1FQFA

Crystal structures of mutant (k296a) that abolish the dilysine interaction in the n-lobe of human transferrin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFADSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEROTRANSFERRIN
publication title Crystal structures and iron release properties of mutants (K206A and K296A) that abolish the dilysine interaction in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 95
structure length 329
sequence length 329
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2000-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqfA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1fqfA02
1PB8A 1B9JA 4ZS9A 4YMAA 3ZKKA 2F8DA 4G77A 3IB0A 3OXNA 3TTMA 3W9VA 2HZKA 4JB7A 5TPAB 3G7WA 1FW0A 1LBBA 4FORA 4QRZA 3H6TA 3TELA 4M4GA 1MQHA 3OO8A 3BKIB 4KHZE 3Q25A 3U72A 4GVOA 4IO3A 2F6PA 1LSTA 1SI1A 5EHMA 1MY1A 4QFNA 5B7DA 4RJZA 5DVJA 2A5TB 3HN0A 3C9HA 1BLFA 2RINA 5H8QA 4MFIA 2QS1A 3MVYA 3S4UA 3M3FA 3LBSA 4ZZAA 2RF1A 3FVKA 4LATA 4R74A 1WDNA 5CMKA 1YTVA 2XX7A 1GVCA 3G3IA 2E1SA 4JSOA 3ECRA 4EDPA 4DLDA 5F1QA 3PUWE 2X26A 4YAHX 2XXXA 2F7BA 3TFLA 3FJMA 3OO6A 2I48A 3MVWA 1TFDA 4M1VA 3U8QA 4IO4A 1POY1 3DP6A 4EXKA 1USYE 4QFKA 5HM4B 1OIBA 1QKBA 3LR1A 3CG1A 2DSFA 5L8DA 1LB9A 4OFOA 2I4BA 1A54A 1Y4CA 1B52A 2I3WA 5L9OA 3E4RA 3R26A 2QSXA 3U1OA 1B5HA 3RNNA 4C1TA 2ZNSA 3RLFE 4U21A 3FGSA 4KQPA 1YCJA 4ISUA 3OO9A 3O2AA 3OMBA 2V84A 4R6YA 2H4IA 1B32A 4RY1A 2XXQA 1FQDA 4TLMB 4H67A 2O7IA 2OJTA 3QUFA 4XKRA 4G68C 2XXYA 1L5TA 3HV1A 3TPAA 1P1WA 1DPEA 3SEWA 1NNFA 3MC2A 4POXA 4U1ZA 2FNCA 3T66A 2H25A 1MPDA 1P1QA 3U92A 4PFUA 5H8NA 3HPIA 2V3QA 2D21A 1URSA 4NMYA 2I6EA 1Q1KA 1DTZA 3HHFA 2VD2A 2O69A 2I58A 1B3EA 2ZNUA 3UN6A 2GHAA 1B7UA 4RXLA 1B3HA 4RNSA 5CMMA 4QFLA 4NF8A 1M5BA 3OEKA 3VVDA 2UYFA 1MQGA 4X9TA 1IXGA 2V3TA 1QUJA 3E3KA 3M3LA 5EHSA 1FTLA 4GL0A 4YB6A 1MDQA 1FQEA 1B7HA 3C32A 4KFQA 4RA1A 2F35A 3IOVA 4XTCQ 1AMFA 4MLVA 3TEPA 2Z22A 4DXCA 4I9DA 3SEYA 3IL1B 2H9BA 2QPQA 4QSEA 4OETA 4I1DA 1H45A 2HEUA 5JTYA 1BP5A 1D4NA 2XX8A 1OQGA 1IQ7A 1SD3A 1ZU0A 4IO7A 3B6TA 3CI8A 4KCDA 1EH3A 4E0XA 2Z8DA 3PD8A 1MM7A 2RC9A 4YICA 4F2OA 4E0WA 1RYXA 4RPNA 1N84A 4KYEA 3Q27A 4IB2A 4ZDMA 3RY3A 2DVCA 2Q2AA 5CBRA 3QK6A 1VSOA 4OESA 3RPWA 3IOWA 3MP6A 3IORA 1FQBA 3SEVA 2XXPA 3GZGA 5TPAA 4Z0IA 4H0WA 4NF5B 4R6HA 3QSLA 3KJ7A 1SBPA 2DQVA 1MQIA 2AYSA 3MAMA 1N0TA 4JDFA 4IY5A 5AA3A 3MVZA 4LZ7A 3RQTA 1B7ZA 4KYDA 3GBBA 2Q9TA 4H1XA 4JXIA 3K6UA 3TTRA 4YKKA 2I3VA 4EF1A 4R9FA 1VR5A 1JVXA 1NH8A 4NF6B 2Z8FA 3MZ9A 3VLWA 2A5TA 4GL8A 4PETA 3DM0A 1FQCA 4FATA 1FCKA 2ONRA 4PFTA 2F97A 2YJPA 3O29A 3VE1B 5JK4A 2DWHA 1D9YA 1SDXA 4GXSB 4LQ5A 1N04A 4OXVA 4IO6A 2OZZA 1MPCA 4GIZA 1R9LA 3K6VA 1Y3PA 1O63A 2DP8A 5H8SA 1IXHA 1A40A 1YAEA 4O3AA 1JETA 3USDA 4ELPA 4GFRA 1B5IA 2G29A 4R2BA 1ZJLA 4JSDA 3GLBA 3H4ZA 3CFZA 3PMVA 3EPEA 1MY0A 2O7UA 4RPOA 3IB2A 3T96B 1LGBC 4UACA 5BWJA 1MPBA 3PGFA 1PB7A 4F1YA 1O64A 2ABHA 4H5GA 3TCHA 5FTHA 4GD5A 1S7YA 3LSFB 4QFOA 4YKPA 5I2KB 2Q8JA 4PE5B 2HZLA 4XKNA 1LLSA 3H6VA 1JW1A 3PUVE 2D5WA 4OYVA 3RT6B 3V8XB 3OSQA 2ZMBA 3IOUA 3UGWA 2G93A 4F19A 1MRPA 4XXUA 3TMGA 2NXOA 3U94A 1QKAA 3PV0E 3G3JA 3KFMA 4N13A 1GTKA 3PUZE 4BLAA 1Y3QA 1B05A 1B3GA 3HSTA 3G3FA 4DIGA 1MXYA 3MPLA 5IKBA 3VVFA 1ZIUA 3KSXA 5DTBA 1QUKA 3IAZA 2OBGA 5KDTB 2ZYKA 1WVJA 3QIMA 1NNPA 4POWA 4ZEKA 1A7LA 3T9UA 4ZZEA 4PFYA 3S9NC 1UIUA 5FTIA 1BTJA 2XXVA 2XXWA 5K2XA 1US5A 3O66A 3VFJA 3FD3A 2FA7A 3FASA 5FHMA 3V5AA 1T0KA 1NKXA 1M5FA 4G2ZA 3SEXA 5AA2B 4HS7A 3FATA 3LSXA 3VLVA 3MP8A 1OLCA 3RT8A 4H65A 3ZS6A 4YMBA 3IR1A 4QSDA 3IX1A 3LSLA 4G8NA 1OVTA 3KBRA 3LUYA 1I69A 4OFLA 4H8IA 1MDP1 3VVEA 1PB9A 3CR9A 2M8CA 2DOJA 4DE8A 5I57B 1ZLQA 3MUQA 3B6WA 2LAOA 3D4CA 3KZGA 1MQJA 1URDA 4DZ1A 2DXYA 2FYIA 1N7WA 1UTHB 4YKJA 4KI0E 3I6VA 1JEVA 4KPTA 4EF2A 1QVSA 2ZYMA 3JYRA 5M2VA 3TKDA 4L17A 2I49A 1IUDA 2OWTA 3KN7A 2VP1A 2Y7IA 2H5YA 2Y7WA 1R6ZA 3PPPA 1JW4A 2P2AA 3MZBA 3UK4A 2BJJX 4DCXA 5K2YA 2R9JA 1POTA 5L9MA 5LOMA 5CC2A 4ONYA 2Y7PA 4NF5A 5DEXB 4LZ5A 5EYFA 4KYSA 1NNTA 3TQWA 4IO2A 2HCAA 3F11A 1YPNA 3O97A 3FJGA 5DVIA 1BKAA 2RCAA 4OVJA 2QS2A 4ZE8A 1XVYA 3Q29A 1B40A 1H76A 5KCJB 3VXCA 1N7XA 3MQ9A 4BDOA 4ELQA 2O84X 4NF6A 1P1NA 3T9HB 3CG3A 3A3UA 4DDDA 1A99A 5CBSA 3OO7A 4BDLA 1BIYA 4YZZA 1PEBA 1D3KA 1PC3A 1N3WA 1B1XA 3E9XA 2HAUA 1LBCA 1VFDA 3BBRA 4ECFA 4XKQA 2I0CA 3PPNA 1ZMGA 2OWSA 5A5XB 3UORA 5DVFA 3IJXB 4P0GA 1XS5A 3EQ1A 3EHTA 3K00A 1B0LA 4OEUA 3RGYA 2Y84A 3PPQA 3U93A 1B4HA 1US4A 2REJA 2QRYA 3OELA 4OTEA 1A8EA 2ZYOA 3C34A 1ZBMA 1Y1MA 3TODA 5AA2D 4QFPA 4QHQA 4O3CA 1II5A 5ICQA 3V89B 2YLNA 4UA8A 1SQYA 4FEDA 3QYTA 4EXLA 2OCUA 3C4MA 3MJNA 1TFAA 4NWCA 3TCGA 1OQHA 4G68B 3K4UA 4FAJA 2W7YA 5ICTA 4DCYA 4AQ4A 3W9WA 1Y3NA 3WAFA 1QULA 5H8FB 3ZKLA 4Q0CA 1ELJA 1H43A 4MLQA 4RYAA 1LCFA 1MXXA 4F1UA 2QMXA 2PYYA 5J1DA 3G3KA 1IITA 3O9PA 4H6DA 1XVXA 3EF7A 4F39A 5CM6A 5KDTA 2XD2A 4JWYA 1PDAA 4HW8A 1P1UA 4OQOA 4ND9A 4Q8RA 1B51A 2REGA 3KOSA 1M5CA 1CE2A 2A5SA 1MXWA 1JW5A 2CMOA 4WKMA 3PD9A 3PU5A 3QXMA 4HTGA 5DYHA 3OENA 2X7PA 3C31A 3O6GA 5AA2A 3MBPA 2VHAA 4LUBA 4MH5A 2UXAA 2QS3A 4OFJA 3R7XA 5HBCA 4YU0A 4I62A 3Q28A 5I59B 1S9TA 4EQBA 1XHYA 2AL5A 4K3FA 2Y7KA 4Q5TA 1MQDA 3SETA 1VE4A 2Q89A 1B2HA 4R2FA 4OMBA 2XXHA 5I57A 3E13X 4F22A 2UVGA 3GXAA 4IY6A 1UTHA 3IK6B 1AIVA 2F78A 3TAJA 3O6HA 1EU8A 2V93A 5TU0A 3VV5A 5IAIA 1SW5A 4N6PA 1IZ1A 1MS7A 1NH7A 3TDJA 5HPQA 4JWXA 2ONKE 2P0SA 4GOTA 2B65A 1XOCA 3SERA 4TLLB 3MPKA 3N6UA 3P7IA 1VFEA 5I2NB 4NWDA 4GXAA 3JV9A 4R75A 3WAEA 2GFEA 2QJEA 1LFIA 2P1SA 4LQ2A 3C35A 3HHGA 5B70A 3CFXA 3LC8A 2GRVA 1FQAA 4TOZA 1H44A 4Z7EA 5KCJA 2I4CA 1GR2A 2GHBA 3TTLA 2RC8A 3IO6A 4ZEBA 2O1MA 2O68A 1Y20A 2XXUA 4X1DA 2F6GA 4H5FA 2ONSA 1B58A 1HSJA 4RK2A 1QW0A 2Z23A 3DELB 4F3SA 1NL5A 4GQOA 4NF4B 3FUZA 4ELOA 1SW1A 5H8HB 1MH3A 4EQ9A 4LA9A 4GF8A 4U2RA 5I84A 3QAXA 3UA8A 3HO7A 4WEDA 4BDMA 3S9MC 1I6QA 4KR5A 4FE8A 4DXBA 2XXRA 4G8MA 3JZJA 1JEUA 1FQFA 3MP1A 1SYHA 5I56B 2XXTA 2AIXA 3FVOA 4F3BA 1UTBB 2XD3A 1LAXA 1R9QA 4XIGQ 4ZEIA 4PP0A 4F3GA 4MBPA 2DYXA 2ESNA 2OK2A 1PBPA 2HAVA 4FJPA 2DXRA 2NVUB 4F31B 2VD3A 2UVIA 1DPPA 3B7DA 1B1HA 2RC7A 4G68A 4X48A 2O6AA 3FXUA 1LFHA 2H99A 1XT8A 3PPOA 3CVGA 2Z8EA 5H8FA 3ILUB 3N26A 3H6UA 1AL3A 3KJTA 2F7AA 4R9GA 2PBWA 4OZ9A 1RKMA 3Q26A 3LSWA 1CB6A 2R6GE 5I58B 5JTYB 3EHUA 3D4GA 3G3HA 1B4ZA 2GH9A 3TYHA 4FIMA 1M5EA 1MXVA 4AB5A 4QF9A 4WXJA 3TZAA 4IGRA 1P99A 5ISUA 4RK9A 1OLAA 2H98A 2V25A 5CRYA 3OOAA 4H8JA 2PVUA 4ZE9A 4IGTA 1A8FA 1FTOA 2HFBA 3L6GA 3I3VA 1AH5A 1B3FA 2PMSA 1MY4A 5ITOA 3CIJA 3FIRA 3N5LA 5AA4B 4JBZA 2PT1A 3MZ1A 3C33A 4LZ8A 4GWOA 1J1NA 3ILTB 2NWJA 5I59A 2F34A 1IXIA 1LAHE 1AOVA 5JEIA 1UQWA 4F18A 3K01A 2HXWA 2IA4A 1NNKA 4X1BA 4THIA 3TTNA 3KGCA 3FVNA 1MY2A 3MVXA 3TCFA 4TQUQ 5AE4A 3THIA 2CZLA 1B46A 3H3GA 3PMWA 1IIWA 2RCBA 3VXBA 3K6XA 3FV2A 5TP9B 2ZXTA 1QJMA 4I8CA 1N76A 4ESWA 3SKPA 2NUVA 2O1LA 1S50A 2DE3A 3MWBA 3O28A 4NE4A 1MXUA 3DP8A 5I2NA 4G4PA 3FV1A 3KOTA 4ELRA 3KEIA 3B6QA 1OVBA 3H6WA 2VGQA 1SW2A 1HSEA 1GGGA 2V3UA 3IO4A 1TT1A 3TQLA 2YPNA 1LAFE 3O6IA 4NEDA 4F3PA 2Y7RA 3HCQA 4R6KA 1IEJA 1MM6A 5DT6A 4ZEFA 5FHOA 4EUOA 1HSLA 3SDFA 2XHDA 1O7TA 3SESA 4GRKA 4BDRA 1JVYA 1EZOA 1Y4TA 5CI5A 1NFTA 3L6HA 1LB8A 3CRBA 1KWHA 1EZPA 3ODBA 5I2KA 1MY3A 4OENA 4NF4A 2E0SA 2R71A 4O3BA 5H8HA 1R1NA 3ZSFA 1QUIA 1FTJA 3IOTA 4GLIA 3H03A 2PX1A 2IEEA 4OERA 5I56A 3K0VA 3K1PA 4KD5A 1N3XA 3KN8A 1UTBA 1I6BA 3C36A 2QS4A 4MF3A 1Y9UA 4ESXA 2D3IA 4AB6A 3IB1A 3FVGA 1TXFA 4FECA 2ALUA 1ANFA 5L9SA 3TUSA 4G8HA 5KZTA 3FXQA 2UVHA 5CMCA 4F29A 3H06B 4LONB 4OEVA 2DE4A 2DWIA 1DTGA 2AL4A 5CMBA 1SW4A 4PQJA 3G3GA 4F1VA 4KCCA 1SVXB 1DSNA 4HCWA 4C0RA 3UP9A 1I6AA 3W15C 2RKMA 5I58A 1UIVA 3T93B 1B3LA 3UIFA 2HQ0A 3VLUA 4NTLA 2Q2CA 1Q35A 4FEBA 3KSJA 4R73A 1MXZA 3VDFA 4F2QA 4YB7A 3RUMA 5H8QB 4BDQA 1ZKBA 3OD7A 2QMWA 1DOTA 1Z7ME 4PFWA 1M5DA 2DWAA 3EHSA 3ONMA 1F9BA 4YKIA 1OMPA 4WEPA 3T9XB 4P11A 3PUYE 4U4SA 2F7CA 3M3KA 5AA4A 3V83A 1GV8A 3A3CA 1LAGE 3CSBA 3K2DA 1XC1A 3RTWB 1NMUA 4EQ7A 1MG1A 2XXIA 1P1OA 3S2VA 1FTMA 4N07A 3S9LC 3GBAA 5DEXA 1RYOA 1PBQA 1D9VA 5ITPA 1SI0A 2KLFA 1B6HA 3CSGA 3N94A 3RTFB 4OWDA 4QSCA 3DLNA 4LP2B 3DP4A 4OHNA 3S9EA 3R6UA 3T9VA 1B0HA 1JQFA 4YB5A 2QL3A 2OLBA 3T22A 4LVQA 1B5JA 2NOOA 5TP9A 1JNFA 2DS9A 1IXCA 3OSRA 3I5OA 4Q30B 1ATGA 3OEMA 2DWJA 1A55A 3BFTA 1DMBA 4XKPA 2VOZA 3K1MA 1LFGA 1EZ9A 5ELVA 3QUJA 4ZEDA 5BUUA 4DXUA 2DE2A 1SYIA 2XX9A 2DVZA 4ZECA 5A5XA 5H8NB 2THIA 1ZTYA 4HCYA 2B3BA 1H3DA 4P0IA 3TTKA 2UVJA 1Z7NE 3K02A 3AXFA 3BFUA 3PPRA 3RN8A 3PMXA 3N6TA 2F36A 1LCTA 3FZVA 3FXRA 1MH4A 2B3FA 1URGA 3EN3A 3M8UA 2UYEA 1Y1ZA 4NF8B 4U1OA 3H7MA 1FTKA 3MW0A 2ZNTA 4R72A 2Q88A 2WKYA 2I0BA 3A09A 3FJ7A 4BDNA 3PUXE 4U4XA 2X7QA 5AA1A 3K1NA 1WODA 5F7VA 2ANJA 4IO5A 4JWOA 1USYH 3KG2A 2ZYNA 3IJOB 4C1UA 4U22A 5FHNA 2F5XA 1TWYA 4U23A 3K6WA 3KN3A 2O51A 3SEUA 3CFLA 2PT2A
