1FQ3A

Crystal structure of human granzyme b
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
227
structure length
227
Chain Sequence
IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIQDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRANZYME B
publication title Crystal structure of the caspase activator human granzyme B, a proteinase highly specific for an Asp-P1 residue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 38
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature ec 3.4.21.79: Granzyme B.
pdb deposition date 2000-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fq3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fq3A02
1O2ZA 1Z6JH 1DANH 1V2MT 2BD2A 2Z7FE 1C9PA 1S81A 5F6MA 3AAUA 1AFQB 5HYOA 3URCA 1KLJH 4X8VH 1IOEA 1C5OH 1YPLH 3KL6A 7LPRA 1FDPA 1GI0A 2UUYA 3SHAH 1C2KA 1CT0E 3SNDA 2BQ7B 3K2UA 4NZLA 1MQ5A 1GI3A 1P03A 1KYNA 1EJMA 1Y5BT 1CGJE 2ZDKA 2VVVA 4OS6A 2ZDLA 4YZUA 3JZ1B 4IS5A 3DFJA 2F3CE 1CHOF 1SGQE 1N8OC 5F8ZA 1AFEH 2BD4A 3MU8A 2STAE 2ZPRA 3TK9A 1ZHRA 2GZ7A 4Y8YA 4GUXA 2C3SA 1D9IA 3SUEA 2FTLE 3UR9A 1QBVH 3GY3A 4MQAA 4WF8A 4HGCA 1G3EA 3O8DA 1ZGVA 1MCVA 1TA6A 4ISNA 5H4IB 3GCNA 4F49A 1K1LA 1DWCH 2VWLA 1AKSA 1ABIH 4WY3A 2ZFTA 3RXUA 1TBQH 1DPOA 4I8LA 1QL9A 3F68H 1XKBC 2FEQH 1MH0A 1MTSA 1ZRKA 2WUBA 2Y7ZA 1GHVH 5FCKA 4WJG2 1QIXB 3RDZA 3PLBA 4ZKOU 8KME2 3VEQB 3UIRA 2GGVB 3M37A 5GCHF 1LCYA 2BB4A 2ZFSA 3C27B 1QR3E 2O8MA 1HAOH 1HDTH 2FOFA 4CBOA 3BG4C 3A7TA 1O5FH 1YPJH 1TNGA 1UHBA 1GCTB 1FN8A 1X7AC 2AMDA 1QBOA 1RTLA 3RXMA 1FPCH 1V2LT 2UWOA 1FNIA 3TGKE 1G36A 4AX9H 1C1WH 1C1RA 2OQUA 5EU8A 1QB9A 1QQ4A 1SMFE 2GVFA 3M3VA 3D49H 2F9BH 1EB1H 2BX3A 3SV8A 2F9VA 1HV7A 1RTKA 4AOQA 4K1TA 3T62A 5HMAA 8LPRA 3BTFE 1TGSZ 1P04A 3GDUA 1DX5M 3BG8A 3ODDA 5GCHG 1C2HA 3P8FA 3A80A 3SU4A 2FESH 3D62A 1T32A 2BZ6H 3RXSA 4X2WA 3A8BA 1SGPE 5IDKA 1VITH 2QXJA 2ZU1A 1ETTH 3BEIB 2Q6FA 1Z6EA 3GY5A 3ITIA 1NS3A 3SGAE 3SI3H 2D2DA 3SN8A 4Q80A 1O3PB 4BXWA 1TX6A 2D8WA 3UREA 5JPMH 3GY8A 3AAVA 2OLGA 2FYQA 1FZZA 3RXVA 2WYGA 3GDSA 4YLUA 4DT7B 3GOVB 4ABEA 1HIAB 1LKBA 2H9EH 5A0AE 5DP6A 1H9HE 3TNTA 4UONA 4UDWH 2RG3A 1XUGA 1HJAC 3MFJA 1F5KU 3HK3B 4IC6A 1PQ5A 2BDCA 2J4IA 4UFEH 1EB2A 1ELAA 4BXSA 2BD8A 3DD2H 1CSOE 4NFFA 2SGEE 2PKSC 1CQQA 3ZVCA 3AW0A 1F0RA 3B9FH 2XTTB 1DXWA 1KDQB 4AG2A 2XBWA 3SV9A 2FIRH 3F1SB 4RKJB 3SHCH 1O3DA 2BD5A 4INKA 5EW1H 3PLKA 2ZDAH 1OP2A 1O2XA 2BQWB 4JZEH 2P95A 3A82A 2GT7A 2ZHDA 5AHGH 4X8UH 1YCPK 1XUKA 1FY8E 3E0PB 3Q3YA 1Y3UA 3S9AA 1OYTH 1G3BA 2PLXA 1VGCB 4B71A 3RXEA 2VJ1A 4FUDA 3M5NA 3GCOA 2ZG0H 3GYLB 4PROA 1AI8H 1UVTH 3QWCH 2RA3A 2ASUB 2P8OC 2Y5FA 4JYVH 5AVDA 5C67A 2IPHA 3EA9A 2A5AA 5EODA 3T28A 4D8NA 1ELVA 1ARCA 1O3KA 3RXCA 4AN7A 1SFIA 2BDAA 1NROH 4IMQA 1ACBE 1YPKH 1RRKA 3SUGA 1GGDC 5E0JA 2BVRH 1IQEA 1O2HA 1O2NA 2H6MA 2J94A 1CU1A 4AG1A 3ZZ9A 1EZUC 1S5SA 1ETSH 1UVUH 2J34A 2ZGCA 3ODFA 4JZDH 2QXGA 5GWZA 1O5CB 1O2TA 2CHAB 1BRBE 1ELDE 1O2YA 1FONA 1ZHPA 1BITA 1ANCA 5DO4H 3MOCA 6CHAC 1AO5A 1DLKB 5E2OA 1E38B 2A31A 2QF3A 5AFYH 3MH6A 1OWEA 4ISOA 1GBCA 3MO6A 5JB8S 4D76A 1XXFA 1GMDG 2VH6A 1ESBA 3DUXH 2GDDA 4JZFH 1EPTB 2G00A 5C5OA 1F7ZA 1TNLA 1MTNC 3UNQA 3MWIU 2P3FH 1EAUA 2G51A 4X2YA 1SLWB 3BEUA 3A87A 4MNXA 1TBRH 4OGXA 1DWBH 1W12U 3I77A 1A0HB 5HXFA 2Y80A 2ZKSA 2ZFRH 3SGQE 4OS7A 3A7VA 1ABJH 2ZCKP 1S83A 4X1NU 7ESTE 3U98H 1TE0A 1P3EA 3NKKA 4TY6A 1W3CA 3O8RA 1QB1A 1GBMA 4ZROA 5JBCS 2GTBA 1SLVB 3VPKA 1J16A 1ELTA 1FI8A 5GDSH 3RUOA 1O2IA 3SNEA 1VCPA 1AB9C 1BTZA 2VWOA 5JBBS 4K5ZA 1HPGA 1QJ1B 1GBFA 1UCYK 2V3OH 4K3JA 6GCHF 1O3LA 1PPFE 3STJA 1QGFA 2ZF0H 4CH8B 3U8OH 2STBE 3CENA 1TMTH 2C93B 1G9IE 1DUEA 1H4WA 5F03A 3VB5A 3SUFA 5I25A 1QA7A 1H8IH 1GJ8B 6LPRA 1P09A 1VZQH 1ESTA 1MBMA 1UTOA 1TRMA 4X1SU 5FBEA 4FUBA 3EYDA 4U30A 1HJ8A 1G3CA 1GDUA 2XYAA 5DP5A 3FANA 3MU4A 1ZLRA 3BTGE 1FXYA 3A86A 3SGBE 3VB4A 1AU8A 1UVOA 1V3XA 2IN2A 1TFXA 2Z3CA 2GT8A 1OYQA 1ZPBA 3IG6B 1ZR0A 1QJ6B 3TJVA 6GCHG 4OS5A 1LPZB 1GJCB 4I7YH 2JETB 4ISIH 2ZA5A 1QRXA 3KGPA 1MKWK 4Y71A 1BRUP 1SQAA 1D3QB 2UUJB 2TRMA 3Q77A 2VIVA 4HTCH 3HGPA 3VGCC 1C5YB 4DURA 2H2ZA 1HAHH 1ZTJA 1O33A 1VITF 2ZO3H 4RKOB 3FP6E 1FQ3A 4YESB 4GCHF 5TJXA 2F91A 3QZRA 1H9LB 3ZV8A 1JMOH 4FUHA 2F9UA 3KEEA 3BSQA 1ZSLA 1K1IA 2BDGA 3Q00A 3RM2H 4FUCA 1H8DH 3UUZA 2ZU4A 1O2SA 3PWCA 2ZU3A 3SNAA 1D4PB 3ZV9A 1Y5UT 2VGCB 1YPEH 2XWAA 5E8EH 1NRNH 5GPIB 2JKHA 4AZ2B 5JBTA 1THRH 2FYRA 3L33A 1P05A 1QURH 1EZXC 1O36A 3TK6A 1A3BH 5CHAB 5EG4A 1GBAA 1GI1A 2V3HH 3QGJA 5DP8A 2BTCE 2F9OA 3GICB 4A6LA 1VITG 4FUGA 1KDQA 5DJ7A 3N7OA 2Y82A 1MQ6A 4GCHG 2EI6A 1T31A 3MU0A 1C5RA 3PLPA 3GCTF 5T6GA 3RMLH 3U69H 3MMGA 1NU9A 1GJ4H 1T8MA 1O32A 4DIIH 2WINI 3RXAA 2G81E 4CRAA 1GBDA 2AIQA 1UK4A 3TH2H 4BTTB 1J8AA 1VJ9U 1QNJA 1GI7B 3KQCA 1MTUA 2FO9A 2WYJA 3SZNA 2QCYA 3P8NA 4NFEA 2FOBA 2WPLS 5DGJA 1XUJA 2BD3A 2BX4A 1NN6A 4KKDA 1K1JA 1K1MA 2FS9A 3Q3XA 2VB0A 1V2PT 1YPGH 3DFLA 3MNSA 1TPPA 3TNSA 5K7RA 1Q31A 5HM2A 2BDHA 2FI4E 3GCTG 2Z3EA 4YLQH 2W5EA 1ELCA 2PR3A 1UVSH 2ZP0H 4GVUA 3QN7A 1IQMA 1LVOA 4M7GA 2HWLB 3M5OA 1DS2E 1XX9A 3M3SA 3UWJH 1P57B 3MH5A 1AY6H 2TGDA 5DPAA 1YLCA 1ZTKA 1N6XA 