ B;  3RSE G;  3KS2 A;  4RLY A;  3I3N A;  2IY0 C;  2Y0B G;  1FT2 A;  2BKG A;  3FH7 A;  3RJV A;  3LEW A;  1N52 A;  3F6Q A;  1SVX A;  3UT8 A;  3RRU A;  3P1U A;  3UIN C;  3ABK E;  3LVR E;  4G23 A;  3UM3 A;  1ELK A;  2LSV A;  2DVW A;  4AM9 A;  3MV2 B;  4YDY A;  3ZFW A;  3HVE A;  5A7D B;  1EPU A;  2WXI A;  4HRN A;  1IQU A;  2RD0 A;  4FLB A;  2PM7 A;  4ILG A;  2IO3 C;  4GTO A;  2AXU A;  4DI3 A;  1NL4 A;  4TRQ A;  2ILR A;  3NZS A;  5AAR A;  2VSX E;  4BX8 A;  1JCR A;  3PNL B;  3QWV A;  1N0Q A;  3U9W A;  2LAH A;  3L13 A;  3Q73 A;  3T5X A;  5D0Q D;  2P9L G;  2L9B A;  4I1A A;  3PZD A;  5ITZ F;  2XS1 A;  1E7V A;  4CDM A;  4KZ0 A;  3TGO A;  3CK9 A;  3SBS A;  1IHG A;  2XZD G;  3CVY A;  1BI7 B;  2OND A;  1Z6T A;  4G24 A;  2P58 C;  2P9K G;  3Q78 A;  1WG0 A;  3JYS A;  4YDE A;  3LS8 A;  4BSZ B;  2R59 A;  4I1M A;  1HE8 A;  3ZYK A;  2AWI A;  1JWG A;  4A55 A;  5BUZ A;  4URK A;  5FTP A;  3R7R A;  1QBQ A;  2XS8 A;  4HFG A;  1DVP A;  1Z3X A;  3L16 A;  1SA4 A;  5AQ7 A;  2CHZ A;  1E96 B;  2XPY A;  3T5V A;  4D10 C;  5FIO A;  1JCS A;  5CRU A;  5AAO A;  3AG4 E;  4HBD A;  3IHV A;  5CRV A;  4HOR A;  1V54 E;  3O4Z A;  1TN6 A;  4PS7 A;  4F1S A;  1XNF A;  1UJJ A;  5ENT D;  2WXF A;  1S0P A;  3FTY A;  4MBG A;  3PE3 A;  2KCL A;  1KT0 A;  4EZL A;  3FWV A;  4U8V D;  5KJK A;  1AP7 A;  3PVL A;  5KCM A;  4GZD A;  4AOF A;  1UN8 A;  3TWQ A;  3UQ3 A;  4U07 A;  3SGH A;  2Y4T A;  2YHE A;  1VDY A;  5JJT A;  1PC2 A;  3TJP A;  3AG2 E;  2AXZ A;  2H6F A;  4C9B B;  1Y8M A;  3PDN A;  2E0I A;  2LAI A;  2XRY A;  1JPL A;  4G8L A;  1QNF A;  5FWQ A;  3I4G A;  4WNF A;  4WAF A;  2I1J A;  3CV0 A;  4ILH B;  1HG2 A;  5FQ8 A;  3KSQ A;  2I1K A;  4LRZ A;  3Q9U C;  3QKY A;  2WXR A;  4F53 A;  4PS8 A;  4LCT A;  4PDX A;  2GRO B;  3AG3 E;  5LCW C;  2R03 A;  4RQI A;  3SO8 A;  1KT1 A;  1N4R A;  4LNB A;  2VGX B;  5BXO A;  3ASF A;  2CG2 A;  2MYO A;  2C2L A;  1UW4 B;  4U0Z A;  3K9I A;  3ISM C;  4TUM A;  4I9E A;  4GML A;  2LUH A;  4CDN A;  1FVH A;  2VGY A;  2FF4 A;  1D8E A;  4GTM A;  