chains in the Genus database with same CATH superfamily
1PB8A 3BIGA 1B9JA 4ZS9A 4PAFA 4YMAA 3ZKKA 2F8DA 4G77A 3IB0A 3OXNA 3TTMA 4X8RA 3W9VA 4PFRA 3RYDA 2HZKA 4JB7A 5TPAB 3G7WA 1FW0A 1LBBA 4FORA 4QRZA 3H6TA 3TELA 2CZIA 4M4GA 1MQHA 3OO8A 4JVCA 5IZ3A 3BKIB 4KHZE 3Q25A 3U72A 4GVOA 2XWOA 4IO3A 2F6PA 1LSTA 1SI1A 5EHMA 1MY1A 4JVIA 3E79A 4QFNA 5B7DA 3KBZA 4RJZA 5DVJA 2A5TB 3HN0A 3C9HA 1BLFA 2RINA 5H8QA 4MFIA 2QS1A 3MVYA 3S4UA 1NV2A 3M3FA 3LBSA 4ZZAA 2RF1A 3FVKA 4LATA 4R74A 2FHYA 1WDNA 5CMKA 1YTVA 2XX7A 1GVCA 3G3IA 2E1SA 4JSOA 3ECRA 4EDPA 4DLDA 1KA0A 3BIHA 4N17A 5F1QA 3PUWE 2X26A 4YAHX 1YYZA 2XXXA 2F7BA 3A29A 3TFLA 3ISPA 3FJMA 3OO6A 4P8BA 2I48A 3MVWA 1TFDA 4M1VA 3U8QA 4IO4A 1POY1 3DP6A 4EXKA 1USYE 4QFKA 5HM4B 4LN5A 1OIBA 1QKBA 2FBPA 3RPLB 3LR1A 3CG1A 2DSFA 5L8DA 1LB9A 5IZZA 4OFOA 2I4BA 1A54A 3E78A 1Y4CA 1B52A 4O7IA 2I3WA 5L9OA 3E4RA 3R26A 2QSXA 3U1OA 1B5HA 3RNNA 4C1TA 2ZNSA 4N8YA 3RLFE 4U21A 5A5LA 3FGSA 4KQPA 1YCJA 4ISUA 3OO9A 3O2AA 3OMBA 2V84A 4R6YA 1NUYA 2H4IA 1B32A 5IZ1A 4RY1A 2XXQA 1FQDA 4TLMB 4H67A 2O7IA 2OJTA 3QUFA 4XKRA 4G68C 2XXYA 4O8MA 1L5TA 3HV1A 3TPAA 1P1WA 1DPEA 3SEWA 1NNFA 3MC2A 4POXA 4U1ZA 2V4CA 2FNCA 3T66A 2H25A 1MPDA 1P1QA 3U92A 4GBVA 4PFUA 5H8NA 3HPIA 2V3QA 2D21A 1URSA 4NMYA 2I6EA 3MYUA 1Q1KA 2KR0A 1DTZA 1EYIA 3HHFA 2VD2A 2O69A 2I58A 1B3EA 2ZNUA 3UN6A 4PGPA 2GHAA 1B7UA 4RXLA 1B3HA 4RNSA 5CMMA 4QFLA 4NF8A 2ZZWA 1M5BA 3OEKA 3VVDA 2UYFA 1MQGA 4X9TA 1IXGA 2V3TA 1QUJA 3E3KA 3M3LA 5EHSA 1FTLA 4GL0A 4YB6A 1MDQA 1FQEA 1B7HA 1JP4A 3C32A 4KFQA 4RA1A 2F35A 3IOVA 4XTCQ 1AMFA 4MLVA 1FBHA 3TEPA 2Z22A 4DXCA 2DDKA 2XWIA 4I9DA 3SEYA 3IL1B 2H9BA 2QPQA 2ZZVA 4QSEA 4OETA 4I1DA 1H45A 2HEUA 5JTYA 1BP5A 1D4NA 2XX8A 1OQGA 1IQ7A 1SD3A 1ZU0A 4IO7A 3B6TA 3CI8A 4KCDA 1EH3A 4E0XA 2Z8DA 3PD8A 4G61A 1MM7A 2RC9A 4YICA 4F2OA 4E0WA 1RYXA 4RPNA 1N84A 4KYEA 3Q27A 4IB2A 4PFIA 4ZDMA 3RY3A 2DVCA 2Q2AA 5CBRA 3QK6A 4OESA 1VSOA 3RPWA 3IOWA 3MP6A 3IORA 1FQBA 3SEVA 2XXPA 3GZGA 5TPAA 4MCOA 4Z0IA 4H0WA 4NF5B 5I3SA 4R6HA 3QSLA 4OVRA 3KJ7A 1SBPA 2DQVA 1MQIA 2AYSA 3EKIA 3MAMA 1N0TA 4JDFA 4IY5A 5AA3A 4HE0A 2CEYA 3MVZA 1FPEA 4LZ7A 3RQTA 1B7ZA 4KYDA 3GBBA 2Q9TA 4GWSA 4H1XA 3IFCA 4JXIA 3K6UA 3TTRA 4YKKA 2I3VA 4MIJA 4R9FA 4EF1A 1VR5A 1JVXA 1NH8A 4N81A 4NF6B 2Z8FA 3PTYA 3MZ9A 3VLWA 2A5TA 4GL8A 4PETA 3DM0A 1FQCA 4FATA 1FCKA 2ONRA 4PFTA 2F97A 2YJPA 3O29A 3VE1B 5JK4A 2DWHA 1D9YA 1SDXA 4GXSB 4LQ5A 1N04A 4OXVA 4IO6A 2OZZA 1MPCA 4GIZA 4GWZA 1R9LA 3K6VA 1Y3PA 4P3LA 1O63A 4PFBA 4PTKA 3HFUA 2DP8A 5H8SA 1IXHA 1A40A 1YAEA 4O3AA 1JETA 3USDA 4ELPA 4GFRA 1B5IA 4P1EA 5EYHA 2G29A 4R2BA 1ZJLA 4JSDA 3GLBA 5ESYA 3H4ZA 3CFZA 3PMVA 3EPEA 1MY0A 2O7UA 4RPOA 3IB2A 3T96B 1LGBC 4UACA 1LBWA 5I5PA 3RPLA 1MPBA 5BWJA 1IMBA 1PB7A 3PGFA 4F1YA 1IMAA 1O64A 2ABHA 4H5GA 3TCHA 5FTHA 4MNCA 4GD5A 1S7YA 3LSFB 4QFOA 4YKPA 5I2KB 2QVUA 4MAGA 2Q8JA 4PE3A 4PE5B 2HZLA 4XKNA 1LLSA 3H6VA 1JW1A 3PUVE 2D5WA 3KC0A 4OYVA 1VDWA 3IFAA 3RT6B 3V8XB 3OSQA 2ZMBA 3IOUA 3UGWA 2G93A 4F19A 1MRPA 4XXUA 3TMGA 2NXOA 3GYYA 3U94A 1QKAA 3PV0E 3G3JA 3KFMA 1NV0A 4N13A 1GTKA 3PUZE 4BLAA 1Y3QA 1B05A 1B3GA 4P56A 3HSTA 3G3FA 4DIGA 1MXYA 3MPLA 5ET8A 1FBFA 5IKBA 3VVFA 1ZIUA 3KSXA 5DTBA 1QUKA 3IAZA 2OBGA 5KDTB 2ZYKA 1WVJA 3QIMA 1NNPA 4POWA 4ZEKA 1A7LA 3T9UA 4ZZEA 3T0JA 4PFYA 3S9NC 1UIUA 5FTIA 4PF6A 1BTJA 2XXVA 2XXWA 5K2XA 1US5A 3O66A 3VFJA 4PDDA 1FPJA 2FA7A 3D1RA 3FD3A 4GWWA 3FASA 1FTAA 5FHMA 3V5AA 1T0KA 1NKXA 4NN3A 1M5FA 4G2ZA 3SEXA 5AA2B 4HS7A 2XA5A 3FATA 3LSXA 3VLVA 1FPIA 3MP8A 1OLCA 2Y5KA 4UABA 4H65A 3RT8A 3ZS6A 4YMBA 3IR1A 4QSDA 3IX1A 4MNPA 1DCUA 3LSLA 4G8NA 1OVTA 3KBRA 3LUYA 1I69A 4OFLA 4H8IA 1MDP1 3VVEA 1PB9A 3CR9A 2M8CA 4HXVA 2DOJA 4DE8A 4FBPA 5DW8A 5I57B 1LBZA 1ZLQA 3MUQA 3B6WA 2LAOA 3D4CA 3KZGA 1MQJA 4N6KA 1URDA 4DZ1A 2DXYA 2FYIA 1N7WA 2PFZA 1UTHB 4YKJA 4KI0E 3I6VA 1JEVA 4KPTA 2ZYMA 1QVSA 5M2VA 3JYRA 4EF2A 3TKDA 4L17A 2I49A 1IUDA 2OWTA 3KN7A 3LUZA 2VP1A 2Y7IA 4QBAA 2H5YA 2Y7WA 1R6ZA 5F24A 3PPPA 1JW4A 2P2AA 3MZBA 3UK4A 2BJJX 4DCXA 5K2YA 2R9JA 1POTA 5L9MA 5EYGA 1NV1A 4OANA 2P3VA 5LOMA 5CC2A 4ONYA 2Y7PA 4NF5A 5DEXB 4LZ5A 5EYFA 4KYSA 1NNTA 3TQWA 4IO2A 1FRPA 2HCAA 3F11A 1FSAA 1YPNA 3O97A 3FJGA 5DVIA 4I3YA 1BKAA 5LTCA 2RCAA 4OVJA 2PCRA 2QS2A 4ZE8A 1XVYA 3Q29A 1B40A 1H76A 5KCJB 2FIEA 3VXCA 1N7XA 3MQ9A 5ET5A 2WEFA 4BDOA 4ELQA 2WBDA 2O84X 4NF6A 1P1NA 4KXPA 3T9HB 3CG3A 3A3UA 4DDDA 1A99A 5CBSA 3OO7A 4BDLA 1BIYA 2OWZA 4YZZA 1PEBA 1D3KA 1PC3A 1N3WA 1B1XA 3E9XA 2HAUA 1LBCA 1VFDA 2WYKA 3BBRA 4ECFA 4XKQA 2I0CA 1NV3A 3PPNA 1ZMGA 2OWSA 5A5XB 3UORA 5DVFA 2XWVA 3IJXB 4P0GA 1XS5A 3EQ1A 3EHTA 3K00A 1BK4A 1B0LA 4AS5A 4OEUA 3RGYA 2Y84A 3PPQA 3U93A 1B4HA 1US4A 2REJA 2QRYA 3OELA 4OTEA 1A8EA 2ZYOA 3C34A 1ZBMA 1Y1MA 3TODA 5AA2D 4QFPA 4QHQA 3B50A 4O3CA 1II5A 5ICQA 3V89B 2YLNA 4UA8A 1SQYA 1K9ZA 4FEDA 3QYTA 1KZ8A 4EXLA 2OCUA 3C4MA 3MJNA 1TFAA 4NWCA 3TCGA 1OQHA 4G68B 3K4UA 4FAJA 2W7YA 5ICTA 4DCYA 4AQ4A 3W9WA 1Y3NA 3WAFA 4GWYA 1QULA 4N4UA 5H8FB 3ZKLA 4Q0CA 1ELJA 1FBCA 1H43A 1EYJA 4MLQA 1G0HA 4RYAA 1NV6A 1LCFA 1MXXA 4F1UA 2Q74A 2QMXA 2PYYA 5J1DA 3G3KA 1IITA 3O9PA 4H6DA 4P1LA 5EQ9A 1XVXA 3EF7A 4F39A 5CM6A 5KDTA 2XD2A 2XXKA 4JWYA 1PDAA 4GBWA 2BJIA 2CZHA 4HW8A 1P1UA 1IMCA 4PGNA 4OQOA 2Y5LA 4ND9A 4NF0A 4Q8RA 1B51A 2REGA 3KOSA 1M5CA 4OVSA 1CE2A 2A5SA 1MXWA 1FBPA 1JW5A 2CMOA 4WKMA 2WBBA 3PD9A 3PU5A 3QXMA 4HTGA 5DYHA 4DI4B 3OENA 2X7PA 3C31A 3O6GA 5AA2A 3MBPA 2VHAA 4HE2A 4LUBA 2QFLA 4MH5A 1EYKA 4JVDA 2Q8MA 2UXAA 2QS3A 4OFJA 3R7XA 5HBCA 4YU0A 2HHMA 4N15A 4I62A 4PF8A 3Q28A 5I59B 1S9TA 4EQBA 1XHYA 2AL5A 4K3FA 2Y7KA 4Q5TA 1MQDA 3SETA 1VE4A 2Q89A 1B2HA 4R2FA 4OMBA 2XXHA 1FPDA 5I57A 1FPKA 3E13X 2QVVA 4N6DA 4F22A 2OX3A 4HE1A 2UVGA 3GXAA 4IY6A 1UTHA 3IK6B 1RDYA 1AIVA 2F78A 1SPIA 3TAJA 1NUZA 3O6HA 4I40A 1EU8A 2V93A 5TU0A 3VV5A 5IAIA 1FBGA 1SW5A 4N6PA 4NX1A 1IZ1A 1MS7A 1NH7A 1FBDA 3TDJA 1FPLA 5HPQA 4JWXA 2ONKE 2P0SA 4GOTA 2B65A 1IMEA 1XOCA 3SERA 4TLLB 3MPKA 3N6UA 3U65A 3P7IA 1VFEA 2CZKA 5I2NB 4NWDA 4GXAA 3JV9A 4R75A 2F3DA 3WAEA 2GFEA 2QJEA 1LFIA 2GQ1A 2P1SA 4LQ2A 3C35A 3HHGA 4NG7A 5B70A 3CFXA 3LC8A 2GRVA 1FQAA 4TOZA 1H44A 4Z7EA 5KCJA 2I4CA 1GR2A 2GHBA 4PAKA 3TTLA 2RC8A 3IO6A 2JJKA 1RDXA 4ZEBA 4MEVA 2O1MA 2O68A 3QMFA 1Y20A 2XXUA 4X1DA 2F6GA 4H5FA 2ONSA 1B58A 1HSJA 4RK2A 1QW0A 2Z23A 3DELB 4F3SA 1NL5A 4GQOA 3FBPA 4NF4B 3FUZA 4ELOA 1SW1A 5H8HB 1MH3A 4EQ9A 4LA9A 4GF8A 4U2RA 4PAIA 5I84A 3QAXA 3UA8A 3HO7A 4WEDA 4BDMA 2F3BA 3S9MC 1I6QA 2FVZA 4KR5A 4FE8A 2XXRA 4DXBA 4G8MA 3JZJA 1JEUA 1FQFA 3MP1A 1SYHA 5I56B 2XXTA 2AIXA 3FVOA 3FXBA 4F3BA 4N91A 1UTBB 2XD3A 1LAXA 1R9QA 4XIGQ 4ZEIA 4PP0A 2B4MA 1YXIA 4F3GA 4GX6A 4MBPA 2DYXA 2ESNA 2OK2A 1PBPA 2HAVA 4FJPA 2DXRA 2NVUB 4F31B 2VD3A 2UVIA 1DPPA 3B7DA 4OA4A 1B1HA 2RC7A 4O7MA 4G68A 4X48A 2O6AA 3FXUA 1LFHA 2H99A 1XT8A 3PPOA 3CVGA 2Z8EA 5H8FA 3ILUB 3N26A 4AS4A 3H6UA 1AL3A 1K9YA 4NQ8A 3KJTA 2F7AA 4R9GA 2PBWA 4OZ9A 1RKMA 3Q26A 3LSWA 5IGAA 2WYPA 1CB6A 3B8BA 2R6GE 5I58B 2VT5A 5JTYB 3EHUA 3D4GA 3G3HA 4PBQA 1B4ZA 2GH9A 3TYHA 4FIMA 