3HK6B 3T5FH 1O30A 5DP3A 1CE5A 2WPMS 2VH0A 1CA0B 1DSTA 1UTPA 4MTBA 2ZWLH 4AYVB 1XXDA 4DGJA 7GCHF 3BV9B 1TOCB 3S7HB 1DE7H 3UPEA 3NPSA 3JZ2B 3OTJE 1YCPH 3KQBA 4MPUA 1KXEA 1C5TA 1FN6A 3KQDA 1BTXA 4AGKA 3WY8A 1EUFA 1UCYE 3GY6A 4BTIB 2DE8A 1C5SA 1EPTA 2ULLA 1L1NA 1FY3A 1DFPA 1P11E 2BVXH 1HAPH 1L1GA 3BTDE 1V2NT 3SW2B 4K69A 2ZFPH 1P01A 1TPOA 4B73A 1XVOA 4XSKU 4NSYA 1TNIA 4CRGA 1C5MD 1GI6A 1O3BA 1P2JA 1GJ5H 1RIWB 5AF9H 1QRWA 2Y5HA 2AFQB 3EQ0H 3GDVA 3ELAH 3UOUA 3MI4A 1IQKA 4OS4A 2Z9LA 1CGIE 2OUAA 1C1MA 1ZMLA 4Q7YA 4DOQA 1GHYH 3V0XA 1KXCA 4DIHH 4E05H 2LNCA 1C2IA 4WMDA 3A8DA 3RXRA 3UQVA 2SNWA 1FAKH 1ARBA 1B7XB 2ZTZA 4GHTA 2ZHEH 1GJAB 2ZFFH 3RC6A 1QA0A 2CV3A 4AFSA 1Z8GA 1F0TA 2OC7A 1AVGH 3TGJE 1YBWA 3SU1A 4NWKA 4ZHLU 1RJXB 4DVAU 3P95A 2AMPA 1P0SH 4CHAC 3ENSB 2CMYA 1SOZA 1C4V2 1WTGH 1SGYE 3D23A 2VWNA 1W0YH 1C2FA 5E2PA 3BTEE 4ISHH 1TMBH 2B8OH 5K0HA 3URDA 5ABWA 3A89A 2GCHG 3QTOH 1P8VC 4CREA 1FY4A 2W26A 2BZAA 3SI4H 1P3CA 1VJAU 1KXFA 1TNKA 4WXVA 2A0QB 1V2RT 4ABAA 2CJIA 3LONA 3OY6U 2Z9JA 2NU0E 2ZNKH 4IW4E 3CP7A 4JCNA 1C5WB 1QTFA 1IHTH 5F8TA 1UK2A 1UTLM 1TYNA 1T8LA 4OS1A 1UCYH 3KNXA 5C1XA 1C5NH 4A1VA 3SUDA 1GI4A 2D26C 3ZYEA 1KXBA 1SFQB 1LHEH 1SG8B 3T26A 3M7QA 2ANYA 1OOKB 2JH6D 2FZZA 4FUEA 4Y79A 1EQ9A 1TA2A 3SBKA 4X2XA 2ZCLP 1FAXA 3R3GB 9ESTA 1HUTH 4JYUH 1JWTA 3MU5A 3EA7A 2FODA 1E0FD 1LPGB 1PYTD 1VR1H 4U01A 3H7TA 2TGTA 2BLVA 4CR5A 1T4VH 1N8OB 1O2LA 2Z3DA 4YT6H 1L0ZA 1A5GH 3TJOA 1THPB 1EOLA 2FOCA 2PGBB 4I8KA 1CBWB 2O8LA 5A8YA 3K65B 1WUNH 1MKWH 3P92A 3A7ZA 4JK5A 2BDBA 4MLFB 1XKAC 2OBOA 3LOXA 5JB9S 4VGCB 4AORA 3M36A 1WQSA 2FLBH 5DP7A 4ZXXH 4ABDA 1OS8A 4O3TA 1A0LA 1GHAF 4TY7A 4IGDA 3A88A 3DA9B 1C1SA 1LHGH 1PYTC 1ZMNA 1SGFG 1JRTA 1GVZA 1TNHA 5C3NA 2NU3E 4KTSA 3PM3A 2Z9GA 1ZSJA 1FV9A 1CVWH 1TQ7B 3GYMA 5EQRA 3U8TH 1CA8B 1BA8B 4MNVA 4NIVA 2VVCA 2B5TB 4ABGA 5L6NH 3BG4B 4TWYA 2HNTC 4UFFH 1ID5H 3SV2H 2RA0A 4HI3A 4BAOB 4ABHA 1ELEE 1JXPA 1GHZA 1TGTA 1ZMJA 5EGMA 2WV4A 4D7FA 3RXGA 4Y7AA 2IJOB 2QYIA 1GBTA 2QXHA 1GHAG 3U9AH 4ESTE 1BMLA 1P2OA 4MNYA 2A5KA 4E06H 3VXEH 2GD4B 1OKXA 2V6NA 1GBJA 1N1LA 3FVFB 3HATH 4JK6A 2FI3E 3SV6A 3LGIA 3V12A 4XBCA 3MH7A 1DWDH 1P9SA 2R9PA 5EXLA 1MD7A 3RU4D 5CE1A 1OX1A 5CMXH 1O3FA 9LPRA 2Q6GA 4AB8A 5EW2H 1V2QT 2ZECA 3TIUA 4E7NA 3AASA 5JYIA 1EKBB 1VGCC 1AIXH 3SJ8A 1A1RA 1Y5AT 4XBBA 3V7TA 4DCDA 1OWJA 3MNXA 2SGQE 3DT0H 1AZZA 4UFDH 1SI5H 1QBNA 3SJ9A 4Y8ZA 2BY6X 1BTHH 5LPEA 1T8OA 3UOPA 2QY0B 2F9PA 1XMNB 2HGTH 1HJAB 4IMZA 1UTQA 1WBGB 1MUEB 3SNCA 1O3MA 3ZYDA 1O3HA 1KXAA 2V35A 1GG6C 1OWIA 1AD8H 4TPYA 3BIUH 8ESTE 2M5TA 2PKSB 5T6FA 4FUFA 3A84A 1TMUH 3NXPA 5DP9A 1INCA 2ESTE 1A3EH 2G5VA 5AFZH 2CHAC 2UWPA 2QV1A 1U6QA 2ODYB 1GMDF 4TYDA 3L6PA 5C1YA 1GJ7B 1BMMH 3Q3KA 1THSH 1O2PA 1RXPA 1V2JT 2VVUA 4MG3A 4DW2U 1SGTA 1LO6A 4UFGH 2BYAX 2VNTA 1ESAA 4CBNA 1OXGA 4WH8A 3ZZ6A 1UTMA 3STIA 5F8XA 1GL1A 3S9BA 3M5MA 1C5VA 2RCEA 1O5EH 4CRDA 2A1DB 4JZIA 1SGCA 1SC8U 1IQGA 1UJ1A 1Y3YA 4IC5A 1QHRB 1UTJA 1ELFA 1IQHA 2G5NA 5T3HA 2WV5A 2G55A 1V2TT 3A81A 1BDAA 2Q1JA 3LDXH 2Z94A 2P8OB 1SSXA 2Y6TA 5BPEA 1EX3A 4JMYA 3MTYA 3QGNB 1BMAA 1V6DA 8GCHF 2G4UA 3B8JA 1S85A 1HAZB 4AFUA 1JIMA 3P6ZB 3TK5A 1DWEH 1OSSA 4A1TA 2A32A 2B0FA 3PYHA 1GGDB 4I31A 3E91A 2C8XB 4Z6AH 4YM9A 1SGEE 1Z7KA 2BY9X 5LPRA 1HFDA 1WYKA 4NGAH 3MHWU 4LXBH 1ZSKA 1PPHE 1V2KT 2BXTH 1HRTH 1C1UH 1UTNA 3PO1C 1MMJN 2GKVE 5B6OA 4FVDA 4KGAA 2P93A 1V2VT 1AVWA 1W2KH 2BLOA 3A7WA 4X2VA 2R3YA 4YOGA 1CO7E 1P2NA 2BDYA 8GCHG 2HALA 1SLUB 3MO9A 3UWIA 1VCQA 1C5LH 4NSVA 3VB6A 1AWFH 3KCGH 2G52A 1QY6A 1YM0A 1NRRH 1A0JA 1MTNB 3L3TA 2DUCA 4BNRA 1K21H 1M9UA 1LTOA 2UWLA 3FP7E 4A1XA 3RU4T 2O8UA 1HXEH 2O8WA 1EXFA 4I8HA 1QRZA 3GCHC 1TGBA 1O3GA 4MPWA 1L2EA 3SU0A 2C90B 2P59A 1K9OE 1ZRBA 2A2QH 1GMCF 1GVLA 1J14A 2R2WU 3KHVA 2AGGX 3HPTB 2ZFQH 4NCYA 3TH3H 3NUMA 3MNCA 1BT7A 3UFAA 3MNBA 1Y3VA 1O35A 2A45B 3T2NA 5A09A 3HKJB 3GY7A 1K2I1 3RXDA 4ABJA 3ATLA 2FOHA 3GISB 1C5ZB 1LQDB 3T25A 4K2YA 1P02A 4KP0A 4X1RU 3QUMP 1HAVB 4Y10E 1AB9B 3BTWE 1WU1A 1MKXK 1A2CH 1PQ7A 1TRNA 4R8TB 2CN0H 4LZ4B 1O2KA 1OP8A 1O3IA 3ATWA 2WPJS 1EJNA 2TGPZ 1ANDA 1TNJA 2JH0D 1GMCG 1GL0E 3RXTA 1O2OA 1YKTA 1BB0B 2A7HA 4ZUHA 1DXPA 1F0SA 1PQAA 4WMEA 4BAMB 1HAGE 1HIAA 1BTPA 2P94A 2FXRA 3EGKH 3V3MA 2BDIA 1KTTB 5EQSA 4XOJA 1GWAA 3UNRA 2D1JA 1WSSH 2ZPQA 1C2DA 1GJDB 1E36B 1OWKA 1BMNH 2EA3A 4SGAE 4JZ1A 1O5DH 3A8AA 2OCVB 2XBYA 3PV4A 4NIXA 1AQ7A 1IQNA 1F5LA 5LGOA 3B23B 1GDQA 4TPIZ 1SGDE 3U1JB 1NFXA 3VGCB 1F2SE 1A4WH 4LK4A 1UK3A 1NC6A 1EAWA 1O3JA 1G37A 3HKIB 1NO9H 1YGCH 1A5IA 3M5LA 5LPFA 4FU8A 1HYLA 2CF9H 1C1QA 1DVAH 1XUFA 3MH4A 6ESTA 2ZC9H 2C8ZB 5C1UA 1C5XB 1O2QA 1TX7A 1LVMA 3TVJB 4OS2A 1ZZZA 2NU1E 1BTWA 1UHBB 1NT1A 1H9IE 4I8GA 4WVPE 4YT7H 5FCRA 4XBDA 4LOYH 3S0NA 2R0LA 2VIDA 4K60A 3LJJA 2O9QA 1O5GH 2FOEA 2SGAA 3KF2A 4A92A 2W7UA 3OSYA 1Y8TA 1NY22 2GDEH 3BN9A 1V2OT 3FZDA 4RN6A 1S82A 1P2IA 3EA8A 1LHDH 3OU0A 3SJIA 4H4FA 4JYTA 1BBRK 4AB9A 1ANEA 2CXVA 1C1PA 3NZIA 1O3AA 3E90B 2Z9KA 4FUIA 2KAIB 3QDZB 2XBXA 1G2MA 4ABFA 2FLRH 2H9HA 2XC0A 3LGTA 4X8TH 4ASHA 4IN1A 5G4BA 5HGGA 1W7GH 1ANBA 2PHBA 2XC5A 5FX6A 1DSUA 4YOIA 1SGFA 5DG6A 1C1VH 