4GTQ A;  5LX8 A;  3L6A A;  3R9A B;  4O1O A;  5AJD A;  4ATG A;  2UY1 B;  4XEI G;  5CED B;  1MJ0 A;  3E30 A;  3RKV A;  5E76 A;  4BT8 A;  1OWL A;  3MJW A;  3SY2 A;  1O1R A;  2IEJ A;  4AIF A;  2GW1 A;  2HYZ A;  3EIJ A;  4CT4 A;  5FZR A;  3NOC D;  4J0U A;  5D2M C;  1LTX A;  3Q4A B;  1U2V G;  4NUR A;  3CR3 A;  4J8D A;  1PY1 A;  4G1T A;  3NBN B;  3UT7 A;  3W9G A;  4HLE A;  5AYW D;  4XX5 A;  5ENS D;  4I9C A;  5AIJ A;  5EKQ D;  4KT6 B;  4JEH A;  3UT4 A;  4O60 A;  2JLB A;  1FCH A;  3EHQ A;  4FP7 A;  5IY5 E;  3HXC A;  1MQS A;  3APC A;  3SZ7 A;  1ZBP A;  3DXK G;  1H0A A;  2XZT G;  3CHM A;  4UI9 C;  2QC9 A;  3ZVV A;  1X81 A;  3CVQ A;  3LJN A;  4J7W A;  4JVS A;  5KJN A;  4JB8 P;  3CGH A;  3PRE A;  5H7P A;  4BTA A;  2CFZ A;  3LY7 A;  4A63 B;  1E8X A;  1TR4 A;  3KAE A;  3CST A;  4J8F A;  4FU3 A;  4OAU C;  1ELW A;  3HXF A;  4DI4 A;  4BEP A;  4TXP A;  4WND A;  3FUK A;  2DZN A;  2HR2 A;  3MYV A;  1KLX A;  4WWO A;  5D0O D;  2YHC A;  4GZ5 A;  2BTD A;  3BQO A;  4HOS A;  1H6K A;  2LO6 A;  3LKU A;  4I1O B;  4J8S A;  4ANX A;  4KMO A;  4NIK A;  3TWV A;  4ANU A;  4HRM B;  2BF0 X;  2C0M A;  3LYA A;  1QYM A;  1BD8 A;  2ZGG A;  4GPK A;  4E6H A;  1Z5S C;  4DLO A;  5CMW A;  4CDR A;  3GZ2 A;  4L2L A;  4J6I A;  2FUL A;  3DSX A;  3PEV B;  4FLH A;  3CVN A;  5HS0 A;  1FT1 A;  3DWL G;  1Y6I A;  4EHM A;  3X2Q E;  3SBT B;  2XGO A;  4XE0 A;  3ULE G;  3CVV A;  3SHF A;  3AS8 A;  2Y4U A;  3EU5 A;  5KWD A;  3QWP A;  4TXR A;  5B1A E;  1TN7 A;  4JEU A;  5JJ6 A;  2M63 A;  3PZ3 A;  4AY5 A;  4F7A A;  3APF A;  2EIJ E;  4MRU A;  4KXK B;  5J90 A;  2PQN A;  4PUC A;  1E8Z A;  5LOZ A;  4I6G A;  3JUI A;  3ULQ A;  5LFA A;  4WWP A;  3FUJ A;  1Q2Z A;  5DIZ A;  3FP3 A;  3UKU G;  4U8H A;  3BG1 B;  4UWG A;  3OTN A;  3TXN A;  3ABL E;  3BU8 A;  4KVM A;  3D9H A;  3EJN A;  3LVQ E;  2AJA A;  2VGE A;  3ZYQ A;  4DX1 A;  3Q5M A;  4ANV A;  2MRI A;  5EX3 A;  3SQV A;  4GAA A;  3CQG B;  2MHK A;  4C0M A;  4U8Y D;  4LUN U;  4NQ0 A;  2PZI A;  5CBN A;  3TXM A;  3UM0 A;  3FUM A;  5BV0 