1M5EA 1MXVA 4AB5A 4QF9A 4WXJA 2QVRA 3TZAA 2R8TA 4IGRA 1P99A 5ISUA 4RK9A 1OLAA 2H98A 2V25A 3CHGA 5CRYA 3OOAA 4H8JA 2PVUA 4ZE9A 4IGTA 1A8FA 4DI3D 1FTOA 2HFBA 3L6GA 3I3VA 1AH5A 4QXDA 1B3FA 2PMSA 1MY4A 5ITOA 3CIJA 4IR8A 3FIRA 3N5LA 5AA4B 5ET6A 4JBZA 1FPFA 2PT1A 3MZ1A 3C33A 4LZ8A 4GWOA 1J1NA 4N8GA 4GX4A 3ILTB 2NWJA 5I59A 1CNQA 4MJOA 2F34A 1IXIA 1LAHE 1AOVA 1LBXA 5JEIA 1UQWA 4F18A 3K01A 2HXWA 2IA4A 1NNKA 4X1BA 4THIA 3TTNA 4H45A 3KGCA 3FVNA 1MY2A 3MVXA 3TCFA 4TQUQ 5AE4A 3THIA 2CEXA 2CZLA 1B46A 3H3GA 3PMWA 1IIWA 4NHBA 2RCBA 3VXBA 3K6XA 3FV2A 2PFYA 5TP9B 2ZXTA 1QJMA 4I8CA 1N76A 1FPGA 1INPA 4ESWA 4GWUA 3SKPA 1IMDA 2MKZA 2NUVA 2O1LA 5FBPA 1S50A 2DE3A 3MWBA 3O28A 4NE4A 1MXUA 3DP8A 5I2NA 4G4PA 3FV1A 3KOTA 4NAPA 4ELRA 3KEIA 3B6QA 1OVBA 3H6WA 5J16A 2VGQA 1SW2A 1HSEA 1GGGA 2V3UA 3IO4A 1TT1A 3TQLA 2YPNA 1LAFE 3O6IA 2B4LA 1DK4A 1LEVA 4NEDA 4F3PA 2Y7RA 3HCQA 3NOHA 4O94A 4R6KA 1IEJA 1MM6A 5DT6A 4MHFA 4ZEFA 5FHOA 4EUOA 1HSLA 3SDFA 2XHDA 3KC1A 1O7TA 3SESA 4GRKA 4BDRA 1JVYA 1NV4A 1EZOA 1Y4TA 5CI5A 1NFTA 3L6HA 1LB8A 3CRBA 1KWHA 2FIXA 2ZZXA 1EZPA 3ODBA 3SZPA 1MY3A 5I2KA 4OENA 4NGUA 1FJ6A 4NF4A 2E0SA 2R71A 1D9QA 4O3BA 5H8HA 1R1NA 3ZSFA 1QUIA 1Q9DA 1FTJA 2XWKA 3IOTA 4GLIA 5EQAA 4P47A 3H03A 2PX1A 2KQZA 2IEEA 5I7IA 4OVPA 1NV5A 4OERA 5I56A 1QGXA 3K0VA 3K1PA 4KD5A 1N3XA 4MNIA 3T1BA 3KN8A 1UTBA 2L5VA 2HPGA 1I6BA 3C36A 4PDHA 2QS4A 4MF3A 1Y9UA 4ESXA 2WX9A 2D3IA 4AB6A 3IB1A 3FVGA 1TXFA 4FECA 2ALUA 1ANFA 4GWXA 5L9SA 3TUSA 1NV7A 4G8HA 5KZTA 3FXQA 2UVHA 5CMCA 4F29A 3H06B 4LONB 4OEVA 4XFEA 2DE4A 2DWIA 1DTGA 2AL4A 5CMBA 1SW4A 4PQJA 3G3GA 4OVQA 4PCDA 4F1VA 4KCCA 1SVXB 1DSNA 5IZ3B 4HCWA 4C0RA 3UP9A 1I6AA 5IM2A 1YZ0A 3W15C 2RKMA 4MX6A 5I58A 1UIVA 3T93B 1B3LA 3UIFA 2HQ0A 3VLUA 4NTLA 2Q2CA 1Q35A 4FEBA 3KSJA 4R73A 3MSTA 1MXZA 5LDZA 1NI9A 3VDFA 4F2QA 4YB7A 3RUMA 5H8QB 4BDQA 1ZKBA 1KA1A 3OD7A 2QMWA 4P9KA 1DOTA 2HXRA 1Z7ME 4PFWA 1M5DA 4XEQA 2DWAA 3EHSA 1FJ9A 3ONMA 3ROJA 1F9BA 4PC9A 4YKIA 1OMPA 4WEPA 3T9XB 1FPBA 4P11A 5ET7A 3PUYE 4U4SA 2F7CA 3M3KA 5AA4A 3V83A 1GV8A 3A3CA 4PBHA 1LAGE 3CSBA 3K2DA 1XC1A 3RTWB 4OVTA 1NMUA 4EQ7A 1MG1A 2XXIA 1P1OA 3S2VA 1FTMA 4N07A 3S9LC 3GBAA 5DEXA 1RYOA 4H46A 1PBQA 1D9VA 5ITPA 1SI0A 2KLFA 1B6HA 3CSGA 3N94A 3RTFB 4OWDA 4QSCA 3DLNA 1G0IA 4LP2B 4XF5A 3DP4A 4OHNA 3S9EA 3R6UA 3T9VA 1B0HA 1JQFA 4YB5A 2QL3A 2OLBA 3T22A 4LVQA 1B5JA 1IMFA 2NOOA 3LV0A 5TP9A 1JNFA 2DS9A 2VPNA 1IXCA 4GX3A 3OSRA 3I5OA 4Q30B 1ATGA 3OEMA 5T3JA 2DWJA 1A55A 3BFTA 1DMBA 4XKPA 1LBYA 2VOZA 3K1MA 1LFGA 1EZ9A 5ELVA 3QUJA 4ZEDA 5BUUA 4DXUA 2DE2A 1SYIA 2XX9A 2DVZA 4X04A 4ZECA 5A5XA 4I3EA 1DBZA 1NUXA 5H8NB 2VPOA 2THIA 1ZTYA 4HCYA 2B3BA 1H3DA 4P0IA 3TTKA 2UVJA 1Z7NE 3K02A 1LBVA 3AXFA 3BFUA 3PPRA 3RN8A 3PMXA 3N6TA 2F36A 1LCTA 5EQ7A 3FZVA 3FXRA 1NUWA 1MH4A 2B3FA 1URGA 3EN3A 3M8UA 2UYEA 1Y1ZA 4NF8B 4U1OA 3H7MA 1FTKA 3MW0A 2ZNTA 4R72A 2Q88A 2WKYA 2I0BA 2P3NA 3A09A 1RDZA 3FJ7A 4BDNA 3PUXE 4U4XA 2X7QA 5AA1A 3K1NA 1WODA 5F7VA 2ANJA 1XI6A 4MMPA 1AWBA 4IO5A 4JWOA 1USYH 3KG2A 5EQ8A 2ZYNA 3IJOB 4C1UA 4U22A 1FBEA 5FHNA 2F5XA 1TWYA 4U23A 3K6WA 3KN3A 2O51A 3SEUA 3CFLA 2PT2A
chains in the Genus database with same CATH topology
1PB8A 1B9JA 4ZS9A 4YMAA 3ZKKA 2F8DA 4G77A 3IB0A 3OXNA 3TTMA 3W9VA 2HZKA 4JB7A 5TPAB 3G7WA 1FW0A 1LBBA 4FORA 4QRZA 3H6TA 3TELA 4M4GA 1MQHA 3OO8A 3BKIB 4KHZE 3Q25A 3U72A 4GVOA 4IO3A 2F6PA 1LSTA 1SI1A 5EHMA 1MY1A 4QFNA 5B7DA 4RJZA 5DVJA 2A5TB 3HN0A 3C9HA 1BLFA 2RINA 5H8QA 4MFIA 2QS1A 3MVYA 3S4UA 3M3FA 3LBSA 4ZZAA 2RF1A 3FVKA 4LATA 4R74A 1WDNA 5CMKA 1YTVA 2XX7A 1GVCA 3G3IA 2E1SA 4JSOA 3ECRA 4EDPA 4DLDA 5F1QA 3PUWE 2X26A 4YAHX 2XXXA 2F7BA 3TFLA 3FJMA 3OO6A 2I48A 3MVWA 1TFDA 4M1VA 3U8QA 4IO4A 1POY1 3DP6A 4EXKA 1USYE 4QFKA 5HM4B 1OIBA 1QKBA 3LR1A 3CG1A 2DSFA 5L8DA 1LB9A 4OFOA 2I4BA 1A54A 1Y4CA 1B52A 2I3WA 5L9OA 3E4RA 3R26A 2QSXA 3U1OA 1B5HA 3RNNA 4C1TA 2ZNSA 3RLFE 4U21A 3FGSA 4KQPA 1YCJA 4ISUA 3OO9A 3O2AA 3OMBA 2V84A 4R6YA 2H4IA 1B32A 4RY1A 2XXQA 1FQDA 4TLMB 4H67A 2O7IA 2OJTA 3QUFA 4XKRA 4G68C 2XXYA 1L5TA 3HV1A 3TPAA 1P1WA 1DPEA 3SEWA 1NNFA 3MC2A 4POXA 4U1ZA 2FNCA 3T66A 2H25A 1MPDA 1P1QA 3U92A 4PFUA 5H8NA 3HPIA 2V3QA 2D21A 1URSA 4NMYA 2I6EA 1Q1KA 1DTZA 3HHFA 2VD2A 2O69A 2I58A 1B3EA 2ZNUA 3UN6A 2GHAA 1B7UA 4RXLA 1B3HA 4RNSA 5CMMA 4QFLA 4NF8A 1M5BA 3OEKA 3VVDA 2UYFA 1MQGA 4X9TA 1IXGA 2V3TA 1QUJA 3E3KA 3M3LA 5EHSA 1FTLA 4GL0A 4YB6A 1MDQA 1FQEA 1B7HA 3C32A 4KFQA 4RA1A 2F35A 3IOVA 4XTCQ 1AMFA 4MLVA 3TEPA 2Z22A 4DXCA 4I9DA 3SEYA 3IL1B 2H9BA 2QPQA 4QSEA 4OETA 4I1DA 1H45A 2HEUA 5JTYA 1BP5A 1D4NA 2XX8A 1OQGA 1IQ7A 1SD3A 1ZU0A 4IO7A 3B6TA 3CI8A 4KCDA 1EH3A 4E0XA 2Z8DA 3PD8A 1MM7A 2RC9A 4YICA 4F2OA 4E0WA 1RYXA 4RPNA 1N84A 4KYEA 3Q27A 4IB2A 4ZDMA 3RY3A 2DVCA 2Q2AA 5CBRA 3QK6A 1VSOA 4OESA 3RPWA 3IOWA 3MP6A 3IORA 1FQBA 3SEVA 2XXPA 3GZGA 5TPAA 4Z0IA 4H0WA 4NF5B 4R6HA 3QSLA 3KJ7A 1SBPA 2DQVA 1MQIA 2AYSA 3MAMA 1N0TA 4JDFA 4IY5A 5AA3A 3MVZA 4LZ7A 3RQTA 1B7ZA 4KYDA 3GBBA 2Q9TA 4H1XA 4JXIA 3K6UA 3TTRA 4YKKA 2I3VA 4EF1A 4R9FA 1VR5A 1JVXA 1NH8A 4NF6B 2Z8FA 3MZ9A 3VLWA 2A5TA 4GL8A 4PETA 3DM0A 1FQCA 4FATA 1FCKA 2ONRA 4PFTA 2F97A 2YJPA 3O29A 3VE1B 5JK4A 2DWHA 1D9YA 1SDXA 4GXSB 4LQ5A 1N04A 4OXVA 4IO6A 2OZZA 1MPCA 4GIZA 1R9LA 3K6VA 1Y3PA 1O63A 2DP8A 5H8SA 1IXHA 1A40A 1YAEA 4O3AA 1JETA 3USDA 4ELPA 4GFRA 1B5IA 2G29A 4R2BA 1ZJLA 4JSDA 3GLBA 3H4ZA 3CFZA 3PMVA 3EPEA 1MY0A 2O7UA 4RPOA 3IB2A 3T96B 1LGBC 4UACA 5BWJA 1MPBA 3PGFA 1PB7A 4F1YA 1O64A 2ABHA 4H5GA 3TCHA 5FTHA 4GD5A 1S7YA 3LSFB 4QFOA 4YKPA 5I2KB 2Q8JA 4PE5B 2HZLA 4XKNA 1LLSA 3H6VA 1JW1A 3PUVE 2D5WA 4OYVA 3RT6B 3V8XB 3OSQA 2ZMBA 3IOUA 3UGWA 2G93A 4F19A 1MRPA 4XXUA 3TMGA 2NXOA 3U94A 1QKAA 3PV0E 3G3JA 3KFMA 4N13A 1GTKA 3PUZE 4BLAA 1Y3QA 1B05A 1B3GA 3HSTA 3G3FA 4DIGA 1MXYA 3MPLA 5IKBA 3VVFA 1ZIUA 3KSXA 5DTBA 1QUKA 3IAZA 2OBGA 5KDTB 2ZYKA 1WVJA 3QIMA 1NNPA 4POWA 4ZEKA 1A7LA 3T9UA 4ZZEA 4PFYA 3S9NC 1UIUA 5FTIA 1BTJA 2XXVA 2XXWA 5K2XA 1US5A 3O66A 3VFJA 3FD3A 2FA7A 3FASA 5FHMA 3V5AA 1T0KA 1NKXA 1M5FA 4G2ZA 3SEXA 5AA2B 4HS7A 3FATA 3LSXA 3VLVA 3MP8A 1OLCA 3RT8A 4H65A 3ZS6A 4YMBA 3IR1A 4QSDA 3IX1A 3LSLA 4G8NA 1OVTA 3KBRA 3LUYA 1I69A 4OFLA 4H8IA 1MDP1 3VVEA 1PB9A 3CR9A 2M8CA 2DOJA 4DE8A 5I57B 1ZLQA 3MUQA 3B6WA 2LAOA 3D4CA 3KZGA 1MQJA 1URDA 4DZ1A 2DXYA 2FYIA 1N7WA 1UTHB 4YKJA 4KI0E 3I6VA 1JEVA 4KPTA 4EF2A 1QVSA 2ZYMA 3JYRA 5M2VA 3TKDA 4L17A 2I49A 1IUDA 2OWTA 3KN7A 2VP1A 2Y7IA 2H5YA 2Y7WA 1R6ZA 3PPPA 1JW4A 2P2AA 3MZBA 3UK4A 2BJJX 4DCXA 5K2YA 2R9JA 1POTA 5L9MA 5LOMA 5CC2A 4ONYA 2Y7PA 4NF5A 5DEXB 4LZ5A 5EYFA 4KYSA 1NNTA 3TQWA 4IO2A 2HCAA 3F11A 1YPNA 3O97A 3FJGA 5DVIA 1BKAA 2RCAA 4OVJA 2QS2A 4ZE8A 1XVYA 3Q29A 1B40A 1H76A 5KCJB 3VXCA 1N7XA 3MQ9A 4BDOA 4ELQA 2O84X 4NF6A 1P1NA 3T9HB 3CG3A 3A3UA 4DDDA 1A99A 5CBSA 3OO7A 4BDLA 1BIYA 4YZZA 1PEBA 1D3KA 1PC3A 1N3WA 1B1XA 3E9XA 2HAUA 1LBCA 1VFDA 3BBRA 4ECFA 4XKQA 2I0CA 3PPNA 1ZMGA 2OWSA 5A5XB 3UORA 5DVFA 3IJXB 4P0GA 1XS5A 3EQ1A 3EHTA 3K00A 1B0LA 4OEUA 3RGYA 2Y84A 3PPQA 3U93A 1B4HA 1US4A 2REJA 2QRYA 3OELA 4OTEA 1A8EA 2ZYOA 3C34A 1ZBMA 1Y1MA 3TODA 5AA2D 4QFPA 4QHQA 4O3CA 1II5A 5ICQA 3V89B 2YLNA 4UA8A 1SQYA 4FEDA 3QYTA 4EXLA 2OCUA 3C4MA 3MJNA 1TFAA 4NWCA 3TCGA 1OQHA 4G68B 3K4UA 4FAJA 2W7YA 5ICTA 4DCYA 4AQ4A 3W9WA 1Y3NA 3WAFA 1QULA 5H8FB 3ZKLA 4Q0CA 1ELJA 1H43A 4MLQA 4RYAA 1LCFA 1MXXA 4F1UA 2QMXA 2PYYA 5J1DA 3G3KA 1IITA 3O9PA 4H6DA 1XVXA 3EF7A 4F39A 5CM6A 5KDTA 2XD2A 4JWYA 1PDAA 4HW8A 1P1UA 4OQOA 4ND9A 4Q8RA 1B51A 2REGA 3KOSA 1M5CA 1CE2A 2A5SA 1MXWA 1JW5A 2CMOA 4WKMA 3PD9A 3PU5A 3QXMA 4HTGA 5DYHA 3OENA 2X7PA 3C31A 3O6GA 5AA2A 3MBPA 2VHAA 4LUBA 4MH5A 2UXAA 2QS3A 4OFJA 3R7XA 5HBCA 4YU0A 4I62A 3Q28A 5I59B 1S9TA 4EQBA 1XHYA 2AL5A 4K3FA 2Y7KA 4Q5TA 1MQDA 3SETA 1VE4A 2Q89A 1B2HA 4R2FA 4OMBA 2XXHA 5I57A 3E13X 4F22A 2UVGA 3GXAA 4IY6A 1UTHA 3IK6B 1AIVA 2F78A 3TAJA 3O6HA 1EU8A 2V93A 5TU0A 3VV5A 5IAIA 1SW5A 4N6PA 1IZ1A 1MS7A 1NH7A 3TDJA 5HPQA 4JWXA 2ONKE 2P0SA 