1GBBA 4D9RA 1MZAA 1KLTA 2FOGA 1YPMH 3ZVEA 4Y76A 1GI5A 2XW9A 1RIWC 1P2MA 1FMGA 1QCPA 3RLWH 1YPHC 4D7GA 4I33A 3F6UH 3LIWA 1TAWA 3PMHB 2VIWA 3TJUA 3F9HA 4Y7BA 3GY4A 2Q6DA 1UMAH 2AGEX 2H1UA 2ZHFH 3PMAB 1LPKB 1O37A 1Y3XA 5A8ZA 3RXBA 4FUJA 3ZVGA 2TPIZ 1GBIA 4INHA 4UD9H 2GCTC 3H5CB 4A7IB 2EI7A 3RXKA 3PTBA 1ZGIA 1ZOMA 4X6PA 5FBIA 1CHGA 1PQ8A 1D3DB 5DKMA 2OTVA 3T27A 1ELBA 2XNIA 2SGDE 3OY5U 1FUJA 1AMHA 1CGHA 2ZTYA 4K1SA 2F83A 2G4TA 1Z71A 3FFGA 2GMTC 4J2YB 2ZEBA 1GBEA 2QN5T 1DLEA 1JBUH 4CRCA 2RDLA 1LDTT 3F9EA 5C2ZA 1TRYA 2ZTXA 3ZZ7A 4YOJA 1LKAA 1AFQC 1O3CA 2GCHF 3NCLA 1SQTA 2OP9A 4J1YA 4DG4A 4GHQA 2H5DA 3LH1A 3LKWA 1WCZA 5EPNA 1W0ZU 4I8JA 4NIYA 2Y7XA 4B2CA 1XUHA 4BAHB 2ANMH 1TOMH 3RMOH 4AYYB 1EAXA 3ZZ8A 3S9CA 2Y81A 3SO3A 1GDNA 1Z8IB 1HAIH 1PJPA 2PSXA 4AGJA 2HPPH 1HBTH 1IQFA 1KXDA 3FZZA 1NZQH 1TB6H 1A46H 1ORFA 1SHYA 3GY2A 2I6QA 3QK1A 1E34B 3I78A 3QX5H 4ZMAH 5FXLA 2R2MB 5DP4A 1AZ8A 4X1QU 5ESBA 2DE9A 1EASA 4QT8C 3VXFH 2B9LA 1WTHD 1FIWA 4MDSA 1YP9A 2H9TH 2OC0A 5A0BA 1C1TA 4ZHAA 5EXNA 1KLIH 4XFQA 1XVMA 4ZHMU 2BD7A 2ZQ1A 2Z9IA 4MPXA 1AUJA 1A61H 4BAQB 3E6PH 1C4Y2 1G32B 1C2EA 1YCPM 1MZDA 3MU1A 4CHAB 3BEFB 1FY5A 1LVYA 3NK8A 3RC5A 2GZ8A 4AFZA 1PPGE 3KIDU 3SQHE 2GV6A 4MNWA 2P3UB 1F0UA 2Y5GA 2AH4X 1W7XH 1RS0A 2AS9A 4O9VA 1CBWC 2C8WB 1GCTC 3ZZDA 1ZYOA 1YC0A 4B1TA 2SGPE 5TCCA 1B0EA 4DJZB 1UTKA 1CT4E 1ELGA 1C4U2 4CRBA 3CS7A 4ZKNU 5T6DA 2ZDVH 4VGCC 3SU6A 3TGIE 1FY1A 1O2JA 5LH8A 1GBHA 3A8CA 1BBRE 5FPTA 1XUIA 1C2LA 2WPHS 4GLYA 4B74A 4K8BA 3UTUH 3RXQA 4BAKB 1MKXH 2ZI2H 4H6TA 1CHOG 3LH3A 1DT2A 3SV7A 3AVZA 1O2VA 1ZPZA 4WXIA 3H7OA 2FOAA 4Y6DA 4H6SB 3T29A 5J4SA 2IOTA 1BHXF 3PTNA 2A7CA 3IITA 1GI9B 2XBVA 1NU7B 1AGJA 3RXFA 2BMGB 2PUQH 2UUKB 1P12E 1Q2WA 3RM0H 1TPSA 2XXLA 5EOKA 3E3TA 1W11U 2XWBI 1AWHB 1ZTLA 3ESTA 1QB6A 2EEKA 1NRPH 4CH2B 2AGIX 4XE4A 1C5UA 3F9GA 2XCFA 4NZQA 3BTME 4ZH8A 4F4OC 2WUCA 1SLXB 1SHHB 3ZVAA 3ZZ4A 1LMWB 4NA9H 2BOKA 1O38A 3K6YA 4NG9H 2PFEA 2HVXA 3F9FA 2BD9A 1J17T 2PV9B 1QQUA 2BLQA 1V2ST 1A7SA 1DY8A 1EP5A 3M3TA 2KAIA 2FTMA 4TWWA 1Q3XA 1B0FA 5A8XA 2PTNA 1SVPA 1IHSH 2SGFE 4HFPB 4X0WU 4U2WA 1BOQA 3V13A 1EAIA 1L1JA 1MAYA 1SB1H 3O8CA 2CF8H 1IQLA 3P17H 2GX4A 2ILNA 4X6OA 1V2UT 3A7YA 1W10U 2BY7X 3NWUA 4XDEA 5TCAA 4BOHA 1NESE 2BY5X 2PGQB 1GHWH 3PB1E 4HZHA 1FPHH 1TIOA 4K1EA 5FPSA 1BIOA 1D6WA 1MAXA 4FU7A 2AERH 2YNAA 3LC5A 2A4GA 1Z8RA 1BRCE 1LHCH 2PUXB 4WWYA 1HLTH 1HAYB 2FDAA 1GPZA 1TX8A 1NPMA 1AE5A 3ZVDA 1D6RA 5C5NA 2ODQA 4NWLA 4RSPA 1LHFH 1SGRE 3SJOA 1DUAA 3CS0A 3ATKA 1WOFA 1C1OA 1YYY1 1F92A 4E7RG 1OWDA 2HNTE 1EATA 1BBRH 5IYTA 1O34A 1J9CH 4AFQA 3PMJA 1NM6A 2XCNA 2FI5E 1K1PA 5FAHA 4ZKSU 3SJKA 1TBZH 2A4RA 1QL8A 4U32A 1W8BH 3SU2A 2P16A 1G30B 3U8RH 3C1KA 1C1NA 3P8OA 2R0KA 1E35B 4WMFA 1XM1A 2AMQA 1HJ9A 3RXLA 1WAYB 2ZCHP 1MCTA 3ZVFA 3ZVBA 1KTSB 1FJSA 3VFEA 1V2WT 1JRSA 2TBSA 3QZQA 4NA7A 2ZHWH 2C4FH 1S6FA 3TITA 1C5PA 1DY9A 1PFXC 3KQEA 3SORA 3BIVH 1AN1E 3BTTE 4BTUB 1AUTC 4THNH 1SL3A 5C20A 3ZZ3A 1FLEE 2ZDMA 3QO6A 1EPTC 1T7CA 1FIZA 3ATMA 1HGTH 1S6HA 2OD3B 1GG6B 1Y3WA 1TONA 2J2UA 4CR9A 4ABBA 1BZXE 1C5QA 4Y11E 1ZPCA 1RTFB 2J9NA 3E16B 4O03A 2A2XH 2AEIH 3UQOA 2OBQA 1C2MA 1GCDA 2PKAB 3E8LA 1TWXB 1SQOA 2HRVA 3I29A 2UUFB 3RU4E 2FS8A 3G01A 1JIRA 1GBLA 4KTCA 2FPZA 3ZZCA 3Q76A 4LZ1H 1AVXA 2BVSH 1JOUB 1DDJA 1PPEE 4D9QA 1O39A 1BHXB 1MU8B 3S69A 1QJ7B 4Y8XA 4SGBE 4NA8A 1TGNA 2NU2E 2ZGJA 4B75A 4Z0KA 1QFKH 2NU4E 1CT2E 1RD3B 3UR6A 1L4DA 3TH4H 3VB3A 6CHAB 2O8TA 5JDUB 1L4ZA 1SGIB 4ABIA 5HM9A 1T4UH 4O97A 4B76A 2OC8A 4H42U 2W7SA 3IWMA 1A5HA 3SQEE 2A4QA 1PPZA 1NFWA 3PMBB 1TLDA 4GSOA 3QTVH 4MVNA 4KTUA 2PTCE 2F9NA 1K28D 3M7UA 1TPAE 4MPVA 1MTVA 4IN2A 2XC4A 2YNBA 4UEHH 2A7JA 3PROA 2BXUH 2A4OA 5PTPA 3SU3A 1P9UA 1SPJA 3P8GA 1J15A 2JETC 1DICA 3BTKE 1GHBF 4Q7XA 2AYWA 3PO1B 5EPYA 2NWNA 3RLYH 1ETRH 1NRQH 4I32A 3W94A 5FHTA 5E0GA 1C2JA 1MU6B 3RXJA 2BLWA 3OYPA 5I46H 2ZDNA 2ANKH 4UE7H 1D3PB 2QA9E 3RMMH 2Z6BD 1AHTH 3MYWA 3RXIA 1IQJA 2FOMB 2QXIA 1F5RA 2VGCC 3K9XB 1Z1JA 4KELA 2OINA 4Q7ZA 3BTHE 3LGUA 1EZSC 1D3TB 3KN2A 1KIGH 4X6MA 1O3OA 4FU9A 2VWMA 5GJ4B 2BY8X 3GCHB 1GJ6A 5CHAC 3A85A 1GHBG 5EQQA 1HNEE 5A2MH 2ZU5A 4B2BA 1BQYA 2W3KA 4ZAEA 3ZZ5A 3TPIZ 1EP6A 2FX6A 2PSYA 1VCWA 4INLA 3HGNA 3LGWA 3LT3A 4OGYA 4ZXYH 1YF4A 2TGAA 3AW1A 1KY9A 3BF6H 2ODPA 1IQIA 3EDXB 1KSNA 1BUIA 1EJAA 1G3DA 1O2WA 1YLDA 2ZPSA 1RFNA 2JH5D 3FAOA 3S7KB 2VU8E 1EZQA 2A5IA 4K8YA 1C9TA 2XRCA 2ZZUH 5A0CA 1HCGA 4ISLA 3ATIA 1O5AB 3M7TA 1WV7H 1DOJA 2EI8A 2BQ6B 4FVBA 3K6ZA 2TIOA 1SOTA 1RGQA 2R3UA 3P70B 5ETXA 1GI8B 1AKSB 2FMJA 3LPRA 2THFB 1UO6A 2EC9H 1OWHA 3BTQE 4YTAA 3SU5A 5SGAE 3EE0B 2GP9B 2HPQH 2J38A 3E1XB 1BTYA 3FP8E 2OXSA 5ESTE 1MBQA 1K22H 2H5CA 2ZQ2A 1OPHB 2CGAA 2FM2A 4R0IA 1BCUH 1Y59T 4ZKRU 2J95A 2QC2A 2ZGHA 2VINA 4IBLH 5EXMA 5FPYA 3DHKH 3LGYA 2ALPA 4A5TS 1NFUA 5GXPA 1LVBA 4NIWA 4X8SH 5FX5A 1AE8H 2QIQA 1MTWA 2SFAA 7KMEH 1T8NA 1QL7A 5E0HA 5L2YH 2QGRA 2P3TB 2G8TA 1CA0C 1P2KA 1TABE 4GPGA 1W14U 2B7DH 1GVKB 2ZGXH 1OP0A 4O3UA 1O3NA 2OQ5A 2ZGBH 1PPCE 1B5GH 1EOJA 1P10A 2FWWA 3RP2A 1WQVH 4Y0YE 1GMHF 1GJBB 4YO9A 2ALVA 1GI2A 2VIQA 1MD8A 1GJ9B 5GIBA 4FXGH 2AIPA 3D65E 1GBKA 