A;  4I6J A;  2DCP A;  2OV8 A;  3AAA C;  2E2E A;  4GYY A;  5BV1 A;  3VLD A;  3IKO B;  1SZ9 A;  4GZC A;  2GRL A;  1IYG A;  4HXI A;  2X6J A;  4JPS A;  1ELR A;  4KZC A;  1FVF A;  3QDN A;  4GTT A;  3CK8 A;  4GCN A;  5KNH D;  1TNB A;  5ANL A;  3LJ3 A;  4BET A;  3DPD A;  2UY1 A;  3C5R A;  2P9N G;  1NA0 A;  2AVP A;  1IQR A;  1EF1 C;  3S7D A;  4K5C A;  2IOL A;  2YQ8 A;  4B94 A;  2V5Q C;  3ABM E;  5JHA A;  1Z3Y A;  1OY3 D;  3CVP A;  4EEC A;  4HOT A;  3AS4 A;  5JA4 D;  4BWR A;  5KJL A;  4G25 A;  1YCS B;  3NZU A;  2WXO A;  2XEV A;  4A1G A;  2B0O E;  3PS6 A;  4GA0 A;  4CT0 A;  1BLX B;  2DBA A;  3OXL A;  5BNW A;  1JCQ A;  1N95 A;  1OWN A;  3BG0 B;  4Q94 A;  2H6G A;  5AQA A;  3CHR A;  1KPS B;  4XKB A;  1UOH A;  2ZXW E;  5HRY A;  1HH8 A;  1HU3 A;  3G2U A;  3PZ2 A;  3MX3 A;  1NI1 A;  1E8W A;  3E32 A;  5ARF A;  4PH4 B;  3CVL A;  4N2Q A;  5BPP A;  3FH8 A;  4EZJ A;  3FTS A;  5FQ7 A;  4ZHB A;  4KVO A;  2XQ0 A;  1O1S A;  1H6O A;  2BUG A;  4RG9 A;  2NC9 A;  3U3W A;  2Y3A A;  5E75 A;  3Q47 B;  2FO1 E;  3PRZ A;  4K03 A;  1MYO A;  4F6R D;  2R2L A;  5G04 J;  4OAV B;  3CIA A;  3ZUV B;  4BT9 A;  2X38 A;  3FU0 A;  4HQD A;  4V3I A;  1NZN A;  4G26 A;  3CLJ A;  3IEG A;  1SA5 A;  2J4B A;  3CQC B;  4UUC A;  4RG6 A;  1ZB1 A;  1OXJ A;  1E90 A;  2XRZ A;  1S70 B;  1WAO 1;  2KBX A;  4G2V A;  2WXM A;  4L9P A;  4Z68 A;  2EIK E;  4A3V A;  3ASD A;  3DEO A;  2ETC A;  1HG5 A;  4ACK A;  3DSV A;  3S7B A;  1X5B A;  3TWR A;  3MGB A;  2IJG X;  1QQE A;  1JWF A;  2WXQ A;  4H7Y A;  3TG4 A;  2LSU A;  4HNA D;  4UWK A;  3L22 A;  2V0P A;  5FT9 A;  3HXD A;  4AY6 A;  2WXH A;  4YND A;  3LY8 A;  3ASN E;  3Q7F A;  5CER B;  3UIO C;  2RG8 A;  1S64 A;  3MKQ A;  1GW6 A;  5EID A;  4I17 A;  4U0U A;  5HI7 A;  4E85 A;  2IO2 C;  3KEA A;  1OWM A;  3NF1 A;  3PE4 A;  1OCZ E;  2JEK A;  2IU1 A;  4TUU A;  2EIL E;  3CHQ A;  4BY6 A;  2LNI A;  3Q7A A;  3DPY A;  3C98 A;  4EBA A;  4L23 A;  4I43 A;  4G8K A;  2F0Y A;  2OVB A;  1MHQ A;  5AQ9 A;  5KBA A;  2ETB A;  2KCK A;  1B89 A;  3TG5 A;  