4GOTA 2B65A 1XOCA 3SERA 4TLLB 3MPKA 3N6UA 3P7IA 1VFEA 5I2NB 4NWDA 4GXAA 3JV9A 4R75A 3WAEA 2GFEA 2QJEA 1LFIA 2P1SA 4LQ2A 3C35A 3HHGA 5B70A 3CFXA 3LC8A 2GRVA 1FQAA 4TOZA 1H44A 4Z7EA 5KCJA 2I4CA 1GR2A 2GHBA 3TTLA 2RC8A 3IO6A 4ZEBA 2O1MA 2O68A 1Y20A 2XXUA 4X1DA 2F6GA 4H5FA 2ONSA 1B58A 1HSJA 4RK2A 1QW0A 2Z23A 3DELB 4F3SA 1NL5A 4GQOA 4NF4B 3FUZA 4ELOA 1SW1A 5H8HB 1MH3A 4EQ9A 4LA9A 4GF8A 4U2RA 5I84A 3QAXA 3UA8A 3HO7A 4WEDA 4BDMA 3S9MC 1I6QA 4KR5A 4FE8A 4DXBA 2XXRA 4G8MA 3JZJA 1JEUA 1FQFA 3MP1A 1SYHA 5I56B 2XXTA 2AIXA 3FVOA 4F3BA 1UTBB 2XD3A 1LAXA 1R9QA 4XIGQ 4ZEIA 4PP0A 4F3GA 4MBPA 2DYXA 2ESNA 2OK2A 1PBPA 2HAVA 4FJPA 2DXRA 2NVUB 4F31B 2VD3A 2UVIA 1DPPA 3B7DA 1B1HA 2RC7A 4G68A 4X48A 2O6AA 3FXUA 1LFHA 2H99A 1XT8A 3PPOA 3CVGA 2Z8EA 5H8FA 3ILUB 3N26A 3H6UA 1AL3A 3KJTA 2F7AA 4R9GA 2PBWA 4OZ9A 1RKMA 3Q26A 3LSWA 1CB6A 2R6GE 5I58B 5JTYB 3EHUA 3D4GA 3G3HA 1B4ZA 2GH9A 3TYHA 4FIMA 1M5EA 1MXVA 4AB5A 4QF9A 4WXJA 3TZAA 4IGRA 1P99A 5ISUA 4RK9A 1OLAA 2H98A 2V25A 5CRYA 3OOAA 4H8JA 2PVUA 4ZE9A 4IGTA 1A8FA 1FTOA 2HFBA 3L6GA 3I3VA 1AH5A 1B3FA 2PMSA 1MY4A 5ITOA 3CIJA 3FIRA 3N5LA 5AA4B 4JBZA 2PT1A 3MZ1A 3C33A 4LZ8A 4GWOA 1J1NA 3ILTB 2NWJA 5I59A 2F34A 1IXIA 1LAHE 1AOVA 5JEIA 1UQWA 4F18A 3K01A 2HXWA 2IA4A 1NNKA 4X1BA 4THIA 3TTNA 3KGCA 3FVNA 1MY2A 3MVXA 3TCFA 4TQUQ 5AE4A 3THIA 2CZLA 1B46A 3H3GA 3PMWA 1IIWA 2RCBA 3VXBA 3K6XA 3FV2A 5TP9B 2ZXTA 1QJMA 4I8CA 1N76A 4ESWA 3SKPA 2NUVA 2O1LA 1S50A 2DE3A 3MWBA 3O28A 4NE4A 1MXUA 3DP8A 5I2NA 4G4PA 3FV1A 3KOTA 4ELRA 3KEIA 3B6QA 1OVBA 3H6WA 2VGQA 1SW2A 1HSEA 1GGGA 2V3UA 3IO4A 1TT1A 3TQLA 2YPNA 1LAFE 3O6IA 4NEDA 4F3PA 2Y7RA 3HCQA 4R6KA 1IEJA 1MM6A 5DT6A 4ZEFA 5FHOA 4EUOA 1HSLA 3SDFA 2XHDA 1O7TA 3SESA 4GRKA 4BDRA 1JVYA 1EZOA 1Y4TA 5CI5A 1NFTA 3L6HA 1LB8A 3CRBA 1KWHA 1EZPA 3ODBA 5I2KA 1MY3A 4OENA 4NF4A 2E0SA 2R71A 4O3BA 5H8HA 1R1NA 3ZSFA 1QUIA 1FTJA 3IOTA 4GLIA 3H03A 2PX1A 2IEEA 4OERA 5I56A 3K0VA 3K1PA 4KD5A 1N3XA 3KN8A 1UTBA 1I6BA 3C36A 2QS4A 4MF3A 1Y9UA 4ESXA 2D3IA 4AB6A 3IB1A 3FVGA 1TXFA 4FECA 2ALUA 1ANFA 5L9SA 3TUSA 4G8HA 5KZTA 3FXQA 2UVHA 5CMCA 4F29A 3H06B 4LONB 4OEVA 2DE4A 2DWIA 1DTGA 2AL4A 5CMBA 1SW4A 4PQJA 3G3GA 4F1VA 4KCCA 1SVXB 1DSNA 4HCWA 4C0RA 3UP9A 1I6AA 3W15C 2RKMA 5I58A 1UIVA 3T93B 1B3LA 3UIFA 2HQ0A 3VLUA 4NTLA 2Q2CA 1Q35A 4FEBA 3KSJA 4R73A 1MXZA 3VDFA 4F2QA 4YB7A 3RUMA 5H8QB 4BDQA 1ZKBA 3OD7A 2QMWA 1DOTA 1Z7ME 4PFWA 1M5DA 2DWAA 3EHSA 3ONMA 1F9BA 4YKIA 1OMPA 4WEPA 3T9XB 4P11A 3PUYE 4U4SA 2F7CA 3M3KA 5AA4A 3V83A 1GV8A 3A3CA 1LAGE 3CSBA 3K2DA 1XC1A 3RTWB 1NMUA 4EQ7A 1MG1A 2XXIA 1P1OA 3S2VA 1FTMA 4N07A 3S9LC 3GBAA 5DEXA 1RYOA 1PBQA 1D9VA 5ITPA 1SI0A 2KLFA 1B6HA 3CSGA 3N94A 3RTFB 4OWDA 4QSCA 3DLNA 4LP2B 3DP4A 4OHNA 3S9EA 3R6UA 3T9VA 1B0HA 1JQFA 4YB5A 2QL3A 2OLBA 3T22A 4LVQA 1B5JA 2NOOA 5TP9A 1JNFA 2DS9A 1IXCA 3OSRA 3I5OA 4Q30B 1ATGA 3OEMA 2DWJA 1A55A 3BFTA 1DMBA 4XKPA 2VOZA 3K1MA 1LFGA 1EZ9A 5ELVA 3QUJA 4ZEDA 5BUUA 4DXUA 2DE2A 1SYIA 2XX9A 2DVZA 4ZECA 5A5XA 5H8NB 2THIA 1ZTYA 4HCYA 2B3BA 1H3DA 4P0IA 3TTKA 2UVJA 1Z7NE 3K02A 3AXFA 3BFUA 3PPRA 3RN8A 3PMXA 3N6TA 2F36A 1LCTA 3FZVA 3FXRA 1MH4A 2B3FA 1URGA 3EN3A 3M8UA 2UYEA 1Y1ZA 4NF8B 4U1OA 3H7MA 1FTKA 3MW0A 2ZNTA 4R72A 2Q88A 2WKYA 2I0BA 3A09A 3FJ7A 4BDNA 3PUXE 4U4XA 2X7QA 5AA1A 3K1NA 1WODA 5F7VA 2ANJA 4IO5A 4JWOA 1USYH 3KG2A 2ZYNA 3IJOB 4C1UA 4U22A 5FHNA 2F5XA 1TWYA 4U23A 3K6WA 3KN3A 2O51A 3SEUA 3CFLA 2PT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PB8 A;  1B9J A;  4ZS9 A;  4YMA A;  3ZKK A;  2F8D A;  4G77 A;  3IB0 A;  3OXN A;  3TTM A;  3W9V A;  2HZK A;  4JB7 A;  5TPA B;  3G7W A;  1FW0 A;  1LBB A;  4FOR A;  4QRZ A;  3H6T A;  3TEL A;  4M4G A;  1MQH A;  3OO8 A;  3BKI B;  4KHZ E;  3Q25 A;  3U72 A;  4GVO A;  4IO3 A;  2F6P A;  1LST A;  1SI1 A;  5EHM A;  1MY1 A;  4QFN A;  5B7D A;  4RJZ A;  5DVJ A;  2A5T B;  3HN0 A;  3C9H A;  1BLF A;  2RIN A;  5H8Q A;  4MFI A;  2QS1 A;  3MVY A;  3S4U A;  3M3F A;  3LBS A;  4ZZA A;  2RF1 A;  3FVK A;  4LAT A;  4R74 A;  1WDN A;  5CMK A;  1YTV A;  2XX7 A;  1GVC A;  3G3I A;  2E1S A;  4JSO A;  3ECR A;  4EDP A;  4DLD A;  5F1Q A;  3PUW E;  2X26 A;  4YAH X;  2XXX A;  2F7B A;  3TFL A;  3FJM A;  3OO6 A;  2I48 A;  3MVW A;  1TFD A;  4M1V A;  3U8Q A;  4IO4 A;  1POY 1;  3DP6 A;  4EXK A;  1USY E;  4QFK A;  5HM4 B;  1OIB A;  1QKB A;  3LR1 A;  3CG1 A;  2DSF A;  5L8D A;  1LB9 A;  4OFO A;  2I4B A;  1A54 A;  1Y4C A;  1B52 A;  2I3W A;  5L9O A;  3E4R A;  3R26 A;  2QSX A;  3U1O A;  1B5H A;  3RNN A;  4C1T A;  2ZNS A;  3RLF E;  4U21 A;  3FGS A;  4KQP A;  1YCJ A;  4ISU A;  3OO9 A;  3O2A A;  3OMB A;  2V84 A;  4R6Y A;  2H4I A;  1B32 A;  4RY1 A;  2XXQ A;  1FQD A;  4TLM B;  4H67 A;  2O7I A;  2OJT A;  3QUF A;  4XKR A;  4G68 C;  2XXY A;  1L5T A;  3HV1 A;  3TPA A;  1P1W A;  1DPE A;  3SEW A;  1NNF A;  3MC2 A;  4POX A;  4U1Z A;  2FNC A;  3T66 A;  2H25 A;  1MPD A;  1P1Q A;  3U92 A;  4PFU A;  5H8N A;  3HPI A;  2V3Q A;  2D21 A;  1URS A;  4NMY A;  2I6E A;  1Q1K A;  1DTZ A;  3HHF A;  2VD2 A;  2O69 A;  2I58 A;  1B3E A;  2ZNU A;  3UN6 A;  2GHA A;  1B7U A;  4RXL A;  1B3H A;  4RNS A;  5CMM A;  4QFL A;  4NF8 A;  1M5B A;  3OEK A;  3VVD A;  2UYF A;  1MQG A;  4X9T A;  1IXG A;  2V3T A;  1QUJ A;  3E3K A;  3M3L A;  5EHS A;  1FTL A;  4GL0 A;  4YB6 A;  1MDQ A;  1FQE A;  1B7H A;  3C32 A;  4KFQ A;  4RA1 A;  2F35 A;  3IOV A;  4XTC Q;  1AMF A;  4MLV A;  3TEP A;  2Z22 A;  4DXC A;  4I9D A;  3SEY A;  3IL1 B;  2H9B A;  2QPQ A;  4QSE A;  4OET A;  4I1D A;  1H45 A;  2HEU A;  5JTY A;  1BP5 A;  1D4N A;  2XX8 A;  1OQG A;  1IQ7 A;  1SD3 A;  1ZU0 A;  4IO7 A;  3B6T A;  3CI8 A;  4KCD A;  1EH3 A;  4E0X A;  2Z8D A;  3PD8 A;  1MM7 A;  2RC9 A;  4YIC A;  4F2O A;  4E0W A;  1RYX A;  4RPN A;  1N84 A;  4KYE A;  3Q27 A;  4IB2 A;  4ZDM A;  3RY3 A;  2DVC A;  2Q2A A;  5CBR A;  3QK6 A;  1VSO A;  4OES A;  3RPW A;  3IOW A;  3MP6 A;  3IOR A;  1FQB A;  3SEV A;  2XXP A;  3GZG A;  5TPA A;  4Z0I A;  4H0W A;  4NF5 B;  4R6H A;  3QSL A;  3KJ7 A;  1SBP A;  2DQV A;  1MQI A;  2AYS A;  3MAM A;  1N0T A;  4JDF A;  4IY5 A;  5AA3 A;  3MVZ A;  4LZ7 A;  3RQT A;  1B7Z A;  4KYD A;  3GBB A;  2Q9T A;  4H1X A;  4JXI A;  3K6U A;  3TTR A;  4YKK A;  2I3V A;  4EF1 A;  4R9F A;  1VR5 A;  1JVX A;  1NH8 A;  4NF6 B;  2Z8F A;  3MZ9 A;  3VLW A;  2A5T A;  4GL8 A;  4PET A;  3DM0 A;  1FQC A;  4FAT A;  1FCK A;  2ONR A;  4PFT A;  2F97 A;  2YJP A;  3O29 A;  3VE1 B;  5JK4 A;  2DWH A;  1D9Y A;  1SDX A;  4GXS B;  4LQ5 A;  1N04 A;  4OXV A;  4IO6 A;  2OZZ A;  1MPC A;  4GIZ A;  1R9L A;  3K6V A;  1Y3P A;  1O63 A;  2DP8 A;  5H8S A;  1IXH A;  1A40 A;  1YAE A;  4O3A A;  1JET A;  3USD A;  4ELP A;  4GFR A;  1B5I A;  2G29 A;  4R2B A;  1ZJL A;  4JSD A;  3GLB A;  3H4Z A;  3CFZ A;  3PMV A;  3EPE A;  1MY0 A;  2O7U A;  4RPO A;  3IB2 A;  3T96 B;  1LGB C;  4UAC A;  5BWJ A;  1MPB A;  3PGF A;  1PB7 A;  4F1Y A;  1O64 A;  2ABH A;  4H5G A;  3TCH A;  5FTH A;  4GD5 A;  1S7Y A;  3LSF B;  4QFO A;  4YKP A;  5I2K B;  2Q8J A;  4PE5 B;  2HZL A;  4XKN A;  1LLS A;  3H6V A;  1JW1 A;  3PUV E;  2D5W A;  4OYV A;  3RT6 B;  3V8X B;  3OSQ A;  2ZMB A;  3IOU A;  3UGW A;  2G93 A;  4F19 A;  1MRP A;  4XXU A;  3TMG A;  2NXO A;  3U94 A;  1QKA A;  3PV0 E;  3G3J A;  3KFM A;  4N13 A;  1GTK A;  3PUZ E;  4BLA A;  1Y3Q A;  1B05 A;  1B3G A;  3HST A;  3G3F A;  4DIG A;  1MXY A;  3MPL A;  5IKB A;  3VVF A;  1ZIU A;  3KSX A;  5DTB A;  1QUK A;  3IAZ A;  2OBG A;  5KDT B;  2ZYK A;  1WVJ A;  3QIM A;  1NNP A;  4POW A;  4ZEK A;  1A7L A;  3T9U A;  4ZZE A;  4PFY A;  3S9N C;  1UIU A;  5FTI A;  1BTJ A;  2XXV A;  2XXW A;  5K2X A;  1US5 A;  3O66 A;  3VFJ A;  3FD3 A;  2FA7 A;  3FAS A;  5FHM A;  3V5A A;  1T0K A;  1NKX A;  1M5F A;  4G2Z A;  3SEX A;  5AA2 B;  4HS7 A;  3FAT A;  3LSX A;  3VLV A;  3MP8 A;  1OLC A;  3RT8 A;  4H65 A;  3ZS6 A;  4YMB A;  3IR1 A;  4QSD A;  3IX1 A;  3LSL A;  4G8N A;  1OVT A;  3KBR A;  3LUY A;  1I69 A;  4OFL A;  4H8I A;  