3W95A 1W13U 5L2ZH 1C2GA 1TQ0B 4Y0ZE 3ZZBA 1Z8JB 1S84A 2BM2A 1P06A 4WH6A 1O5BB 2FP7B 1TGCA 2PKAA 2W3IA 2QF0A 5JBAS 3SNBA 2BHGA 5J4QA 2OC1A 3RXHA 1HXFH 3SOSA 3A7XA 3ZZAA 1HAXB 1NTPA 1H1BA 3TLOA 4B2AA 3VB7A 2GZ9A 3M35A 1NRSH 5L30H 2WPIS 1K1NA 3R0FA 3PWBA 1ZJKA 3U1IB 3RC4A 2BOHB 1DM4B 2QAAA 1GMHG 1O2GH 2PWXA 3RXPA 4BANB 3LGVA 1P2QA 2YOLA 2VIPA 4GAWA 4X1PU 1SGNE 2ZU2A 1DITH 1O0DH 3LJOA 1O3EA 3M61U 1PPBH 1LQEA 2GV7A 2J92A 1SR5C 5DK1A 1O2MA 1BJVA 1TALA 3UY9A 3MO3A 2ZHQH 2V0BA 3OX7U 1BTUA 1UVPA 7GCHG 1O31A 4DY7B 3LC3A 1GHXH 2K1QA 3RXOA 3RMNH 1ZHMA 1G2LA 5BRRE 1O2RA 2HNTF 2GCTB 3A83A 2C8YB 2HOBA 2WPKS 3E0NB 4Q2KA 1IAUA 2PW8H 2LPRA 1HB0B 1Z1IA 1K1OA 1S0RA 1YPHE 3LU9B 3QLPH 2I6SA 3TJNA 2SNVA 2ZIQH 1ZJDA 1SBWA 2FX4A 4X6NA 1E37B 1BRAA 1BJUA 3O8BA 3UNSA 2GMTB 1N6YA 2VIOA 1NFYA 3EAJA 4CRFA 2HLCA 2ANWA 3TU7H 1S0QA 1O2UA 1HAVA
chains in the Genus database with same CATH superfamily
1O2ZA 1Z6JH 1DANH 1V2MT 2BD2A 2Z7FE 1C9PA 1S81A 5F6MA 3AAUA 1AFQB 5HYOA 5EJLA 1KLJH 3URCA 4X8VH 1IOEA 1C5OH 2V7QD 1YPLH 3KL6A 7LPRA 1FDPA 1GI0A 2UUYA 3SHAH 1C2KA 1CT0E 3SNDA 2BQ7B 3K2UA 4NZLA 1MQ5A 1GI3A 1P03A 1KYNA 1EJMA 1Y5BT 1CGJE 2ZDKA 2VVVA 4OS6A 2ZDLA 4YZUA 3JZ1B 4IS5A 3DFJA 2F3CE 1CHOF 1SGQE 1N8OC 2L6OA 5F8ZA 1AFEH 2BD4A 3MU8A 2STAE 2ZPRA 3TK9A 1ZHRA 2GZ7A 4Y8YA 4GUXA 2C3SA 3PV2A 1D9IA 3SUEA 2FTLE 3UR9A 1QBVH 3GY3A 4MQAA 4WF8A 4HGCA 1G3EA 3O8DA 1ZGVA 1MCVA 1TA6A 4ISNA 5H4IB 3GCNA 4F49A 1K1LA 1DWCH 2VWLA 1AKSA 1ABIH 4WY3A 2ZFTA 3RXUA 1TBQH 1DPOA 4I8LA 1QL9A 3F68H 1XKBC 2FEQH 1MH0A 1MTSA 1ZRKA 2WUBA 2Y7ZA 1GHVH 5FCKA 4WJG2 1QIXB 1E1QD 3PLBA 3RDZA 4ZKOU 8KME2 3VEQB 3UIRA 3PRDA 2GGVB 3M37A 5GCHF 1LCYA 2BB4A 2ZFSA 3C27B 1QR3E 2O8MA 1HAOH 1HDTH 2FOFA 4CBOA 3BG4C 3A7TA 2LP6A 1O5FH 1YPJH 1TNGA 1UHBA 1GCTB 1FN8A 1X7AC 2AMDA 4F48B 1QBOA 1RTLA 3RXMA 1FPCH 1V2LT 2UWOA 1FNIA 3TGKE 1G36A 4AX9H 1C1WH 1C1RA 2OQUA 5EU8A 1QB9A 1QQ4A 1SMFE 2GVFA 3M3VA 3D49H 2F9BH 1EB1H 2BX3A 3SV8A 2F9VA 1S6LA 1HV7A 1RTKA 4AOQA 4K1TA 3T62A 5HMAA 8LPRA 3BTFE 1TGSZ 1P04A 3GDUA 1DX5M 3BG8A 3ODDA 5GCHG 1C2HA 3P8FA 3A80A 3SU4A 3DSGA 2FESH 3D62A 1T32A 2QE7D 2BZ6H 3RXSA 4X2WA 3A8BA 1SGPE 5IDKA 1VITH 2QXJA 3PV5A 2ZU1A 1ETTH 3BEIB 2Q6FA 1Z6EA 3GY5A 3ITIA 1NS3A 3SGAE 3SI3H 2D2DA 3SN8A 4Q80A 1O3PB 4BXWA 1TX6A 2D8WA 3UREA 5JPMH 3GY8A 3AAVA 2OLGA 2FYQA 1FZZA 3RXVA 2WYGA 3GDSA 4YLUA 4DT7B 3GOVB 4ABEA 1HIAB 1LKBA 2H9EH 5A0AE 5DP6A 1H9HE 3TNTA 4UONA 4UDWH 2RG3A 1XUGA 1HJAC 5C0TA 3MFJA 1F5KU 3HK3B 4IC6A 1PQ5A 2BDCA 2J4IA 4UFEH 1EB2A 1ELAA 4BXSA 2BD8A 3DD2H 1CSOE 4NFFA 2SGEE 2PKSC 1CQQA 3ZVCA 3AW0A 1F0RA 3B9FH 2XTTB 1DXWA 1KDQB 2CK3D 4AG2A 2XBWA 3SV9A 2FIRH 3F1SB 4RKJB 3SHCH 1O3DA 2BD5A 4INKA 5EW1H 3PLKA 2ZDAH 1OP2A 1O2XA 2BQWB 4JZEH 1H8ED 2P95A 3A82A 2GT7A 2ZHDA 5AHGH 4X8UH 1YCPK 1XUKA 1FY8E 3E0PB 3Q3YA 1Y3UA 3S9AA 1OYTH 1G3BA 2PLXA 1VGCB 4B71A 3RXEA 2VJ1A 4FUDA 3M5NA 3GCOA 2ZG0H 2QF4A 3GYLB 4PROA 1AI8H 1UVTH 3QWCH 2RA3A 2ASUB 2P8OC 2Y5FA 4JYVH 5AVDA 5C67A 2IPHA 3EA9A 2A5AA 5EODA 3T28A 4D8NA 1ELVA 1ARCA 1O3KA 3RXCA 4AN7A 1SFIA 2BDAA 4RT0A 1NROH 4IMQA 1ACBE 1YPKH 1RRKA 3SUGA 3WWFA 1GGDC 5E0JA 2BVRH 1IQEA 5KGOA 3OAAD 1O2HA 1O2NA 2H6MA 2J94A 1CU1A 4AG1A 3ZZ9A 1EZUC 1S5SA 1ETSH 1UVUH 2J34A 2ZGCA 3ODFA 4JZDH 2QXGA 5GWZA 1O5CB 1O2TA 2CHAB 1BRBE 1ELDE 1O2YA 1FONA 1ZHPA 1BITA 1ANCA 3OEED 5DO4H 3MOCA 6CHAC 1AO5A 1DLKB 3OFND 5E2OA 1E38B 2A31A 2QF3A 5AFYH 3MH6A 1OWEA 4ISOA 1GBCA 3MO6A 5JB8S 4D76A 1XXFA 1GMDG 2VH6A 1ESBA 3DUXH 2GDDA 4TT3D 4JZFH 1EPTB 2G00A 5C5OA 1F7ZA 1TNLA 1MTNC 2XNDD 3UNQA 3MWIU 2P3FH 1EAUA 2G51A 4X2YA 1SLWB 3BEUA 3A87A 4MNXA 1TBRH 4OGXA 1DWBH 1W12U 3I77A 1A0HB 5HXFA 5T1VA 4Q63A 2Y80A 2ZKSA 2ZFRH 3SGQE 4OS7A 3A7VA 1ABJH 2ZCKP 1S83A 4X1NU 7ESTE 3U98H 1TE0A 1P3EA 3NKKA 4TY6A 5C0UA 1W3CA 3O8RA 1QB1A 1GBMA 4ZROA 5JBCS 2GTBA 1SLVB 3PRBA 3VPKA 1J16A 1ELTA 1FI8A 5GDSH 3RUOA 1O2IA 3FN8A 3SNEA 1VCPA 1AB9C 1BTZA 2VWOA 5JBBS 2KCPA 4K5ZA 1HPGA 1QJ1B 1GBFA 1UCYK 2EY4C 2V3OH 4K3JA 1O3LA 1PPFE 2J5UA 5DN6D 6GCHF 3STJA 1QGFA 2ZF0H 4CH8B 3U8OH 2STBE 3CENA 1TMTH 2C93B 1G9IE 5HIZA 1DUEA 1H4WA 5F03A 3VB5A 3SUFA 5I25A 1QA7A 1H8IH 1GJ8B 6LPRA 1P09A 1VZQH 1ESTA 1MBMA 1UTOA 1TRMA 4X1SU 5FBEA 4FUBA 3EYDA 4U30A 1HJ8A 1G3CA 1GDUA 2XYAA 5DP5A 3FANA 3MU4A 1ZLRA 3BTGE 1FXYA 3A86A 3SGBE 3VB4A 1AU8A 1UVOA 1V3XA 2IN2A 1TFXA 2Z3CA 2GT8A 1OYQA 1ZPBA 3IG6B 1ZR0A 1QJ6B 2WV9A 3TJVA 5B6LA 6GCHG 4OS5A 1LPZB 1GJCB 4I7YH 2JETB 4ISIH 2ZA5A 1QRXA 3KGPA 1MKWK 4Y71A 1BRUP 1SQAA 1D3QB 2UUJB 2TRMA 3Q77A 2VIVA 4HTCH 3HGPA 3VGCC 1C5YB 4DURA 2H2ZA 1HAHH 1ZTJA 2AHME 1O33A 1VITF 2ZO3H 4RKOB 3FP6E 1FQ3A 4YESB 4GCHF 5TJXA 2F91A 3QZRA 1H9LB 3ZV8A 1JMOH 4XD7D 4FUHA 2F9UA 3KEEA 3BSQA 1ZSLA 1K1IA 2BDGA 3Q00A 3RM2H 4FUCA 1H8DH 3UUZA 2ZU4A 1O2SA 3PWCA 2ZU3A 3SNAA 1D4PB 3ZV9A 1Y5UT 2VGCB 1YPEH 2XWAA 5E8EH 1NRNH 5GPIB 2JKHA 4AZ2B 5JBTA 1THRH 2FYRA 3L33A 1P05A 1QURH 1EZXC 1O36A 3TK6A 1A3BH 5CHAB 5EG4A 4B6FA 1GBAA 1GI1A 2V3HH 3QGJA 5DP8A 2BTCE 2F9OA 3GICB 4A6LA 1VITG 2KZ4A 4FUGA 1KDQA 4YXWD 5DJ7A 3N7OA 2Y82A 1MQ6A 4GCHG 2EI6A 3OTPA 1T31A 3MU0A 1C5RA 3PLPA 3GCTF 5T6GA 3RMLH 3U69H 3MMGA 1NU9A 