4JHJ A;  4CZ2 D;  3FDH A;  1K8K G;  5A6C A;  3WXX A;  2C0L A;  3FTX A;  1N4P A;  3G2T A;  3SFX A;  1WM5 A;  4XI0 A;  4AP2 A;  4JL0 A;  2XHE A;  4DX5 D;  2VJ8 A;  3OXG A;  2GRP B;  2J9Q A;  4GMR A;  3QB2 A;  3ZIM A;  4LG6 A;  3CVW A;  3RU0 A;  4HI9 A;  3ZPJ A;  1LD7 A;  3Q15 A;  3CKB A;  3R9M A;  4LNG A;  3GW4 A;  4DUI A;  2WMO A;  4ZFH A;  5C2Y A;  4U0S A;  3RIB A;  4JZY A;  4P29 A;  3V2O A;  2A5E A;  2WXG A;  3ZU7 B;  2ZIS A;  2J4D A;  3FUI A;  2ETA A;  3JUE A;  4I2Z A;  5EIL A;  4B93 B;  3CVX A;  2RFA A;  3RRM B;  4ANW A;  4GTV A;  5FQ6 A;  1BI8 B;  2VSY A;  3UUX A;  1H6P A;  2J09 A;  4B8A A;  1TEZ A;  5B1B E;  4HOU A;  3UPV A;  3ONL A;  3UXG A;  4XKC A;  3Q79 A;  2BKK B;  3UIP C;  1V55 E;  1TNZ A;  2JAB A;  3VTX A;  1W3B A;  3FU5 A;  3L17 A;  1N0R A;  2ZIR A;  3I5P A;  4UWF A;  3NB2 A;  1SZA A;  3TWT A;  3HYM B;  3RRN B;  3FTV A;  1DCQ A;  3V30 A;  1L5J A;  2OEW A;  3Q49 B;  3HVE B;  4AEZ C;  4DK5 A; 
#chains in the Genus database with same CATH homology
 3PZ1 A;  1O1R A;  2IEJ A;  4GTP A;  1JCR A;  3KSL A;  3Q73 A;  3HXD A;  1JCQ A;  1N95 A;  1O5M A;  1S63 A;  1LTX A;  2H6G A;  3HXB A;  1LD7 A;  3Q7F A;  1LD8 A;  2H6F A;  4LNG A;  1S64 A;  3EUV A;  3PZ2 A;  3DSX A;  1N94 A;  1NI1 A;  3DSS A;  3HXE A;  3DRA A;  3E32 A;  3DSU A;  1O1S A;  4GTS A;  1FT1 A;  3KSQ A;  2ZIS A;  4EHM A;  1TNY A;  3Q78 A;  4GTT A;  3SFY A;  4YDE A;  2BED A;  1TNB A;  3EU5 A;  3HXC A;  3DSW A;  2R2L A;  1TN7 A;  3Q7A A;  3E34 A;  1FT2 A;  1N9A A;  3DPY A;  3PZ3 A;  1QBQ A;  3DST A;  1TN8 A;  2F0Y A;  1DCE A;  1N4R A;  4LNB A;  1MZC A;  4GTV A;  1SA4 A;  1X81 A;  1O1T A;  1KZO A;  1SA5 A;  2H6H A;  4GTR A;  1JCS A;  1D8D A;  1KZP A;  1TNO A;  3Q79 A;  3E33 A;  1TNZ A;  1N4P A;  1TN6 A;  3HXF A;  1TNU A;  1N4S A;  4L9P A;  2ZIR A;  3SFX A;  4GTM A;  1D8E A;  1FPP A;  4MBG A;  4YDO A;  4GTQ A;  3DSV A;  3Q75 A;  4GTO A;  3E37 A;  2H6I A;  3PZ4 A;  1NL4 A;  3C72 A;  3E30 A;  1N4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...