1MDP 1;  3VVE A;  1PB9 A;  3CR9 A;  2M8C A;  2DOJ A;  4DE8 A;  5I57 B;  1ZLQ A;  3MUQ A;  3B6W A;  2LAO A;  3D4C A;  3KZG A;  1MQJ A;  1URD A;  4DZ1 A;  2DXY A;  2FYI A;  1N7W A;  1UTH B;  4YKJ A;  4KI0 E;  3I6V A;  1JEV A;  4KPT A;  4EF2 A;  1QVS A;  2ZYM A;  3JYR A;  5M2V A;  3TKD A;  4L17 A;  2I49 A;  1IUD A;  2OWT A;  3KN7 A;  2VP1 A;  2Y7I A;  2H5Y A;  2Y7W A;  1R6Z A;  3PPP A;  1JW4 A;  2P2A A;  3MZB A;  3UK4 A;  2BJJ X;  4DCX A;  5K2Y A;  2R9J A;  1POT A;  5L9M A;  5LOM A;  5CC2 A;  4ONY A;  2Y7P A;  4NF5 A;  5DEX B;  4LZ5 A;  5EYF A;  4KYS A;  1NNT A;  3TQW A;  4IO2 A;  2HCA A;  3F11 A;  1YPN A;  3O97 A;  3FJG A;  5DVI A;  1BKA A;  2RCA A;  4OVJ A;  2QS2 A;  4ZE8 A;  1XVY A;  3Q29 A;  1B40 A;  1H76 A;  5KCJ B;  3VXC A;  1N7X A;  3MQ9 A;  4BDO A;  4ELQ A;  2O84 X;  4NF6 A;  1P1N A;  3T9H B;  3CG3 A;  3A3U A;  4DDD A;  1A99 A;  5CBS A;  3OO7 A;  4BDL A;  1BIY A;  4YZZ A;  1PEB A;  1D3K A;  1PC3 A;  1N3W A;  1B1X A;  3E9X A;  2HAU A;  1LBC A;  1VFD A;  3BBR A;  4ECF A;  4XKQ A;  2I0C A;  3PPN A;  1ZMG A;  2OWS A;  5A5X B;  3UOR A;  5DVF A;  3IJX B;  4P0G A;  1XS5 A;  3EQ1 A;  3EHT A;  3K00 A;  1B0L A;  4OEU A;  3RGY A;  2Y84 A;  3PPQ A;  3U93 A;  1B4H A;  1US4 A;  2REJ A;  2QRY A;  3OEL A;  4OTE A;  1A8E A;  2ZYO A;  3C34 A;  1ZBM A;  1Y1M A;  3TOD A;  5AA2 D;  4QFP A;  4QHQ A;  4O3C A;  1II5 A;  5ICQ A;  3V89 B;  2YLN A;  4UA8 A;  1SQY A;  4FED A;  3QYT A;  4EXL A;  2OCU A;  3C4M A;  3MJN A;  1TFA A;  4NWC A;  3TCG A;  1OQH A;  4G68 B;  3K4U A;  4FAJ A;  2W7Y A;  5ICT A;  4DCY A;  4AQ4 A;  3W9W A;  1Y3N A;  3WAF A;  1QUL A;  5H8F B;  3ZKL A;  4Q0C A;  1ELJ A;  1H43 A;  4MLQ A;  4RYA A;  1LCF A;  1MXX A;  4F1U A;  2QMX A;  2PYY A;  5J1D A;  3G3K A;  1IIT A;  3O9P A;  4H6D A;  1XVX A;  3EF7 A;  4F39 A;  5CM6 A;  5KDT A;  2XD2 A;  4JWY A;  1PDA A;  4HW8 A;  1P1U A;  4OQO A;  4ND9 A;  4Q8R A;  1B51 A;  2REG A;  3KOS A;  1M5C A;  1CE2 A;  2A5S A;  1MXW A;  1JW5 A;  2CMO A;  4WKM A;  3PD9 A;  3PU5 A;  3QXM A;  4HTG A;  5DYH A;  3OEN A;  2X7P A;  3C31 A;  3O6G A;  5AA2 A;  3MBP A;  2VHA A;  4LUB A;  4MH5 A;  2UXA A;  2QS3 A;  4OFJ A;  3R7X A;  5HBC A;  4YU0 A;  4I62 A;  3Q28 A;  5I59 B;  1S9T A;  4EQB A;  1XHY A;  2AL5 A;  4K3F A;  2Y7K A;  4Q5T A;  1MQD A;  3SET A;  1VE4 A;  2Q89 A;  1B2H A;  4R2F A;  4OMB A;  2XXH A;  5I57 A;  3E13 X;  4F22 A;  2UVG A;  3GXA A;  4IY6 A;  1UTH A;  3IK6 B;  1AIV A;  2F78 A;  3TAJ A;  3O6H A;  1EU8 A;  2V93 A;  5TU0 A;  3VV5 A;  5IAI A;  1SW5 A;  4N6P A;  1IZ1 A;  1MS7 A;  1NH7 A;  3TDJ A;  5HPQ A;  4JWX A;  2ONK E;  2P0S A;  4GOT A;  2B65 A;  1XOC A;  3SER A;  4TLL B;  3MPK A;  3N6U A;  3P7I A;  1VFE A;  5I2N B;  4NWD A;  4GXA A;  3JV9 A;  4R75 A;  3WAE A;  2GFE A;  2QJE A;  1LFI A;  2P1S A;  4LQ2 A;  3C35 A;  3HHG A;  5B70 A;  3CFX A;  3LC8 A;  2GRV A;  1FQA A;  4TOZ A;  1H44 A;  4Z7E A;  5KCJ A;  2I4C A;  1GR2 A;  2GHB A;  3TTL A;  2RC8 A;  3IO6 A;  4ZEB A;  2O1M A;  2O68 A;  1Y20 A;  2XXU A;  4X1D A;  2F6G A;  4H5F A;  2ONS A;  1B58 A;  1HSJ A;  4RK2 A;  1QW0 A;  2Z23 A;  3DEL B;  4F3S A;  1NL5 A;  4GQO A;  4NF4 B;  3FUZ A;  4ELO A;  1SW1 A;  5H8H B;  1MH3 A;  4EQ9 A;  4LA9 A;  4GF8 A;  4U2R A;  5I84 A;  3QAX A;  3UA8 A;  3HO7 A;  4WED A;  4BDM A;  3S9M C;  1I6Q A;  4KR5 A;  4FE8 A;  4DXB A;  2XXR A;  4G8M A;  3JZJ A;  1JEU A;  1FQF A;  3MP1 A;  1SYH A;  5I56 B;  2XXT A;  2AIX A;  3FVO A;  4F3B A;  1UTB B;  2XD3 A;  1LAX A;  1R9Q A;  4XIG Q;  4ZEI A;  4PP0 A;  4F3G A;  4MBP A;  2DYX A;  2ESN A;  2OK2 A;  1PBP A;  2HAV A;  4FJP A;  2DXR A;  2NVU B;  4F31 B;  2VD3 A;  2UVI A;  1DPP A;  3B7D A;  1B1H A;  2RC7 A;  4G68 A;  4X48 A;  2O6A A;  3FXU A;  1LFH A;  2H99 A;  1XT8 A;  3PPO A;  3CVG A;  2Z8E A;  5H8F A;  3ILU B;  3N26 A;  3H6U A;  1AL3 A;  3KJT A;  2F7A A;  4R9G A;  2PBW A;  4OZ9 A;  1RKM A;  3Q26 A;  3LSW A;  1CB6 A;  2R6G E;  5I58 B;  5JTY B;  3EHU A;  3D4G A;  3G3H A;  1B4Z A;  2GH9 A;  3TYH A;  4FIM A;  1M5E A;  1MXV A;  4AB5 A;  4QF9 A;  4WXJ A;  3TZA A;  4IGR A;  1P99 A;  5ISU A;  4RK9 A;  1OLA A;  2H98 A;  2V25 A;  5CRY A;  3OOA A;  4H8J A;  2PVU A;  4ZE9 A;  4IGT A;  1A8F A;  1FTO A;  2HFB A;  3L6G A;  3I3V A;  1AH5 A;  1B3F A;  2PMS A;  1MY4 A;  5ITO A;  3CIJ A;  3FIR A;  3N5L A;  5AA4 B;  4JBZ A;  2PT1 A;  3MZ1 A;  3C33 A;  4LZ8 A;  4GWO A;  1J1N A;  3ILT B;  2NWJ A;  5I59 A;  2F34 A;  1IXI A;  1LAH E;  1AOV A;  5JEI A;  1UQW A;  4F18 A;  3K01 A;  2HXW A;  2IA4 A;  1NNK A;  4X1B A;  4THI A;  3TTN A;  3KGC A;  3FVN A;  1MY2 A;  3MVX A;  3TCF A;  4TQU Q;  5AE4 A;  3THI A;  2CZL A;  1B46 A;  3H3G A;  3PMW A;  1IIW A;  2RCB A;  3VXB A;  3K6X A;  3FV2 A;  5TP9 B;  2ZXT A;  1QJM A;  4I8C A;  1N76 A;  4ESW A;  3SKP A;  2NUV A;  2O1L A;  1S50 A;  2DE3 A;  3MWB A;  3O28 A;  4NE4 A;  1MXU A;  3DP8 A;  5I2N A;  4G4P A;  3FV1 A;  3KOT A;  4ELR A;  3KEI A;  3B6Q A;  1OVB A;  3H6W A;  2VGQ A;  1SW2 A;  1HSE A;  1GGG A;  2V3U A;  3IO4 A;  1TT1 A;  3TQL A;  2YPN A;  1LAF E;  3O6I A;  4NED A;  4F3P A;  2Y7R A;  3HCQ A;  4R6K A;  1IEJ A;  1MM6 A;  5DT6 A;  4ZEF A;  5FHO A;  4EUO A;  1HSL A;  3SDF A;  2XHD A;  1O7T A;  3SES A;  4GRK A;  4BDR A;  1JVY A;  1EZO A;  1Y4T A;  5CI5 A;  1NFT A;  3L6H A;  1LB8 A;  3CRB A;  1KWH A;  1EZP A;  3ODB A;  5I2K A;  1MY3 A;  4OEN A;  4NF4 A;  2E0S A;  2R71 A;  4O3B A;  5H8H A;  1R1N A;  3ZSF A;  1QUI A;  1FTJ A;  3IOT A;  4GLI A;  3H03 A;  2PX1 A;  2IEE A;  4OER A;  5I56 A;  3K0V A;  3K1P A;  4KD5 A;  1N3X A;  3KN8 A;  1UTB A;  1I6B A;  3C36 A;  2QS4 A;  4MF3 A;  1Y9U A;  4ESX A;  2D3I A;  4AB6 A;  3IB1 A;  3FVG A;  1TXF A;  4FEC A;  2ALU A;  1ANF A;  5L9S A;  3TUS A;  4G8H A;  5KZT A;  3FXQ A;  2UVH A;  5CMC A;  4F29 A;  3H06 B;  4LON B;  4OEV A;  2DE4 A;  2DWI A;  1DTG A;  2AL4 A;  5CMB A;  1SW4 A;  4PQJ A;  3G3G A;  4F1V A;  4KCC A;  1SVX B;  1DSN A;  4HCW A;  4C0R A;  3UP9 A;  1I6A A;  3W15 C;  2RKM A;  5I58 A;  1UIV A;  3T93 B;  1B3L A;  3UIF A;  2HQ0 A;  3VLU A;  4NTL A;  2Q2C A;  1Q35 A;  4FEB A;  3KSJ A;  4R73 A;  1MXZ A;  3VDF A;  4F2Q A;  4YB7 A;  3RUM A;  5H8Q B;  4BDQ A;  1ZKB A;  3OD7 A;  2QMW A;  1DOT A;  1Z7M E;  4PFW A;  1M5D A;  2DWA A;  3EHS A;  3ONM A;  1F9B A;  4YKI A;  1OMP A;  4WEP A;  3T9X B;  4P11 A;  3PUY E;  4U4S A;  2F7C A;  3M3K A;  5AA4 A;  3V83 A;  1GV8 A;  3A3C A;  1LAG E;  3CSB A;  3K2D A;  1XC1 A;  3RTW B;  1NMU A;  4EQ7 A;  1MG1 A;  2XXI A;  1P1O A;  3S2V A;  1FTM A;  4N07 A;  3S9L C;  3GBA A;  5DEX A;  1RYO A;  1PBQ A;  1D9V A;  5ITP A;  1SI0 A;  2KLF A;  1B6H A;  3CSG A;  3N94 A;  3RTF B;  4OWD A;  4QSC A;  3DLN A;  4LP2 B;  3DP4 A;  4OHN A;  3S9E A;  3R6U A;  3T9V A;  1B0H A;  1JQF A;  4YB5 A;  2QL3 A;  2OLB A;  3T22 A;  4LVQ A;  1B5J A;  2NOO A;  5TP9 A;  1JNF A;  2DS9 A;  1IXC A;  3OSR A;  3I5O A;  4Q30 B;  1ATG A;  3OEM A;  2DWJ A;  1A55 A;  3BFT A;  1DMB A;  4XKP A;  2VOZ A;  3K1M A;  1LFG A;  1EZ9 A;  5ELV A;  3QUJ A;  4ZED A;  5BUU A;  4DXU A;  2DE2 A;  1SYI A;  2XX9 A;  2DVZ A;  4ZEC A;  5A5X A;  5H8N B;  2THI A;  1ZTY A;  4HCY A;  2B3B A;  1H3D A;  4P0I A;  3TTK A;  2UVJ A;  1Z7N E;  3K02 A;  3AXF A;  3BFU A;  3PPR A;  3RN8 A;  3PMX A;  3N6T A;  2F36 A;  1LCT A;  3FZV A;  3FXR A;  1MH4 A;  2B3F A;  1URG A;  3EN3 A;  3M8U A;  2UYE A;  1Y1Z A;  4NF8 B;  4U1O A;  3H7M A;  1FTK A;  3MW0 A;  2ZNT A;  4R72 A;  2Q88 A;  2WKY A;  2I0B A;  3A09 A;  3FJ7 A;  4BDN A;  3PUX E;  4U4X A;  2X7Q A;  5AA1 A;  3K1N A;  1WOD A;  5F7V A;  2ANJ A;  4IO5 A;  4JWO A;  1USY H;  3KG2 A;  2ZYN A;  3IJO B;  4C1U A;  4U22 A;  5FHN A;  2F5X A;  1TWY A;  4U23 A;  3K6W A;  3KN3 A;  2O51 A;  3SEU A;  3CFL A;  2PT2 A; 
#chains in the Genus database with same CATH topology