1GJ4H 1T8MA 1O32A 4DIIH 2V3MA 2WINI 3RXAA 1QZ8A 2G81E 4CRAA 4P02A 1GBDA 2AIQA 1UK4A 3TH2H 4BTTB 1J8AA 1VJ9U 3GS9A 1QNJA 1GI7B 3KQCA 1MTUA 2FO9A 2WYJA 3SZNA 2QCYA 3P8NA 4NFEA 2FOBA 2WPLS 5DGJA 1XUJA 2BD3A 2BX4A 1NN6A 4KKDA 1K1JA 1K1MA 2FS9A 3Q3XA 3NRLA 2VB0A 1V2PT 1YPGH 3DFLA 3MNSA 1TPPA 3TNSA 5K7RA 1Q31A 5HM2A 3SYJA 2BDHA 2FI4E 3GCTG 2Z3EA 4YLQH 2W5EA 1ELCA 2PR3A 1UVSH 1W0KD 2ZP0H 4GVUA 3QN7A 1IQMA 1LVOA 4M7GA 2HWLB 3M5OA 1DS2E 1XX9A 1EFRD 3M3SA 3UWJH 1P57B 2KCAA 3MH5A 1AY6H 2TGDA 5DPAA 1YLCA 1ZTKA 1N6XA 3HK6B 3T5FH 1O30A 1W0JD 5DP3A 1CE5A 2WPMS 2VH0A 1CA0B 1DSTA 1UTPA 4MTBA 2ZWLH 4AYVB 1XXDA 4DGJA 7GCHF 3BV9B 1TOCB 3S7HB 1DE7H 3UPEA 3NPSA 3JZ2B 3OTJE 1YCPH 3KQBA 4MPUA 1KXEA 1C5TA 1FN6A 3KQDA 1BTXA 4AGKA 3WY8A 1EUFA 1UCYE 3GY6A 4BTIB 2DE8A 1C5SA 1EPTA 2ULLA 1L1NA 1FY3A 1DFPA 1P11E 2BVXH 1HAPH 1L1GA 3BTDE 1V2NT 3SW2B 4K69A 2ZFPH 1P01A 1TPOA 4B73A 1XVOA 4XSKU 4NSYA 1TNIA 4CRGA 1C5MD 1GI6A 1O3BA 1P2JA 1GJ5H 1RIWB 5AF9H 1QRWA 2Y5HA 2AFQB 3EQ0H 3GDVA 3ELAH 3UOUA 3MI4A 4DT4A 1IQKA 4OS4A 1NBMD 2Z9LA 1CGIE 2OUAA 1C1MA 1ZMLA 4Q7YA 4DOQA 1GHYH 3V0XA 1KXCA 4DIHH 4E05H 2LNCA 1C2IA 4WMDA 3A8DA 3RXRA 3UQVA 2SNWA 1FAKH 1ARBA 1B7XB 2ZTZA 4GHTA 2ZHEH 1GJAB 2ZFFH 3RC6A 1QA0A 2CV3A 4AFSA 1Z8GA 1F0TA 2OC7A 1AVGH 3DCLA 5CDFE 3TGJE 1YBWA 3SU1A 4NWKA 4ZHLU 1RJXB 4DVAU 3P95A 1SQRA 2AMPA 1P0SH 4CHAC 3WW7A 3ENSB 2CMYA 1SOZA 1C4V2 1WTGH 1SGYE 3D23A 2VWNA 1W0YH 1C2FA 5E2PA 3BTEE 4ISHH 1TMBH 2B8OH 5K0HA 3URDA 5ABWA 3A89A 2GCHG 3QTOH 1P8VC 4CREA 1FY4A 2W26A 2BZAA 3SI4H 1P3CA 1VJAU 1KXFA 1TNKA 4WXVA 2A0QB 1V2RT 4ABAA 2CJIA 3LONA 3OY6U 2Z9JA 2NU0E 2ZNKH 4IW4E 1MABB 3CP7A 4JCNA 1C5WB 1QTFA 1IHTH 5F8TA 1UK2A 1UTLM 1TYNA 1T8LA 4OS1A 1UCYH 3KNXA 5C1XA 1C5NH 4A1VA 3SUDA 1GI4A 2D26C 3ZYEA 1KXBA 1SFQB 1LHEH 1SG8B 3T26A 2WSSD 3M7QA 2ANYA 1OOKB 2JH6D 2FZZA 4FUEA 4Y79A 1EQ9A 1TA2A 3SBKA 2RFKC 4X2XA 2ZCLP 1FAXA 3R3GB 9ESTA 1HUTH 4JYUH 1JWTA 3MU5A 3EA7A 2FODA 1E0FD 1LPGB 1PYTD 1VR1H 4U01A 3H7TA 2TGTA 2BLVA 4CR5A 1T4VH 5KECA 1N8OB 2QF5A 1O2LA 1E79D 2Z3DA 4YT6H 1L0ZA 1A5GH 3TJOA 1THPB 1EOLA 2FOCA 2PGBB 4I8KA 1CBWB 2O8LA 5A8YA 3K65B 2YMSD 1WUNH 1MKWH 3P92A 3A7ZA 4JK5A 2BDBA 4MLFB 1XKAC 3F2GA 2OBOA 3LOXA 5JB9S 4VGCB 4AORA 3M36A 1WQSA 2FLBH 5DP7A 4ZXXH 4ABDA 1COWD 1OS8A 4O3TA 1A0LA 1GHAF 4TY7A 4IGDA 3A88A 3DA9B 1C1SA 1LHGH 1PYTC 1ZMNA 1SGFG 1JRTA 1GVZA 5EJ1A 1TNHA 5C3NA 2NU3E 4KTSA 3PM3A 5FL7D 2Z9GA 1ZSJA 1FV9A 1CVWH 1TQ7B 3GYMA 5EQRA 3U8TH 1CA8B 1BA8B 4MNVA 4NIVA 2VVCA 2B5TB 2YMSC 4ABGA 5L6NH 3BG4B 4TWYA 2HNTC 4UFFH 1ID5H 3SV2H 2RA0A 4HI3A 4BAOB 4ABHA 1ELEE 1JXPA 1GHZA 1TGTA 1ZMJA 5EGMA 2WV4A 5GNDA 2IJD1 4D7FA 3RXGA 4Y7AA 2IJOB 2QYIA 1GBTA 2QXHA 1GHAG 3U9AH 4ESTE 1BMLA 1P2OA 4MNYA 2A5KA 1E1RD 4E06H 3VXEH 2GD4B 2VBCA 1OKXA 2V6NA 1GBJA 1N1LA 3FVFB 3HATH 4JK6A 2FI3E 3SV6A 3LGIA 3V12A 4XBCA 3MH7A 1DWDH 1P9SA 2R9PA 5EXLA 1MD7A 3RU4D 5CE1A 1OX1A 5CMXH 1O3FA 9LPRA 2Q6GA 4AB8A 5EW2H 2W6JD 1V2QT 2ZECA 3TIUA 4E7NA 3AASA 5JYIA 1EKBB 1VGCC 1AIXH 3SJ8A 1A1RA 5HIYA 1Y5AT 4XBBA 3V7TA 4DCDA 1OWJA 3MNXA 3AK5A 2SGQE 3DT0H 1AZZA 4UFDH 1SI5H 1QBNA 3SJ9A 4Y8ZA 1KMHB 2BY6X 1BTHH 5LPEA 1T8OA 3UOPA 2QY0B 2F9PA 1XMNB 2HGTH 1HJAB 4IMZA 1UTQA 1WBGB 1MUEB 3SNCA 1O3MA 3ZYDA 1O3HA 1KXAA 2V35A 1GG6C 1OWIA 1AD8H 4TPYA 3BIUH 8ESTE 2M5TA 2PKSB 5T6FA 4FUFA 3A84A 1TMUH 3NXPA 5DP9A 1INCA 2ESTE 1A3EH 2G5VA 3ZIAD 5AFZH 2CHAC 2UWPA 1YY3A 2QV1A 1U6QA 2ODYB 1GMDF 4TYDA 3L6PA 5C1YA 1GJ7B 1BMMH 3Q3KA 1THSH 1O2PA 1RXPA 1V2JT 2VVUA 4MG3A 4DW2U 1SGTA 1LO6A 4UFGH 2BYAX 2VNTA 1ESAA 4CBNA 1OXGA 4WH8A 3ZZ6A 1UTMA 3STIA 5F8XA 1GL1A 3S9BA 2IPQX 3M5MA 1C5VA 2RCEA 1O5EH 4CRDA 2A1DB 4JZIA 1SGCA 1SC8U 1IQGA 1UJ1A 1Y3YA 4IC5A 1QHRB 1UTJA 1ELFA 1IQHA 2G5NA 5T3HA 2WV5A 2G55A 1V2TT 3A81A 1BDAA 2Q1JA 3LDXH 2Z94A 2P8OB 1SSXA 2Y6TA 5BPEA 1EX3A 4JMYA 3MTYA 3QGNB 1BMAA 1V6DA 8GCHF 2G4UA 3B8JA 1S85A 1HAZB 4AFUA 1JIMA 3DSOA 3P6ZB 3TK5A 1DWEH 2KM0A 1OSSA 4A1TA 1OHHD 2A32A 2B0FA 3PYHA 1GGDB 4I31A 3E91A 2C8XB 4Z6AH 4YM9A 1SGEE 1Z7KA 2BY9X 5LPRA 1HFDA 1WYKA 4NGAH 3MHWU 4LXBH 1ZSKA 1PPHE 1V2KT 2WHXA 2BXTH 1HRTH 1C1UH 1UTNA 3PO1C 1MMJN 2GKVE 5B6OA 4FVDA 4KGAA 2P93A 1V2VT 1AVWA 1W2KH 2BLOA 3A7WA 4X2VA 5IK2D 2R3YA 4YOGA 1WXRA 1CO7E 1P2NA 2BDYA 8GCHG 2HALA 1SLUB 3MO9A 3UWIA 1VCQA 1C5LH 4NSVA 3VB6A 1AWFH 3KCGH 2G52A 1QY6A 1YM0A 1NRRH 1A0JA 1MTNB 3L3TA 2DUCA 4BNRA 1K21H 1M9UA 2KR7A 1LTOA 2UWLA 3FP7E 4A1XA 3RU4T 2O8UA 1HXEH 2O8WA 1EXFA 4I8HA 1QRZA 3GCHC 1TGBA 1O3GA 4MPWA 1L2EA 3SU0A 2C90B 2P59A 1K9OE 1ZRBA 2A2QH 1GMCF 1GVLA 1J14A 2R2WU 3KHVA 2AGGX 3HPTB 2ZFQH 4NCYA 3TH3H 3NUMA 3MNCA 1BT7A 3H09A 3MNBA 3UFAA 1Y3VA 2KX4A 1O35A 2A45B 3T2NA 5A09A 3HKJB 3GY7A 1K2I1 3RXDA 4ABJA 3ATLA 2FOHA 3GISB 1C5ZB 1LQDB 3T25A 4K2YA 1P02A 4KP0A 4X1RU 3QUMP 1HAVB 4Y10E 1AB9B 3BTWE 1WU1A 1MKXK 1A2CH 1PQ7A 1TRNA 4R8TB 2CN0H 4F55A 4LZ4B 1O2KA 1OP8A 1O3IA 3ATWA 2WPJS 1EJNA 2TGPZ 1ANDA 1TNJA 2JH0D 5EIYA 1GMCG 1GL0E 3RXTA 1O2OA 1YKTA 1BB0B 2A7HA 4ZUHA 1DXPA 1F0SA 1PQAA 4WMEA 4BAMB 1HAGE 1HIAA 1BTPA 3F0OA 2P94A 2FXRA 3EGKH 3V3MA 2BDIA 1KTTB 5EQSA 4XOJA 1GWAA 3UNRA 2D1JA 1WSSH 2ZPQA 1C2DA 1GJDB 1E36B 1OWKA 1BMNH 2EA3A 4SGAE 4JZ1A 1O5DH 3A8AA 2OCVB 2XBYA 3PV4A 4NIXA 1FX0B 1AQ7A 1IQNA 1F5LA 5LGOA 3B23B 1GDQA 4TPIZ 1SGDE 5C17A 3U1JB 1NFXA 3VGCB 1BMFD 1F2SE 5CHBA 1A4WH 4LK4A 1UK3A 1NC6A 4RI0A 1EAWA 1O3JA 1G37A 3HKIB 1NO9H 1YGCH 3OE7D 1A5IA 4ASUD 3M5LA 5LPFA 4FU8A 2PP6A 1HYLA 2CF9H 1C1QA 1DVAH 1XUFA 3MH4A 6ESTA 2KCYA 2ZC9H 2C8ZB 5C1UA 1C5XB 1O2QA 1TX7A 1LVMA 3TVJB 4OS2A 2WPDD 1ZZZA 2NU1E 1BTWA 1UHBB 1NT1A 1H9IE 4I8GA 4WVPE 1YLNA 3N7DA 4YT7H 5FCRA 4XBDA 4LOYH 3S0NA 2R0LA 2VIDA 4K60A 3LJJA 2O9QA 1O5GH 2FOEA 2SGAA 3KF2A 4A92A 2W7UA 3OSYA 1Y8TA 1NY22 2GDEH 3BN9A 1V2OT 3FZDA 1H8HD 4RN6A 1S82A 1P2IA 3EA8A 1LHDH 3OU0A 3SJIA 4H4FA 4JYTA 1BBRK 4AB9A 1ANEA 2CXVA 1C1PA 3NZIA 1O3AA 3E90B 2Z9KA 4FUIA 2KAIB 3QDZB 2XBXA 1G2MA 4ABFA 2FLRH 2H9HA 2XC0A 3LGTA 4X8TH 4ASHA 4IN1A 5G4BA 5HGGA 1W7GH 1ANBA 2PHBA 2GJGA 2XC5A 5FX6A 1DSUA 4YOIA 1SGFA 5DG6A 1C1VH 1GBBA 4D9RA 1MZAA 1KLTA 2FOGA 1YPMH 3ZVEA 4Y76A 1GI5A 2XW9A 1RIWC 1P2MA 1FMGA 1QCPA 3RLWH 1YPHC 3SZEA 4D7GA 4I33A 3F6UH 3LIWA 1TAWA 3PMHB 2VIWA 3TJUA 3F9HA 4Y7BA 3GY4A 2Q6DA 1UMAH 2AGEX 2H1UA 2ZHFH 3PMAB 1LPKB 1O37A 1Y3XA 5A8ZA 3RXBA 4FUJA 3ZVGA 2TPIZ 5DSFA 1GBIA 4INHA 4UD9H 2GCTC 3H5CB 4A7IB 2EI7A 3RXKA 3CNRA 3PTBA 1ZGIA 1ZOMA 4X6PA 5FBIA 1CHGA 1PQ8A 1D3DB 1WDIA 5DKMA 2OTVA 3T27A 1ELBA 2XNIA 2SGDE 3N7EA 3OY5U 1FUJA 1AMHA 1CGHA 2ZTYA 4K1SA 2F83A 1YWUA 2G4TA 1Z71A 3FFGA 2GMTC 4J2YB 2ZEBA 1GBEA 2QN5T 1DLEA 1JBUH 4CRCA 2RDLA 1LDTT 3F9EA 5C2ZA 3KYFA 1TRYA 2ZTXA 3ZZ7A 4YOJA 1LKAA 1AFQC 1O3CA 2GCHF 3NCLA 1SQTA 2OP9A 4J1YA 4DG4A 4GHQA 2H5DA 3LH1A 3LKWA 1WCZA 5EPNA 1W0ZU 4I8JA 4ZCNA 4NIYA 2Y7XA 4B2CA 1XUHA 4BAHB 2ANMH 1TOMH 3RMOH 4AYYB 1EAXA 3ZZ8A 3S9CA 2Y81A 3SO3A 1GDNA 1Z8IB 1HAIH 1PJPA 2PSXA 4AGJA 2HPPH 1HBTH 1IQFA 1KXDA 3FZZA 1NZQH 1TB6H 1A46H 1ORFA 1SHYA 3GY2A 2I6QA 3QK1A 1E34B 3I78A 3QX5H 4ZMAH 5FXLA 2R2MB 5DP4A 1AZ8A 4X1QU 5ESBA 2DE9A 1EASA 4QT8C 3VXFH 2B9LA 1WTHD 1FIWA 4MDSA 1YP9A 2H9TH 2OC0A 5A0BA 1C1TA 4ZHAA 5EXNA 1KLIH 4XFQA 1XVMA 4ZHMU 2BD7A 2ZQ1A 2Z9IA 4MPXA 4TSFD 2OK5A 1AUJA 1A61H 4BAQB 3E6PH 1C4Y2 1G32B 1C2EA 1YCPM 1MZDA 3MU1A 4CHAB 3BEFB 1FY5A 1LVYA 3NK8A 3RC5A 2GZ8A 4AFZA 1PPGE 3KIDU 3SQHE 2GV6A 3F2HA 4MNWA 2P3UB 1F0UA 2Y5GA 2AH4X 1W7XH 1RS0A 2AS9A 4O9VA 1CBWC 2C8WB 1GCTC 2XOKD 3ZZDA 1ZYOA 2JDID 4Q4LA 1YC0A 1NBME 2SGPE 4B1TA 5TCCA 1B0EA 4DJZB 1UTKA 1CT4E 1ELGA 1C4U2 4CRBA 3CS7A 4ZKNU 5T6DA 2ZDVH 4VGCC 3SU6A 3TGIE 1FY1A 2K8IA 1O2JA 5LH8A 1GBHA 3A8CA 1BBRE 5FPTA 1XUIA 3F2FA 1C2LA 2WPHS 4GLYA 4B74A 4K8BA 3UTUH 3RXQA 4BAKB 1MKXH 2ZI2H 4H6TA 1CHOG 3LH3A 1DT2A 2K0QA 3SV7A 3AVZA 1O2VA 1ZPZA 4WXIA 3H7OA 2FOAA 4Y6DA 4H6SB 3T29A 5J4SA 2IOTA 1BHXF 3PTNA 2A7CA 3IITA 1GI9B 2XBVA 1NU7B 3KQ5A 1AGJA 3RXFA 2BMGB 2PUQH 2UUKB 1P12E 1Q2WA 3RM0H 1TPSA 2XXLA 5EOKA 3E3TA 5HKKD 1W11U 2XWBI 1AWHB 1ZTLA 3ESTA 3UAIC 1QB6A 2EEKA 1NRPH 4CH2B 2HLDD 2AGIX 4XE4A 1C5UA 3F9GA 2XCFA 4NZQA 3BTME 4ZH8A 4F4OC 2WUCA 1SLXB 1SHHB 3ZVAA 3ZZ4A 1LMWB 4NA9H 2BOKA 1O38A 3K6YA 4NG9H 2PFEA 2HVXA 3F9FA 2BD9A 3OEHD 1J17T 2PV9B 2HVYB 1QQUA 2BLQA 1V2ST 1A7SA 1DY8A 1EP5A 3M3TA 2KAIA 2FTMA 4TWWA 1Q3XA 1B0FA 5A8XA 2PTNA 3F3BA 1SVPA 4XRNA 1IHSH 2SGFE 4HFPB 4X0WU 4U2WA 1BOQA 3V13A 1EAIA 1L1JA 1MAYA 1SB1H 3O8CA 2CF8H 1IQLA 3P17H 2GX4A 2ILNA 4X6OA 1V2UT 3A7YA 1W10U 2BY7X 3NWUA 4XDEA 4FETA 5TCAA 4BOHA 1NESE 2YMSB 4ACAA 2BY5X 2PGQB 1GHWH 3PB1E 4HZHA 1FPHH 1TIOA 4K1EA 5FPSA 1BIOA 1D6WA 1MAXA 4FU7A 2AERH 2YNAA 3LC5A 2A4GA 1Z8RA 1BRCE 1LHCH 2PUXB 4WWYA 1HLTH 1HAYB 2WZQA 2FDAA 1GPZA 1TX8A 1NPMA 1AE5A 3ZVDA 1D6RA 5C5NA 2ODQA 4NWLA 4RSPA 1LHFH 1SGRE 2J98B 1DUAA 3CS0A 3SJOA 3ATKA 1WOFA 1C1OA 1YYY1 1F92A 4OM9A 1OWDA 2HNTE 4E7RG 1EATA 1BBRH 5IYTA 1O34A 1J9CH 4AFQA 3PMJA 1NM6A 2XCNA 3FO8D 2FI5E 1K1PA 5FAHA 4ZKSU 3SJKA 1TBZH 2A4RA 3W1EA 1QL8A 1UW7A 4U32A 1W8BH 3SU2A 2P16A 1G30B 3U8RH 3C1KA 1C1NA 3P8OA 2R0KA 1E35B 4WMFA 1XM1A 2AMQA 1HJ9A 2F43B 2LELA 3RXLA 1WAYB 2ZCHP 1MCTA 3ZVFA 3ZVBA 1KTSB 1FJSA 3VFEA 1V2WT 1JRSA 2TBSA 3QZQA 4NA7A 4AC9A 2ZHWH 2C4FH 1S6FA 3TITA 1C5PA 1DY9A 3VG8A 1PFXC 3KQEA 3SORA 3BIVH 1AN1E 3BTTE 3F0PA 4BTUB 1AUTC 4THNH 1SL3A 2EQNA 3ZZ3A 5C20A 1FLEE 2KCOA 2ZDMA 3QO6A 1K0HA 1EPTC 1T7CA 1FIZA 3ATMA 1HGTH 1S6HA 2OD3B 1GG6B 1Y3WA 2J97A 1TONA 2J2UA 4CR9A 4ABBA 1BZXE 1C5QA 4Y11E 1ZPCA 1RTFB 2J9NA 3E16B 4O03A 2A2XH 2AEIH 3UQOA 2OBQA 3KYGA 1C2MA 1GCDA 2PKAB 3E8LA 1TWXB 1SQOA 2HRVA 3I29A 2UUFB 3UB0A 3RU4E 2FS8A 3G01A 1JIRA 1GBLA 4KTCA 2FPZA 3ZZCA 3Q76A 4LZ1H 1AVXA 2BVSH 1JOUB 1DDJA 4Z1MD 1PPEE 4D9QA 1O39A 1BHXB 1MU8B 3S69A 1QJ7B 4Y8XA 4SGBE 4NA8A 1TGNA 2NU2E 2ZGJA 4B75A 4Z0KA 1QFKH 2NU4E 1CT2E 2KFWA 1RD3B 3UR6A 1L4DA 3TH4H 3VB3A 6CHAB 2O8TA 5JDUB 1L4ZA 1SGIB 2JJ1D 2L74A 4ABIA 5HM9A 1T4UH 4O97A 4B76A 2OC8A 4H42U 2W7SA 3IWMA 1A5HA 3SQEE 2A4QA 1PPZA 1NFWA 3PMBB 1TLDA 4GSOA 3QTVH 4MVNA 4KTUA 2PTCE 2F9NA 1K28D 3M7UA 4HG6A 1TPAE 4MPVA 1MTVA 4IN2A 2XC4A 2YNBA 4UEHH 2A7JA 3PROA 2BXUH 4FOUC 2A4OA 5PTPA 3SU3A 1P9UA 1SPJA 3P8GA 1J15A 2JETC 1DICA 3BTKE 1GHBF 4Q7XA 2AYWA 3PO1B 4RT1A 5EPYA 2NWNA 3RLYH 1ETRH 1NRQH 4I32A 3W94A 5FHTA 5E0GA 1C2JA 1MU6B 3RXJA 2BLWA 3OYPA 5I46H 2ZDNA 2ANKH 