 1PB8 A;  3BIG A;  1B9J A;  4ZS9 A;  4PAF A;  4YMA A;  3ZKK A;  2F8D A;  4G77 A;  3IB0 A;  3OXN A;  3TTM A;  4X8R A;  3W9V A;  4PFR A;  3RYD A;  2HZK A;  4JB7 A;  5TPA B;  3G7W A;  1FW0 A;  1LBB A;  4FOR A;  4QRZ A;  3H6T A;  3TEL A;  2CZI A;  4M4G A;  1MQH A;  3OO8 A;  4JVC A;  5IZ3 A;  3BKI B;  4KHZ E;  3Q25 A;  3U72 A;  4GVO A;  2XWO A;  4IO3 A;  2F6P A;  1LST A;  1SI1 A;  5EHM A;  1MY1 A;  4JVI A;  3E79 A;  4QFN A;  5B7D A;  3KBZ A;  4RJZ A;  5DVJ A;  2A5T B;  3HN0 A;  3C9H A;  1BLF A;  2RIN A;  5H8Q A;  4MFI A;  2QS1 A;  3MVY A;  3S4U A;  1NV2 A;  3M3F A;  3LBS A;  4ZZA A;  2RF1 A;  3FVK A;  4LAT A;  4R74 A;  2FHY A;  1WDN A;  5CMK A;  1YTV A;  2XX7 A;  1GVC A;  3G3I A;  2E1S A;  4JSO A;  3ECR A;  4EDP A;  4DLD A;  1KA0 A;  3BIH A;  4N17 A;  5F1Q A;  3PUW E;  2X26 A;  4YAH X;  1YYZ A;  2XXX A;  2F7B A;  3A29 A;  3TFL A;  3ISP A;  3FJM A;  3OO6 A;  4P8B A;  2I48 A;  3MVW A;  1TFD A;  4M1V A;  3U8Q A;  4IO4 A;  1POY 1;  3DP6 A;  4EXK A;  1USY E;  4QFK A;  5HM4 B;  4LN5 A;  1OIB A;  1QKB A;  2FBP A;  3RPL B;  3LR1 A;  3CG1 A;  2DSF A;  5L8D A;  1LB9 A;  5IZZ A;  4OFO A;  2I4B A;  1A54 A;  3E78 A;  1Y4C A;  1B52 A;  4O7I A;  2I3W A;  5L9O A;  3E4R A;  3R26 A;  2QSX A;  3U1O A;  1B5H A;  3RNN A;  4C1T A;  2ZNS A;  4N8Y A;  3RLF E;  4U21 A;  5A5L A;  3FGS A;  4KQP A;  1YCJ A;  4ISU A;  3OO9 A;  3O2A A;  3OMB A;  2V84 A;  4R6Y A;  1NUY A;  2H4I A;  1B32 A;  5IZ1 A;  4RY1 A;  2XXQ A;  1FQD A;  4TLM B;  4H67 A;  2O7I A;  2OJT A;  3QUF A;  4XKR A;  4G68 C;  2XXY A;  4O8M A;  1L5T A;  3HV1 A;  3TPA A;  1P1W A;  1DPE A;  3SEW A;  1NNF A;  3MC2 A;  4POX A;  4U1Z A;  2V4C A;  2FNC A;  3T66 A;  2H25 A;  1MPD A;  1P1Q A;  3U92 A;  4GBV A;  4PFU A;  5H8N A;  3HPI A;  2V3Q A;  2D21 A;  1URS A;  4NMY A;  2I6E A;  3MYU A;  1Q1K A;  2KR0 A;  1DTZ A;  1EYI A;  3HHF A;  2VD2 A;  2O69 A;  2I58 A;  1B3E A;  2ZNU A;  3UN6 A;  4PGP A;  2GHA A;  1B7U A;  4RXL A;  1B3H A;  4RNS A;  5CMM A;  4QFL A;  4NF8 A;  2ZZW A;  1M5B A;  3OEK A;  3VVD A;  2UYF A;  1MQG A;  4X9T A;  1IXG A;  2V3T A;  1QUJ A;  3E3K A;  3M3L A;  5EHS A;  1FTL A;  4GL0 A;  4YB6 A;  1MDQ A;  1FQE A;  1B7H A;  1JP4 A;  3C32 A;  4KFQ A;  4RA1 A;  2F35 A;  3IOV A;  4XTC Q;  1AMF A;  4MLV A;  1FBH A;  3TEP A;  2Z22 A;  4DXC A;  2DDK A;  2XWI A;  4I9D A;  3SEY A;  3IL1 B;  2H9B A;  2QPQ A;  2ZZV A;  4QSE A;  4OET A;  4I1D A;  1H45 A;  2HEU A;  5JTY A;  1BP5 A;  1D4N A;  2XX8 A;  1OQG A;  1IQ7 A;  1SD3 A;  1ZU0 A;  4IO7 A;  3B6T A;  3CI8 A;  4KCD A;  1EH3 A;  4E0X A;  2Z8D A;  3PD8 A;  4G61 A;  1MM7 A;  2RC9 A;  4YIC A;  4F2O A;  4E0W A;  1RYX A;  4RPN A;  1N84 A;  4KYE A;  3Q27 A;  4IB2 A;  4PFI A;  4ZDM A;  3RY3 A;  2DVC A;  2Q2A A;  5CBR A;  3QK6 A;  4OES A;  1VSO A;  3RPW A;  3IOW A;  3MP6 A;  3IOR A;  1FQB A;  3SEV A;  2XXP A;  3GZG A;  5TPA A;  4MCO A;  4Z0I A;  4H0W A;  4NF5 B;  5I3S A;  4R6H A;  3QSL A;  4OVR A;  3KJ7 A;  1SBP A;  2DQV A;  1MQI A;  2AYS A;  3EKI A;  3MAM A;  1N0T A;  4JDF A;  4IY5 A;  5AA3 A;  4HE0 A;  2CEY A;  3MVZ A;  1FPE A;  4LZ7 A;  3RQT A;  1B7Z A;  4KYD A;  3GBB A;  2Q9T A;  4GWS A;  4H1X A;  3IFC A;  4JXI A;  3K6U A;  3TTR A;  4YKK A;  2I3V A;  4MIJ A;  4R9F A;  4EF1 A;  1VR5 A;  1JVX A;  1NH8 A;  4N81 A;  4NF6 B;  2Z8F A;  3PTY A;  3MZ9 A;  3VLW A;  2A5T A;  4GL8 A;  4PET A;  3DM0 A;  1FQC A;  4FAT A;  1FCK A;  2ONR A;  4PFT A;  2F97 A;  2YJP A;  3O29 A;  3VE1 B;  5JK4 A;  2DWH A;  1D9Y A;  1SDX A;  4GXS B;  4LQ5 A;  1N04 A;  4OXV A;  4IO6 A;  2OZZ A;  1MPC A;  4GIZ A;  4GWZ A;  1R9L A;  3K6V A;  1Y3P A;  4P3L A;  1O63 A;  4PFB A;  4PTK A;  3HFU A;  2DP8 A;  5H8S A;  1IXH A;  1A40 A;  1YAE A;  4O3A A;  1JET A;  3USD A;  4ELP A;  4GFR A;  1B5I A;  4P1E A;  5EYH A;  2G29 A;  4R2B A;  1ZJL A;  4JSD A;  3GLB A;  5ESY A;  3H4Z A;  3CFZ A;  3PMV A;  3EPE A;  1MY0 A;  2O7U A;  4RPO A;  3IB2 A;  3T96 B;  1LGB C;  4UAC A;  1LBW A;  5I5P A;  3RPL A;  1MPB A;  5BWJ A;  1IMB A;  1PB7 A;  3PGF A;  4F1Y A;  1IMA A;  1O64 A;  2ABH A;  4H5G A;  3TCH A;  5FTH A;  4MNC A;  4GD5 A;  1S7Y A;  3LSF B;  4QFO A;  4YKP A;  5I2K B;  2QVU A;  4MAG A;  2Q8J A;  4PE3 A;  4PE5 B;  2HZL A;  4XKN A;  1LLS A;  3H6V A;  1JW1 A;  3PUV E;  2D5W A;  3KC0 A;  4OYV A;  1VDW A;  3IFA A;  3RT6 B;  3V8X B;  3OSQ A;  2ZMB A;  3IOU A;  3UGW A;  2G93 A;  4F19 A;  1MRP A;  4XXU A;  3TMG A;  2NXO A;  3GYY A;  3U94 A;  1QKA A;  3PV0 E;  3G3J A;  3KFM A;  1NV0 A;  4N13 A;  1GTK A;  3PUZ E;  4BLA A;  1Y3Q A;  1B05 A;  1B3G A;  4P56 A;  3HST A;  3G3F A;  4DIG A;  1MXY A;  3MPL A;  5ET8 A;  1FBF A;  5IKB A;  3VVF A;  1ZIU A;  3KSX A;  5DTB A;  1QUK A;  3IAZ A;  2OBG A;  5KDT B;  2ZYK A;  1WVJ A;  3QIM A;  1NNP A;  4POW A;  4ZEK A;  1A7L A;  3T9U A;  4ZZE A;  3T0J A;  4PFY A;  3S9N C;  1UIU A;  5FTI A;  4PF6 A;  1BTJ A;  2XXV A;  2XXW A;  5K2X A;  1US5 A;  3O66 A;  3VFJ A;  4PDD A;  1FPJ A;  2FA7 A;  3D1R A;  3FD3 A;  4GWW A;  3FAS A;  1FTA A;  5FHM A;  3V5A A;  1T0K A;  1NKX A;  4NN3 A;  1M5F A;  4G2Z A;  3SEX A;  5AA2 B;  4HS7 A;  2XA5 A;  3FAT A;  3LSX A;  3VLV A;  1FPI A;  3MP8 A;  1OLC A;  2Y5K A;  4UAB A;  4H65 A;  3RT8 A;  3ZS6 A;  4YMB A;  3IR1 A;  4QSD A;  3IX1 A;  4MNP A;  1DCU A;  3LSL A;  4G8N A;  1OVT A;  3KBR A;  3LUY A;  1I69 A;  4OFL A;  4H8I A;  1MDP 1;  3VVE A;  1PB9 A;  3CR9 A;  2M8C A;  4HXV A;  2DOJ A;  4DE8 A;  4FBP A;  5DW8 A;  5I57 B;  1LBZ A;  1ZLQ A;  3MUQ A;  3B6W A;  2LAO A;  3D4C A;  3KZG A;  1MQJ A;  4N6K A;  1URD A;  4DZ1 A;  2DXY A;  2FYI A;  1N7W A;  2PFZ A;  1UTH B;  4YKJ A;  4KI0 E;  3I6V A;  1JEV A;  4KPT A;  2ZYM A;  1QVS A;  5M2V A;  3JYR A;  4EF2 A;  3TKD A;  4L17 A;  2I49 A;  1IUD A;  2OWT A;  3KN7 A;  3LUZ A;  2VP1 A;  2Y7I A;  4QBA A;  2H5Y A;  2Y7W A;  1R6Z A;  5F24 A;  3PPP A;  1JW4 A;  2P2A A;  3MZB A;  3UK4 A;  2BJJ X;  4DCX A;  5K2Y A;  2R9J A;  1POT A;  5L9M A;  5EYG A;  1NV1 A;  4OAN A;  2P3V A;  5LOM A;  5CC2 A;  4ONY A;  2Y7P A;  4NF5 A;  5DEX B;  4LZ5 A;  5EYF A;  4KYS A;  1NNT A;  3TQW A;  4IO2 A;  1FRP A;  2HCA A;  3F11 A;  1FSA A;  1YPN A;  3O97 A;  3FJG A;  5DVI A;  4I3Y A;  1BKA A;  5LTC A;  2RCA A;  4OVJ A;  2PCR A;  2QS2 A;  4ZE8 A;  1XVY A;  3Q29 A;  1B40 A;  1H76 A;  5KCJ B;  2FIE A;  3VXC A;  1N7X A;  3MQ9 A;  5ET5 A;  2WEF A;  4BDO A;  4ELQ A;  2WBD A;  2O84 X;  4NF6 A;  1P1N A;  4KXP A;  3T9H B;  3CG3 A;  3A3U A;  4DDD A;  1A99 A;  5CBS A;  3OO7 A;  4BDL A;  1BIY A;  2OWZ A;  4YZZ A;  1PEB A;  1D3K A;  1PC3 A;  1N3W A;  1B1X A;  3E9X A;  2HAU A;  1LBC A;  1VFD A;  2WYK A;  3BBR A;  4ECF A;  4XKQ A;  2I0C A;  1NV3 A;  3PPN A;  1ZMG A;  2OWS A;  5A5X B;  3UOR A;  5DVF A;  2XWV A;  3IJX B;  4P0G A;  1XS5 A;  3EQ1 A;  3EHT A;  3K00 A;  1BK4 A;  1B0L A;  4AS5 A;  4OEU A;  3RGY A;  2Y84 A;  3PPQ A;  3U93 A;  1B4H A;  1US4 A;  2REJ A;  2QRY A;  3OEL A;  4OTE A;  1A8E A;  2ZYO A;  3C34 A;  1ZBM A;  1Y1M A;  3TOD A;  5AA2 D;  4QFP A;  4QHQ A;  3B50 A;  4O3C A;  1II5 A;  5ICQ A;  3V89 B;  2YLN A;  4UA8 A;  1SQY A;  1K9Z A;  4FED A;  3QYT A;  1KZ8 A;  4EXL A;  2OCU A;  3C4M A;  3MJN A;  1TFA A;  4NWC A;  3TCG A;  1OQH A;  4G68 B;  3K4U A;  4FAJ A;  2W7Y A;  5ICT A;  4DCY A;  4AQ4 A;  3W9W A;  1Y3N A;  3WAF A;  4GWY A;  1QUL A;  4N4U A;  5H8F B;  3ZKL A;  4Q0C A;  1ELJ A;  1FBC A;  1H43 A;  1EYJ A;  4MLQ A;  1G0H A;  4RYA A;  1NV6 A;  1LCF A;  1MXX A;  4F1U A;  2Q74 A;  2QMX A;  2PYY A;  5J1D A;  3G3K A;  1IIT A;  3O9P A;  4H6D A;  4P1L A;  5EQ9 A;  1XVX A;  3EF7 A;  4F39 A;  5CM6 A;  5KDT A;  2XD2 A;  2XXK A;  4JWY A;  1PDA A;  4GBW A;  2BJI A;  2CZH A;  4HW8 A;  1P1U A;  1IMC A;  4PGN A;  4OQO A;  2Y5L A;  4ND9 A;  4NF0 A;  4Q8R A;  1B51 A;  2REG A;  3KOS A;  1M5C A;  4OVS A;  1CE2 A;  2A5S A;  1MXW A;  1FBP A;  1JW5 A;  2CMO A;  4WKM A;  2WBB A;  3PD9 A;  3PU5 A;  3QXM A;  4HTG A;  5DYH A;  4DI4 B;  3OEN A;  2X7P A;  3C31 A;  3O6G A;  5AA2 A;  3MBP A;  2VHA A;  4HE2 A;  4LUB A;  2QFL A;  4MH5 A;  1EYK A;  4JVD A;  2Q8M A;  2UXA A;  2QS3 A;  4OFJ A;  3R7X A;  5HBC A;  4YU0 A;  2HHM A;  4N15 A;  4I62 A;  4PF8 A;  3Q28 A;  5I59 B;  1S9T A;  4EQB A;  1XHY A;  2AL5 A;  4K3F A;  2Y7K A;  4Q5T A;  1MQD A;  3SET A;  1VE4 A;  2Q89 A;  1B2H A;  4R2F A;  4OMB A;  2XXH A;  1FPD A;  5I57 A;  1FPK A;  3E13 X;  2QVV A;  4N6D A;  4F22 A;  2OX3 A;  4HE1 A;  2UVG A;  3GXA A;  4IY6 A;  1UTH A;  3IK6 B;  1RDY A;  1AIV A;  2F78 A;  1SPI A;  3TAJ A;  1NUZ A;  3O6H A;  4I40 A;  1EU8 A;  2V93 A;  5TU0 A;  3VV5 A;  5IAI A;  1FBG A;  1SW5 A;  4N6P A;  4NX1 A;  1IZ1 A;  1MS7 A;  1NH7 A;  1FBD A;  3TDJ A;  1FPL A;  5HPQ A;  4JWX A;  2ONK E;  2P0S A;  4GOT A;  2B65 A;  1IME A;  1XOC A;  3SER A;  4TLL B;  3MPK A;  3N6U A;  3U65 A;  3P7I A;  1VFE A;  2CZK A;  5I2N B;  4NWD A;  4GXA A;  3JV9 A;  4R75 A;  2F3D A;  3WAE A;  2GFE A;  2QJE A;  1LFI A;  2GQ1 A;  2P1S A;  4LQ2 A;  3C35 A;  3HHG A;  4NG7 A;  5B70 A;  3CFX A;  3LC8 A;  2GRV A;  1FQA A;  4TOZ A;  1H44 A;  4Z7E A;  5KCJ A;  2I4C A;  1GR2 A;  2GHB A;  4PAK A;  3TTL A;  2RC8 A;  3IO6 A;  2JJK A;  1RDX A;  4ZEB A;  4MEV A;  2O1M A;  2O68 A;  3QMF A;  1Y20 A;  2XXU A;  4X1D A;  2F6G A;  4H5F A;  2ONS A;  1B58 A;  1HSJ A;  4RK2 A;  1QW0 A;  2Z23 A;  3DEL B;  4F3S A;  1NL5 A;  4GQO A;  3FBP A;  4NF4 B;  3FUZ A;  4ELO A;  1SW1 A;  5H8H B;  1MH3 A;  4EQ9 A;  4LA9 A;  4GF8 A;  4U2R A;  4PAI A;  5I84 A;  3QAX A;  3UA8 A;  3HO7 A;  4WED A;  4BDM A;  2F3B A;  3S9M C;  1I6Q A;  2FVZ A;  4KR5 A;  4FE8 A;  2XXR A;  4DXB A;  4G8M A;  3JZJ A;  1JEU A;  1FQF A;  3MP1 A;  1SYH A;  5I56 B;  2XXT A;  2AIX A;  3FVO A;  3FXB A;  4F3B A;  4N91 A;  1UTB B;  2XD3 A;  1LAX A;  1R9Q A;  4XIG Q;  4ZEI A;  4PP0 A;  2B4M A;  1YXI A;  4F3G A;  4GX6 A;  4MBP A;  2DYX A;  2ESN A;  2OK2 A;  1PBP A;  2HAV A;  4FJP A;  2DXR A;  2NVU B;  4F31 B;  2VD3 A;  2UVI A;  1DPP A;  3B7D A;  4OA4 A;  1B1H A;  2RC7 A;  4O7M A;  4G68 A;  4X48 A;  2O6A A;  3FXU A;  1LFH A;  2H99 A;  1XT8 A;  3PPO A;  3CVG A;  2Z8E A;  5H8F A;  3ILU B;  3N26 A;  4AS4 A;  3H6U A;  1AL3 A;  1K9Y A;  4NQ8 A;  3KJT A;  2F7A A;  4R9G A;  2PBW A;  4OZ9 A;  1RKM A;  3Q26 A;  3LSW A;  5IGA A;  2WYP A;  1CB6 A;  3B8B A;  2R6G E;  5I58 B;  2VT5 A;  5JTY B;  3EHU A;  3D4G A;  3G3H A;  4PBQ A;  1B4Z A;  2GH9 A;  3TYH A;  4FIM A;  1M5E A;  1MXV A;  4AB5 A;  4QF9 A;  4WXJ A;  2QVR A;  3TZA A;  2R8T A;  4IGR A;  1P99 A;  5ISU A;  4RK9 A;  1OLA A;  2H98 A;  2V25 A;  3CHG A;  5CRY A;  3OOA A;  4H8J A;  2PVU A;  4ZE9 A;  4IGT A;  1A8F A;  4DI3 D;  1FTO A;  2HFB A;  3L6G A;  3I3V A;  1AH5 A;  4QXD A;  1B3F A;  2PMS A;  1MY4 A;  5ITO A;  3CIJ A;  4IR8 A;  3FIR A;  3N5L A;  5AA4 B;  5ET6 A;  4JBZ A;  1FPF A;  2PT1 A;  3MZ1 A;  3C33 A;  4LZ8 A;  4GWO A;  1J1N A;  4N8G A;  4GX4 A;  3ILT B;  2NWJ A;  5I59 A;  1CNQ A;  4MJO A;  2F34 A;  1IXI A;  1LAH E;  1AOV A;  1LBX A;  5JEI A;  1UQW A;  4F18 A;  3K01 A;  2HXW A;  2IA4 A;  1NNK A;  4X1B A;  4THI A;  3TTN A;  4H45 A;  3KGC A;  3FVN A;  1MY2 A;  3MVX A;  3TCF A;  4TQU Q;  5AE4 A;  3THI A;  2CEX A;  2CZL A;  1B46 A;  3H3G A;  3PMW A;  1IIW A;  4NHB A;  2RCB A;  3VXB A;  3K6X A;  3FV2 A;  2PFY A;  5TP9 B;  2ZXT A;  1QJM A;  4I8C A;  1N76 A;  1FPG A;  1INP A;  4ESW A;  4GWU A;  3SKP A;  1IMD A;  2MKZ A;  2NUV A;  2O1L A;  5FBP A;  1S50 A;  2DE3 A;  3MWB A;  3O28 A;  4NE4 A;  1MXU A;  3DP8 A;  5I2N A;  4G4P A;  3FV1 A;  3KOT A;  4NAP A;  4ELR A;  3KEI A;  3B6Q A;  1OVB A;  3H6W A;  5J16 A;  2VGQ A;  1SW2 A;  1HSE A;  1GGG A;  2V3U A;  3IO4 A;  1TT1 A;  3TQL A;  2YPN A;  1LAF E;  3O6I A;  2B4L A;  1DK4 A;  1LEV A;  4NED A;  4F3P A;  2Y7R A;  3HCQ A;  3NOH A;  4O94 A;  4R6K A;  1IEJ A;  1MM6 A;  5DT6 A;  4MHF A;  4ZEF A;  5FHO A;  4EUO A;  1HSL A;  3SDF A;  2XHD A;  3KC1 A;  1O7T A;  3SES A;  4GRK A;  4BDR A;  1JVY A;  1NV4 A;  1EZO A;  1Y4T A;  5CI5 A;  1NFT A;  3L6H A;  1LB8 A;  3CRB A;  1KWH A;  2FIX A;  2ZZX A;  1EZP A;  3ODB A;  3SZP A;  1MY3 A;  5I2K A;  4OEN A;  4NGU A;  1FJ6 A;  4NF4 A;  2E0S A;  2R71 A;  1D9Q A;  4O3B A;  5H8H A;  1R1N A;  3ZSF A;  1QUI A;  1Q9D A;  1FTJ A;  2XWK A;  3IOT A;  4GLI A;  5EQA A;  4P47 A;  3H03 A;  2PX1 A;  2KQZ A;  2IEE A;  5I7I A;  4OVP A;  1NV5 A;  4OER A;  5I56 A;  1QGX A;  3K0V A;  3K1P A;  4KD5 A;  1N3X A;  4MNI A;  3T1B A;  3KN8 A;  1UTB A;  2L5V A;  2HPG A;  1I6B A;  3C36 A;  4PDH A;  2QS4 A;  4MF3 A;  1Y9U A;  4ESX A;  2WX9 A;  2D3I A;  4AB6 A;  3IB1 A;  3FVG A;  1TXF A;  4FEC A;  2ALU A;  1ANF A;  4GWX A;  5L9S A;  3TUS A;  1NV7 A;  4G8H A;  5KZT A;  3FXQ A;  2UVH A;  5CMC A;  4F29 A;  3H06 B;  4LON B;  4OEV A;  4XFE A;  2DE4 A;  2DWI A;  1DTG A;  2AL4 A;  5CMB A;  1SW4 A;  4PQJ A;  3G3G A;  4OVQ A;  4PCD A;  4F1V A;  4KCC A;  1SVX B;  1DSN A;  5IZ3 B;  4HCW A;  4C0R A;  3UP9 A;  1I6A A;  5IM2 A;  1YZ0 A;  3W15 C;  2RKM A;  4MX6 A;  5I58 A;  1UIV A;  3T93 B;  1B3L A;  3UIF A;  2HQ0 A;  3VLU A;  4NTL A;  2Q2C A;  1Q35 A;  4FEB A;  3KSJ A;  4R73 A;  3MST A;  1MXZ A;  5LDZ A;  1NI9 A;  3VDF A;  4F2Q A;  4YB7 A;  3RUM A;  5H8Q B;  4BDQ A;  1ZKB A;  1KA1 A;  3OD7 A;  2QMW A;  4P9K A;  1DOT A;  2HXR A;  1Z7M E;  4PFW A;  1M5D A;  4XEQ A;  2DWA A;  3EHS A;  1FJ9 A;  3ONM A;  3ROJ A;  1F9B A;  4PC9 A;  4YKI A;  1OMP A;  4WEP A;  3T9X B;  1FPB A;  4P11 A;  5ET7 A;  3PUY E;  4U4S A;  2F7C A;  3M3K A;  5AA4 A;  3V83 A;  1GV8 A;  3A3C A;  4PBH A;  1LAG E;  3CSB A;  3K2D A;  1XC1 A;  3RTW B;  4OVT A;  1NMU A;  4EQ7 A;  1MG1 A;  2XXI A;  1P1O A;  3S2V A;  1FTM A;  4N07 A;  3S9L C;  3GBA A;  5DEX A;  1RYO A;  4H46 A;  1PBQ A;  1D9V A;  5ITP A;  1SI0 A;  2KLF A;  1B6H A;  3CSG A;  3N94 A;  3RTF B;  4OWD A;  4QSC A;  3DLN A;  1G0I A;  4LP2 B;  4XF5 A;  3DP4 A;  4OHN A;  3S9E A;  3R6U A;  3T9V A;  1B0H A;  1JQF A;  4YB5 A;  2QL3 A;  2OLB A;  3T22 A;  4LVQ A;  1B5J A;  1IMF A;  2NOO A;  3LV0 A;  5TP9 A;  1JNF A;  2DS9 A;  2VPN A;  1IXC A;  4GX3 A;  3OSR A;  3I5O A;  4Q30 B;  1ATG A;  3OEM A;  5T3J A;  2DWJ A;  1A55 A;  3BFT A;  1DMB A;  4XKP A;  1LBY A;  2VOZ A;  3K1M A;  1LFG A;  1EZ9 A;  5ELV A;  3QUJ A;  4ZED A;  5BUU A;  4DXU A;  2DE2 A;  1SYI A;  2XX9 A;  2DVZ A;  4X04 A;  4ZEC A;  5A5X A;  4I3E A;  1DBZ A;  1NUX A;  5H8N B;  2VPO A;  2THI A;  1ZTY A;  4HCY A;  2B3B A;  1H3D A;  4P0I A;  3TTK A;  2UVJ A;  1Z7N E;  3K02 A;  1LBV A;  3AXF A;  3BFU A;  3PPR A;  3RN8 A;  3PMX A;  3N6T A;  2F36 A;  1LCT A;  5EQ7 A;  3FZV A;  3FXR A;  1NUW A;  1MH4 A;  2B3F A;  1URG A;  3EN3 A;  3M8U A;  2UYE A;  1Y1Z A;  4NF8 B;  4U1O A;  3H7M A;  1FTK A;  3MW0 A;  2ZNT A;  4R72 A;  2Q88 A;  2WKY A;  2I0B A;  2P3N A;  3A09 A;  1RDZ A;  3FJ7 A;  4BDN A;  3PUX E;  4U4X A;  2X7Q A;  5AA1 A;  3K1N A;  1WOD A;  5F7V A;  2ANJ A;  1XI6 A;  4MMP A;  1AWB A;  4IO5 A;  4JWO A;  1USY H;  3KG2 A;  5EQ8 A;  2ZYN A;  3IJO B;  4C1U A;  4U22 A;  1FBE A;  5FHN A;  2F5X A;  1TWY A;  4U23 A;  3K6W A;  3KN3 A;  2O51 A;  3SEU A;  3CFL A;  2PT2 A; 
#chains in the Genus database with same CATH homology