4UE7H 1D3PB 2QA9E 3RMMH 2Z6BD 1AHTH 3MYWA 3RXIA 1IQJA 2FOMB 2QXIA 1F5RA 2VGCC 3K9XB 1Z1JA 4KELA 5C94A 2OINA 4Q7ZA 3BTHE 3LGUA 1EZSC 1D3TB 3KN2A 1KIGH 4X6MA 1O3OA 4FU9A 2VWMA 5GJ4B 2BY8X 3GCHB 1GJ6A 5CHAC 3A85A 1GHBG 5EQQA 1HNEE 5A2MH 2ZU5A 4B2BA 1BQYA 2W3KA 4ZAEA 3ZZ5A 3TPIZ 1EP6A 2FX6A 2PSYA 1VCWA 4INLA 3HGNA 3LGWA 3LT3A 4OGYA 4ZXYH 1YF4A 2TGAA 3AW1A 1KY9A 3BF6H 2ODPA 1IQIA 2M2AA 3EDXB 1KSNA 1BUIA 1EJAA 1G3DA 1O2WA 1YLDA 2ZPSA 1RFNA 2JH5D 3FAOA 3S7KB 2VU8E 1EZQA 2A5IA 4K8YA 1C9TA 2XRCA 2ZZUH 5A0CA 1HCGA 4ISLA 3ATIA 1O5AB 2W6ID 3M7TA 1WV7H 1DOJA 2EI8A 2BQ6B 4FVBA 3K6ZA 2TIOA 1SOTA 1RGQA 2R3UA 3P70B 5ETXA 2JJ2D 1GI8B 5EJZA 1AKSB 2FMJA 3LPRA 2THFB 1UO6A 2EC9H 2J98A 1OWHA 3BTQE 4YTAA 3SU5A 5SGAE 3EE0B 2GP9B 2HPQH 2J38A 3E1XB 1BTYA 3FP8E 2OXSA 5ESTE 1MBQA 4ACBA 1K22H 2H5CA 2ZQ2A 1OPHB 2CGAA 2FM2A 4R0IA 1BCUH 1Y59T 1SKYE 4ZKRU 2J95A 2QC2A 5F53A 2ZGHA 2VINA 4IBLH 5EXMA 5FPYA 3DHKH 3LGYA 4M9FA 2ALPA 4A5TS 1NFUA 5GXPA 1LVBA 4NIWA 4X8SH 5FX5A 1AE8H 2QIQA 1MTWA 3N99A 2SFAA 7KMEH 5KEDA 1T8NA 1QL7A 5E0HA 5L2YH 2QGRA 2P3TB 2G8TA 1CA0C 1P2KA 1TABE 4GPGA 1W14U 2B7DH 1GVKB 2ZGXH 1OP0A 4O3UA 1O3NA 2OQ5A 2ZGBH 1PPCE 1B5GH 1EOJA 1P10A 2FWWA 3RP2A 3FKSD 3U28C 1WQVH 4Y0YE 1GMHF 1GJBB 4YO9A 2F4LA 2ALVA 1GI2A 2VIQA 1MD8A 1GJ9B 5GIBA 4FXGH 2AIPA 3D65E 1GBKA 3FOAA 3W95A 3WWBA 1W13U 5L2ZH 1C2GA 1TQ0B 4Y0ZE 3ZZBA 1Z8JB 1S84A 2BM2A 1P06A 4WH6A 1O5BB 2FP7B 1TGCA 2PKAA 2W3IA 4P00A 2QF0A 5JBAS 3DSPA 3SNBA 2BHGA 5J4QA 2OC1A 3RXHA 1HXFH 3SOSA 3A7XA 3ZZAA 1HAXB 1NTPA 1H1BA 3TLOA 4B2AA 3VB7A 2GZ9A 2RDEA 3M35A 2JIZD 1NRSH 5L30H 2WPIS 1K1NA 3R0FA 3PWBA 1ZJKA 3U1IB 3RC4A 2BOHB 1DM4B 2QAAA 1GMHG 1O2GH 2PWXA 3RXPA 4BANB 3LGVA 1P2QA 2YOLA 2VIPA 4GAWA 4X1PU 1SGNE 2ZU2A 1DITH 1O0DH 3LJOA 1O3EA 3M61U 1PPBH 1LQEA 2GV7A 2J92A 1SR5C 5DK1A 1O2MA 1BJVA 1TALA 3UY9A 3MO3A 2ZHQH 2V0BA 3OX7U 1BTUA 1UVPA 7GCHG 3MQKC 1O31A 4DY7B 3LC3A 1GHXH 2K1QA 3RXOA 3RMNH 1ZHMA 1G2LA 5BRRE 1O2RA 2HNTF 2GCTB 3A83A 2C8YB 2HOBA 2WPKS 3E0NB 4Q2KA 1IAUA 2PW8H 4B6EA 2LPRA 4I86A 1HB0B 1Z1IA 1K1OA 1S0RA 1YPHE 3LU9B 3QLPH 2I6SA 3TJNA 2SNVA 2ZIQH 1VKYA 1ZJDA 1SBWA 2FX4A 4X6NA 1E37B 1BRAA 1BJUA 3O8BA 3UNSA 2GMTB 1N6YA 2VIOA 1NFYA 3EAJA 4CRFA 2HLCA 2ANWA 3TU7H 1S0QA 1O2UA 3EE7A 1HAVA
chains in the Genus database with same CATH topology
1O2ZA 1Z6JH 1DANH 1V2MT 2BD2A 2Z7FE 1C9PA 1S81A 5F6MA 3AAUA 1AFQB 5HYOA 3URCA 1KLJH 4X8VH 1IOEA 1C5OH 1YPLH 3KL6A 7LPRA 1FDPA 1GI0A 2UUYA 3SHAH 1C2KA 1CT0E 3SNDA 2BQ7B 3K2UA 4NZLA 1MQ5A 1GI3A 1P03A 1KYNA 1EJMA 1Y5BT 1CGJE 2ZDKA 2VVVA 4OS6A 2ZDLA 4YZUA 3JZ1B 4IS5A 3DFJA 2F3CE 1CHOF 1SGQE 1N8OC 5F8ZA 1AFEH 2BD4A 3MU8A 2STAE 2ZPRA 3TK9A 1ZHRA 2GZ7A 4Y8YA 4GUXA 2C3SA 1D9IA 3SUEA 2FTLE 3UR9A 1QBVH 3GY3A 4MQAA 4WF8A 4HGCA 1G3EA 3O8DA 1ZGVA 1MCVA 1TA6A 4ISNA 5H4IB 3GCNA 4F49A 1K1LA 1DWCH 2VWLA 1AKSA 1ABIH 4WY3A 2ZFTA 3RXUA 1TBQH 1DPOA 4I8LA 1QL9A 3F68H 1XKBC 2FEQH 1MH0A 1MTSA 1ZRKA 2WUBA 2Y7ZA 1GHVH 5FCKA 4WJG2 1QIXB 3RDZA 3PLBA 4ZKOU 8KME2 3VEQB 3UIRA 2GGVB 3M37A 5GCHF 1LCYA 2BB4A 2ZFSA 3C27B 1QR3E 2O8MA 1HAOH 1HDTH 2FOFA 4CBOA 3BG4C 3A7TA 1O5FH 1YPJH 1TNGA 1UHBA 1GCTB 1FN8A 1X7AC 2AMDA 1QBOA 1RTLA 3RXMA 1FPCH 1V2LT 2UWOA 1FNIA 3TGKE 1G36A 4AX9H 1C1WH 1C1RA 2OQUA 5EU8A 1QB9A 1QQ4A 1SMFE 2GVFA 3M3VA 3D49H 2F9BH 1EB1H 2BX3A 3SV8A 2F9VA 1HV7A 1RTKA 4AOQA 4K1TA 3T62A 5HMAA 8LPRA 3BTFE 1TGSZ 1P04A 3GDUA 1DX5M 3BG8A 3ODDA 5GCHG 1C2HA 3P8FA 3A80A 3SU4A 2FESH 3D62A 1T32A 2BZ6H 3RXSA 4X2WA 3A8BA 1SGPE 5IDKA 1VITH 2QXJA 2ZU1A 1ETTH 3BEIB 2Q6FA 1Z6EA 3GY5A 3ITIA 1NS3A 3SGAE 3SI3H 2D2DA 3SN8A 4Q80A 1O3PB 4BXWA 1TX6A 2D8WA 3UREA 5JPMH 3GY8A 3AAVA 2OLGA 2FYQA 1FZZA 3RXVA 2WYGA 3GDSA 4YLUA 4DT7B 3GOVB 4ABEA 1HIAB 1LKBA 2H9EH 5A0AE 5DP6A 1H9HE 3TNTA 4UONA 4UDWH 2RG3A 1XUGA 1HJAC 3MFJA 1F5KU 3HK3B 4IC6A 1PQ5A 2BDCA 2J4IA 4UFEH 1EB2A 1ELAA 4BXSA 2BD8A 3DD2H 1CSOE 4NFFA 2SGEE 2PKSC 1CQQA 3ZVCA 3AW0A 1F0RA 3B9FH 2XTTB 1DXWA 1KDQB 4AG2A 2XBWA 3SV9A 2FIRH 3F1SB 4RKJB 3SHCH 1O3DA 2BD5A 4INKA 5EW1H 3PLKA 2ZDAH 1OP2A 1O2XA 2BQWB 4JZEH 2P95A 3A82A 2GT7A 2ZHDA 5AHGH 4X8UH 1YCPK 1XUKA 1FY8E 3E0PB 3Q3YA 1Y3UA 3S9AA 1OYTH 1G3BA 2PLXA 1VGCB 4B71A 3RXEA 2VJ1A 4FUDA 3M5NA 3GCOA 2ZG0H 3GYLB 4PROA 1AI8H 1UVTH 3QWCH 2RA3A 2ASUB 2P8OC 2Y5FA 4JYVH 5AVDA 5C67A 2IPHA 3EA9A 2A5AA 5EODA 3T28A 4D8NA 1ELVA 1ARCA 1O3KA 3RXCA 4AN7A 1SFIA 2BDAA 1NROH 4IMQA 1ACBE 1YPKH 1RRKA 3SUGA 1GGDC 5E0JA 2BVRH 1IQEA 1O2HA 1O2NA 2H6MA 2J94A 1CU1A 4AG1A 3ZZ9A 1EZUC 1S5SA 1ETSH 1UVUH 2J34A 2ZGCA 3ODFA 4JZDH 2QXGA 5GWZA 1O5CB 1O2TA 2CHAB 1BRBE 1ELDE 1O2YA 1FONA 1ZHPA 1BITA 1ANCA 5DO4H 3MOCA 6CHAC 1AO5A 1DLKB 5E2OA 1E38B 2A31A 2QF3A 5AFYH 3MH6A 1OWEA 4ISOA 1GBCA 3MO6A 5JB8S 4D76A 1XXFA 1GMDG 2VH6A 1ESBA 3DUXH 2GDDA 4JZFH 1EPTB 2G00A 5C5OA 1F7ZA 1TNLA 1MTNC 3UNQA 3MWIU 2P3FH 1EAUA 2G51A 4X2YA 1SLWB 3BEUA 3A87A 4MNXA 1TBRH 4OGXA 1DWBH 1W12U 3I77A 1A0HB 5HXFA 2Y80A 2ZKSA 2ZFRH 3SGQE 4OS7A 3A7VA 1ABJH 2ZCKP 1S83A 4X1NU 7ESTE 3U98H 1TE0A 1P3EA 3NKKA 4TY6A 1W3CA 3O8RA 1QB1A 1GBMA 4ZROA 5JBCS 2GTBA 1SLVB 3VPKA 1J16A 1ELTA 1FI8A 5GDSH 3RUOA 1O2IA 3SNEA 1VCPA 1AB9C 1BTZA 2VWOA 5JBBS 4K5ZA 1HPGA 1QJ1B 1GBFA 1UCYK 2V3OH 4K3JA 6GCHF 1O3LA 1PPFE 3STJA 1QGFA 2ZF0H 4CH8B 3U8OH 2STBE 3CENA 1TMTH 2C93B 1G9IE 1DUEA 1H4WA 5F03A 3VB5A 3SUFA 5I25A 1QA7A 1H8IH 1GJ8B 6LPRA 1P09A 1VZQH 1ESTA 1MBMA 1UTOA 1TRMA 4X1SU 5FBEA 4FUBA 3EYDA 4U30A 1HJ8A 1G3CA 1GDUA 2XYAA 5DP5A 3FANA 3MU4A 1ZLRA 3BTGE 1FXYA 3A86A 3SGBE 3VB4A 1AU8A 1UVOA 1V3XA 2IN2A 1TFXA 2Z3CA 2GT8A 1OYQA 1ZPBA 3IG6B 1ZR0A 1QJ6B 3TJVA 6GCHG 4OS5A 1LPZB 1GJCB 4I7YH 2JETB 4ISIH 2ZA5A 1QRXA 3KGPA 1MKWK 4Y71A 1BRUP 1SQAA 1D3QB 2UUJB 2TRMA 3Q77A 2VIVA 4HTCH 3HGPA 3VGCC 1C5YB 4DURA 2H2ZA 1HAHH 1ZTJA 1O33A 1VITF 2ZO3H 4RKOB 3FP6E 1FQ3A 4YESB 4GCHF 5TJXA 2F91A 3QZRA 1H9LB 3ZV8A 1JMOH 4FUHA 2F9UA 3KEEA 3BSQA 1ZSLA 1K1IA 2BDGA 3Q00A 3RM2H 4FUCA 1H8DH 3UUZA 2ZU4A 1O2SA 3PWCA 2ZU3A 3SNAA 1D4PB 3ZV9A 1Y5UT 2VGCB 1YPEH 2XWAA 5E8EH 1NRNH 5GPIB 2JKHA 4AZ2B 5JBTA 1THRH 2FYRA 3L33A 1P05A 1QURH 1EZXC 1O36A 3TK6A 1A3BH 5CHAB 5EG4A 1GBAA 1GI1A 2V3HH 3QGJA 5DP8A 2BTCE 2F9OA 3GICB 4A6LA 1VITG 4FUGA 1KDQA 5DJ7A 3N7OA 2Y82A 1MQ6A 4GCHG 2EI6A 1T31A 3MU0A 1C5RA 3PLPA 3GCTF 5T6GA 3RMLH 3U69H 3MMGA 1NU9A 1GJ4H 1T8MA 1O32A 4DIIH 2WINI 3RXAA 2G81E 4CRAA 1GBDA 2AIQA 1UK4A 3TH2H 4BTTB 1J8AA 1VJ9U 1QNJA 1GI7B 3KQCA 1MTUA 2FO9A 2WYJA 3SZNA 2QCYA 3P8NA 4NFEA 2FOBA 2WPLS 5DGJA 1XUJA 2BD3A 2BX4A 1NN6A 4KKDA 1K1JA 1K1MA 2FS9A 3Q3XA 2VB0A 1V2PT 1YPGH 3DFLA 3MNSA 1TPPA 3TNSA 5K7RA 1Q31A 5HM2A 2BDHA 2FI4E 3GCTG 2Z3EA 4YLQH 2W5EA 1ELCA 2PR3A 1UVSH 2ZP0H 4GVUA 3QN7A 1IQMA 1LVOA 4M7GA 2HWLB 3M5OA 1DS2E 1XX9A 3M3SA 3UWJH 1P57B 3MH5A 1AY6H 2TGDA 5DPAA 1YLCA 1ZTKA 1N6XA 3HK6B 3T5FH 1O30A 5DP3A 1CE5A 2WPMS 2VH0A 1CA0B 1DSTA 1UTPA 4MTBA 2ZWLH 4AYVB 1XXDA 4DGJA 7GCHF 3BV9B 1TOCB 3S7HB 1DE7H 3UPEA 3NPSA 3JZ2B 3OTJE 1YCPH 3KQBA 4MPUA 1KXEA 1C5TA 1FN6A 3KQDA 1BTXA 4AGKA 3WY8A 1EUFA 1UCYE 3GY6A 4BTIB 2DE8A 1C5SA 1EPTA 2ULLA 1L1NA 1FY3A 1DFPA 1P11E 2BVXH 1HAPH 1L1GA 3BTDE 1V2NT 3SW2B 4K69A 2ZFPH 1P01A 1TPOA 4B73A 1XVOA 4XSKU 4NSYA 1TNIA 4CRGA 1C5MD 1GI6A 1O3BA 1P2JA 1GJ5H 1RIWB 5AF9H 1QRWA 2Y5HA 2AFQB 3EQ0H 3GDVA 3ELAH 3UOUA 3MI4A 1IQKA 4OS4A 2Z9LA 1CGIE 2OUAA 1C1MA 1ZMLA 4Q7YA 4DOQA 1GHYH 3V0XA 1KXCA 4DIHH 4E05H 2LNCA 1C2IA 4WMDA 3A8DA 3RXRA 3UQVA 2SNWA 1FAKH 1ARBA 1B7XB 2ZTZA 4GHTA 2ZHEH 1GJAB 2ZFFH 3RC6A 1QA0A 2CV3A 4AFSA 1Z8GA 1F0TA 2OC7A 1AVGH 3TGJE 1YBWA 3SU1A 4NWKA 4ZHLU 1RJXB 4DVAU 3P95A 2AMPA 1P0SH 4CHAC 3ENSB 2CMYA 1SOZA 1C4V2 1WTGH 1SGYE 3D23A 2VWNA 1W0YH 1C2FA 5E2PA 3BTEE 4ISHH 1TMBH 2B8OH 5K0HA 3URDA 5ABWA 3A89A 2GCHG 3QTOH 1P8VC 4CREA 1FY4A 2W26A 2BZAA 3SI4H 1P3CA 1VJAU 1KXFA 1TNKA 4WXVA 2A0QB 1V2RT 4ABAA 2CJIA 3LONA 3OY6U 2Z9JA 2NU0E 2ZNKH 4IW4E 3CP7A 4JCNA 1C5WB 1QTFA 1IHTH 5F8TA 1UK2A 1UTLM 1TYNA 1T8LA 4OS1A 1UCYH 3KNXA 5C1XA 1C5NH 4A1VA 3SUDA 1GI4A 2D26C 3ZYEA 1KXBA 1SFQB 1LHEH 1SG8B 3T26A 3M7QA 2ANYA 1OOKB 2JH6D 2FZZA 4FUEA 4Y79A 1EQ9A 1TA2A 3SBKA 4X2XA 2ZCLP 1FAXA 3R3GB 9ESTA 1HUTH 4JYUH 1JWTA 3MU5A 3EA7A 2FODA 1E0FD 1LPGB 1PYTD 1VR1H 4U01A 3H7TA 2TGTA 2BLVA 4CR5A 1T4VH 1N8OB 1O2LA 2Z3DA 4YT6H 1L0ZA 1A5GH 3TJOA 1THPB 1EOLA 2FOCA 2PGBB 4I8KA 1CBWB 2O8LA 5A8YA 3K65B 1WUNH 1MKWH 3P92A 3A7ZA 4JK5A 2BDBA 4MLFB 1XKAC 2OBOA 3LOXA 5JB9S 4VGCB 4AORA 3M36A 1WQSA 2FLBH 5DP7A 4ZXXH 4ABDA 1OS8A 4O3TA 1A0LA 1GHAF 4TY7A 4IGDA 3A88A 3DA9B 1C1SA 1LHGH 1PYTC 1ZMNA 1SGFG 1JRTA 1GVZA 1TNHA 5C3NA 2NU3E 4KTSA 3PM3A 2Z9GA 1ZSJA 1FV9A 1CVWH 1TQ7B 3GYMA 5EQRA 3U8TH 1CA8B 1BA8B 4MNVA 4NIVA 2VVCA 2B5TB 4ABGA 5L6NH 3BG4B 4TWYA 2HNTC 4UFFH 1ID5H 3SV2H 2RA0A 4HI3A 4BAOB 4ABHA 1ELEE 1JXPA 1GHZA 1TGTA 1ZMJA 5EGMA 2WV4A 4D7FA 3RXGA 4Y7AA 2IJOB 2QYIA 1GBTA 2QXHA 1GHAG 3U9AH 4ESTE 1BMLA 1P2OA 4MNYA 2A5KA 4E06H 3VXEH 2GD4B 1OKXA 2V6NA 1GBJA 1N1LA 3FVFB 3HATH 4JK6A 2FI3E 3SV6A 3LGIA 3V12A 4XBCA 3MH7A 1DWDH 1P9SA 2R9PA 5EXLA 1MD7A 3RU4D 5CE1A 1OX1A 5CMXH 1O3FA 9LPRA 2Q6GA 4AB8A 5EW2H 1V2QT 2ZECA 3TIUA 4E7NA 3AASA 5JYIA 1EKBB 1VGCC 1AIXH 3SJ8A 1A1RA 1Y5AT 4XBBA 3V7TA 4DCDA 1OWJA 3MNXA 2SGQE 3DT0H 1AZZA 4UFDH 1SI5H 1QBNA 3SJ9A 4Y8ZA 2BY6X 1BTHH 5LPEA 1T8OA 3UOPA 2QY0B 2F9PA 1XMNB 2HGTH 1HJAB 4IMZA 1UTQA 1WBGB 1MUEB 3SNCA 1O3MA 3ZYDA 1O3HA 1KXAA 2V35A 1GG6C 1OWIA 1AD8H 4TPYA 3BIUH 8ESTE 2M5TA 2PKSB 5T6FA 4FUFA 3A84A 1TMUH 3NXPA 5DP9A 1INCA 2ESTE 1A3EH 2G5VA 5AFZH 2CHAC 2UWPA 2QV1A 1U6QA 2ODYB 1GMDF 4TYDA 3L6PA 5C1YA 1GJ7B 1BMMH 3Q3KA 1THSH 1O2PA 1RXPA 1V2JT 2VVUA 4MG3A 4DW2U 1SGTA 1LO6A 4UFGH 2BYAX 2VNTA 1ESAA 4CBNA 1OXGA 4WH8A 3ZZ6A 1UTMA 3STIA 5F8XA 1GL1A 3S9BA 3M5MA 1C5VA 2RCEA 1O5EH 4CRDA 2A1DB 4JZIA 1SGCA 1SC8U 1IQGA 1UJ1A 1Y3YA 4IC5A 1QHRB 1UTJA 1ELFA 1IQHA 2G5NA 5T3HA 2WV5A 2G55A 1V2TT 3A81A 1BDAA 2Q1JA 3LDXH 2Z94A 2P8OB 1SSXA 2Y6TA 5BPEA 1EX3A 4JMYA 3MTYA 3QGNB 1BMAA 1V6DA 8GCHF 2G4UA 3B8JA 1S85A 1HAZB 4AFUA 1JIMA 3P6ZB 3TK5A 1DWEH 1OSSA 4A1TA 2A32A 2B0FA 3PYHA 1GGDB 4I31A 3E91A 2C8XB 4Z6AH 4YM9A 1SGEE 1Z7KA 2BY9X 5LPRA 1HFDA 1WYKA 4NGAH 3MHWU 4LXBH 1ZSKA 1PPHE 1V2KT 2BXTH 1HRTH 1C1UH 1UTNA 3PO1C 1MMJN 2GKVE 5B6OA 4FVDA 4KGAA 2P93A 1V2VT 1AVWA 1W2KH 2BLOA 3A7WA 4X2VA 2R3YA 4YOGA 1CO7E 1P2NA 2BDYA 8GCHG 2HALA 1SLUB 3MO9A 3UWIA 1VCQA 1C5LH