 1PB8 A;  1B9J A;  4ZS9 A;  4YMA A;  3ZKK A;  2F8D A;  4G77 A;  3IB0 A;  3OXN A;  3TTM A;  3W9V A;  2HZK A;  4JB7 A;  5TPA B;  3G7W A;  1FW0 A;  1LBB A;  4FOR A;  4QRZ A;  3H6T A;  3TEL A;  4M4G A;  1MQH A;  3OO8 A;  3BKI B;  4KHZ E;  3Q25 A;  3U72 A;  4GVO A;  4IO3 A;  2F6P A;  1LST A;  1SI1 A;  5EHM A;  1MY1 A;  4QFN A;  5B7D A;  4RJZ A;  5DVJ A;  2A5T B;  3HN0 A;  3C9H A;  1BLF A;  2RIN A;  5H8Q A;  4MFI A;  2QS1 A;  3MVY A;  3S4U A;  3M3F A;  3LBS A;  4ZZA A;  2RF1 A;  3FVK A;  4LAT A;  4R74 A;  1WDN A;  5CMK A;  1YTV A;  2XX7 A;  1GVC A;  3G3I A;  2E1S A;  4JSO A;  3ECR A;  4EDP A;  4DLD A;  5F1Q A;  3PUW E;  2X26 A;  4YAH X;  2XXX A;  2F7B A;  3TFL A;  3FJM A;  3OO6 A;  2I48 A;  3MVW A;  1TFD A;  4M1V A;  3U8Q A;  4IO4 A;  1POY 1;  3DP6 A;  4EXK A;  1USY E;  4QFK A;  5HM4 B;  1OIB A;  1QKB A;  3LR1 A;  3CG1 A;  2DSF A;  5L8D A;  1LB9 A;  4OFO A;  2I4B A;  1A54 A;  1Y4C A;  1B52 A;  2I3W A;  5L9O A;  3E4R A;  3R26 A;  2QSX A;  3U1O A;  1B5H A;  3RNN A;  4C1T A;  2ZNS A;  3RLF E;  4U21 A;  3FGS A;  4KQP A;  1YCJ A;  4ISU A;  3OO9 A;  3O2A A;  3OMB A;  2V84 A;  4R6Y A;  2H4I A;  1B32 A;  4RY1 A;  2XXQ A;  1FQD A;  4TLM B;  4H67 A;  2O7I A;  2OJT A;  3QUF A;  4XKR A;  4G68 C;  2XXY A;  1L5T A;  3HV1 A;  3TPA A;  1P1W A;  1DPE A;  3SEW A;  1NNF A;  3MC2 A;  4POX A;  4U1Z A;  2FNC A;  3T66 A;  2H25 A;  1MPD A;  1P1Q A;  3U92 A;  4PFU A;  5H8N A;  3HPI A;  2V3Q A;  2D21 A;  1URS A;  4NMY A;  2I6E A;  1Q1K A;  1DTZ A;  3HHF A;  2VD2 A;  2O69 A;  2I58 A;  1B3E A;  2ZNU A;  3UN6 A;  2GHA A;  1B7U A;  4RXL A;  1B3H A;  4RNS A;  5CMM A;  4QFL A;  4NF8 A;  1M5B A;  3OEK A;  3VVD A;  2UYF A;  1MQG A;  4X9T A;  1IXG A;  2V3T A;  1QUJ A;  3E3K A;  3M3L A;  5EHS A;  1FTL A;  4GL0 A;  4YB6 A;  1MDQ A;  1FQE A;  1B7H A;  3C32 A;  4KFQ A;  4RA1 A;  2F35 A;  3IOV A;  4XTC Q;  1AMF A;  4MLV A;  3TEP A;  2Z22 A;  4DXC A;  4I9D A;  3SEY A;  3IL1 B;  2H9B A;  2QPQ A;  4QSE A;  4OET A;  4I1D A;  1H45 A;  2HEU A;  5JTY A;  1BP5 A;  1D4N A;  2XX8 A;  1OQG A;  1IQ7 A;  1SD3 A;  1ZU0 A;  4IO7 A;  3B6T A;  3CI8 A;  4KCD A;  1EH3 A;  4E0X A;  2Z8D A;  3PD8 A;  1MM7 A;  2RC9 A;  4YIC A;  4F2O A;  4E0W A;  1RYX A;  4RPN A;  1N84 A;  4KYE A;  3Q27 A;  4IB2 A;  4ZDM A;  3RY3 A;  2DVC A;  2Q2A A;  5CBR A;  3QK6 A;  1VSO A;  4OES A;  3RPW A;  3IOW A;  3MP6 A;  3IOR A;  1FQB A;  3SEV A;  2XXP A;  3GZG A;  5TPA A;  4Z0I A;  4H0W A;  4NF5 B;  4R6H A;  3QSL A;  3KJ7 A;  1SBP A;  2DQV A;  1MQI A;  2AYS A;  3MAM A;  1N0T A;  4JDF A;  4IY5 A;  5AA3 A;  3MVZ A;  4LZ7 A;  3RQT A;  1B7Z A;  4KYD A;  3GBB A;  2Q9T A;  4H1X A;  4JXI A;  3K6U A;  3TTR A;  4YKK A;  2I3V A;  4EF1 A;  4R9F A;  1VR5 A;  1JVX A;  1NH8 A;  4NF6 B;  2Z8F A;  3MZ9 A;  3VLW A;  2A5T A;  4GL8 A;  4PET A;  3DM0 A;  1FQC A;  4FAT A;  1FCK A;  2ONR A;  4PFT A;  2F97 A;  2YJP A;  3O29 A;  3VE1 B;  5JK4 A;  2DWH A;  1D9Y A;  1SDX A;  4GXS B;  4LQ5 A;  1N04 A;  4OXV A;  4IO6 A;  2OZZ A;  1MPC A;  4GIZ A;  1R9L A;  3K6V A;  1Y3P A;  1O63 A;  2DP8 A;  5H8S A;  1IXH A;  1A40 A;  1YAE A;  4O3A A;  1JET A;  3USD A;  4ELP A;  4GFR A;  1B5I A;  2G29 A;  4R2B A;  1ZJL A;  4JSD A;  3GLB A;  3H4Z A;  3CFZ A;  3PMV A;  3EPE A;  1MY0 A;  2O7U A;  4RPO A;  3IB2 A;  3T96 B;  1LGB C;  4UAC A;  5BWJ A;  1MPB A;  3PGF A;  1PB7 A;  4F1Y A;  1O64 A;  2ABH A;  4H5G A;  3TCH A;  5FTH A;  4GD5 A;  1S7Y A;  3LSF B;  4QFO A;  4YKP A;  5I2K B;  2Q8J A;  4PE5 B;  2HZL A;  4XKN A;  1LLS A;  3H6V A;  1JW1 A;  3PUV E;  2D5W A;  4OYV A;  3RT6 B;  3V8X B;  3OSQ A;  2ZMB A;  3IOU A;  3UGW A;  2G93 A;  4F19 A;  1MRP A;  4XXU A;  3TMG A;  2NXO A;  3U94 A;  1QKA A;  3PV0 E;  3G3J A;  3KFM A;  4N13 A;  1GTK A;  3PUZ E;  4BLA A;  1Y3Q A;  1B05 A;  1B3G A;  3HST A;  3G3F A;  4DIG A;  1MXY A;  3MPL A;  5IKB A;  3VVF A;  1ZIU A;  3KSX A;  5DTB A;  1QUK A;  3IAZ A;  2OBG A;  5KDT B;  2ZYK A;  1WVJ A;  3QIM A;  1NNP A;  4POW A;  4ZEK A;  1A7L A;  3T9U A;  4ZZE A;  4PFY A;  3S9N C;  1UIU A;  5FTI A;  1BTJ A;  2XXV A;  2XXW A;  5K2X A;  1US5 A;  3O66 A;  3VFJ A;  3FD3 A;  2FA7 A;  3FAS A;  5FHM A;  3V5A A;  1T0K A;  1NKX A;  1M5F A;  4G2Z A;  3SEX A;  5AA2 B;  4HS7 A;  3FAT A;  3LSX A;  3VLV A;  3MP8 A;  1OLC A;  3RT8 A;  4H65 A;  3ZS6 A;  4YMB A;  3IR1 A;  4QSD A;  3IX1 A;  3LSL A;  4G8N A;  1OVT A;  3KBR A;  3LUY A;  1I69 A;  4OFL A;  4H8I A;  1MDP 1;  3VVE A;  1PB9 A;  3CR9 A;  2M8C A;  2DOJ A;  4DE8 A;  5I57 B;  1ZLQ A;  3MUQ A;  3B6W A;  2LAO A;  3D4C A;  3KZG A;  1MQJ A;  1URD A;  4DZ1 A;  2DXY A;  2FYI A;  1N7W A;  1UTH B;  4YKJ A;  4KI0 E;  3I6V A;  1JEV A;  4KPT A;  4EF2 A;  1QVS A;  2ZYM A;  3JYR A;  5M2V A;  3TKD A;  4L17 A;  2I49 A;  1IUD A;  2OWT A;  3KN7 A;  2VP1 A;  2Y7I A;  2H5Y A;  2Y7W A;  1R6Z A;  3PPP A;  1JW4 A;  2P2A A;  3MZB A;  3UK4 A;  2BJJ X;  4DCX A;  5K2Y A;  2R9J A;  1POT A;  5L9M A;  5LOM A;  5CC2 A;  4ONY A;  2Y7P A;  4NF5 A;  5DEX B;  4LZ5 A;  5EYF A;  4KYS A;  1NNT A;  3TQW A;  4IO2 A;  2HCA A;  3F11 A;  1YPN A;  3O97 A;  3FJG A;  5DVI A;  1BKA A;  2RCA A;  4OVJ A;  2QS2 A;  4ZE8 A;  1XVY A;  3Q29 A;  1B40 A;  1H76 A;  5KCJ B;  3VXC A;  1N7X A;  3MQ9 A;  4BDO A;  4ELQ A;  2O84 X;  4NF6 A;  1P1N A;  3T9H B;  3CG3 A;  3A3U A;  4DDD A;  1A99 A;  5CBS A;  3OO7 A;  4BDL A;  1BIY A;  4YZZ A;  1PEB A;  1D3K A;  1PC3 A;  1N3W A;  1B1X A;  3E9X A;  2HAU A;  1LBC A;  1VFD A;  3BBR A;  4ECF A;  4XKQ A;  2I0C A;  3PPN A;  1ZMG A;  2OWS A;  5A5X B;  3UOR A;  5DVF A;  3IJX B;  4P0G A;  1XS5 A;  3EQ1 A;  3EHT A;  3K00 A;  1B0L A;  4OEU A;  3RGY A;  2Y84 A;  3PPQ A;  3U93 A;  1B4H A;  1US4 A;  2REJ A;  2QRY A;  3OEL A;  4OTE A;  1A8E A;  2ZYO A;  3C34 A;  1ZBM A;  1Y1M A;  3TOD A;  5AA2 D;  4QFP A;  4QHQ A;  4O3C A;  1II5 A;  5ICQ A;  3V89 B;  2YLN A;  4UA8 A;  1SQY A;  4FED A;  3QYT A;  4EXL A;  2OCU A;  3C4M A;  3MJN A;  1TFA A;  4NWC A;  3TCG A;  1OQH A;  4G68 B;  3K4U A;  4FAJ A;  2W7Y A;  5ICT A;  4DCY A;  4AQ4 A;  3W9W A;  1Y3N A;  3WAF A;  1QUL A;  5H8F B;  3ZKL A;  4Q0C A;  1ELJ A;  1H43 A;  4MLQ A;  4RYA A;  1LCF A;  1MXX A;  4F1U A;  2QMX A;  2PYY A;  5J1D A;  3G3K A;  1IIT A;  3O9P A;  4H6D A;  1XVX A;  3EF7 A;  4F39 A;  5CM6 A;  5KDT A;  2XD2 A;  4JWY A;  1PDA A;  4HW8 A;  1P1U A;  4OQO A;  4ND9 A;  4Q8R A;  1B51 A;  2REG A;  3KOS A;  1M5C A;  1CE2 A;  2A5S A;  1MXW A;  1JW5 A;  2CMO A;  4WKM A;  3PD9 A;  3PU5 A;  3QXM A;  4HTG A;  5DYH A;  3OEN A;  2X7P A;  3C31 A;  3O6G A;  5AA2 A;  3MBP A;  2VHA A;  4LUB A;  4MH5 A;  2UXA A;  2QS3 A;  4OFJ A;  3R7X A;  5HBC A;  4YU0 A;  4I62 A;  3Q28 A;  5I59 B;  1S9T A;  4EQB A;  1XHY A;  2AL5 A;  4K3F A;  2Y7K A;  4Q5T A;  1MQD A;  3SET A;  1VE4 A;  2Q89 A;  1B2H A;  4R2F A;  4OMB A;  2XXH A;  5I57 A;  3E13 X;  4F22 A;  2UVG A;  3GXA A;  4IY6 A;  1UTH A;  3IK6 B;  1AIV A;  2F78 A;  3TAJ A;  3O6H A;  1EU8 A;  2V93 A;  5TU0 A;  3VV5 A;  5IAI A;  1SW5 A;  4N6P A;  1IZ1 A;  1MS7 A;  1NH7 A;  3TDJ A;  5HPQ A;  4JWX A;  2ONK E;  2P0S A;  4GOT A;  2B65 A;  1XOC A;  3SER A;  4TLL B;  3MPK A;  3N6U A;  3P7I A;  1VFE A;  5I2N B;  4NWD A;  4GXA A;  3JV9 A;  4R75 A;  3WAE A;  2GFE A;  2QJE A;  1LFI A;  2P1S A;  4LQ2 A;  3C35 A;  3HHG A;  5B70 A;  3CFX A;  3LC8 A;  2GRV A;  1FQA A;  4TOZ A;  1H44 A;  4Z7E A;  5KCJ A;  2I4C A;  1GR2 A;  2GHB A;  3TTL A;  2RC8 A;  3IO6 A;  4ZEB A;  2O1M A;  2O68 A;  1Y20 A;  2XXU A;  4X1D A;  2F6G A;  4H5F A;  2ONS A;  1B58 A;  1HSJ A;  4RK2 A;  1QW0 A;  2Z23 A;  3DEL B;  4F3S A;  1NL5 A;  4GQO A;  4NF4 B;  3FUZ A;  4ELO A;  1SW1 A;  5H8H B;  1MH3 A;  4EQ9 A;  4LA9 A;  4GF8 A;  4U2R A;  5I84 A;  3QAX A;  3UA8 A;  3HO7 A;  4WED A;  4BDM A;  3S9M C;  1I6Q A;  4KR5 A;  4FE8 A;  4DXB A;  2XXR A;  4G8M A;  3JZJ A;  1JEU A;  1FQF A;  3MP1 A;  1SYH A;  5I56 B;  2XXT A;  2AIX A;  3FVO A;  4F3B A;  1UTB B;  2XD3 A;  1LAX A;  1R9Q A;  4XIG Q;  4ZEI A;  4PP0 A;  4F3G A;  4MBP A;  2DYX A;  2ESN A;  2OK2 A;  1PBP A;  2HAV A;  4FJP A;  2DXR A;  2NVU B;  4F31 B;  2VD3 A;  2UVI A;  1DPP A;  3B7D A;  1B1H A;  2RC7 A;  4G68 A;  4X48 A;  2O6A A;  3FXU A;  1LFH A;  2H99 A;  1XT8 A;  3PPO A;  3CVG A;  2Z8E A;  5H8F A;  3ILU B;  3N26 A;  3H6U A;  1AL3 A;  3KJT A;  2F7A A;  4R9G A;  2PBW A;  4OZ9 A;  1RKM A;  3Q26 A;  3LSW A;  1CB6 A;  2R6G E;  5I58 B;  5JTY B;  3EHU A;  3D4G A;  3G3H A;  1B4Z A;  2GH9 A;  3TYH A;  4FIM A;  1M5E A;  1MXV A;  4AB5 A;  4QF9 A;  4WXJ A;  3TZA A;  4IGR A;  1P99 A;  5ISU A;  4RK9 A;  1OLA A;  2H98 A;  2V25 A;  5CRY A;  3OOA A;  4H8J A;  2PVU A;  4ZE9 A;  4IGT A;  1A8F A;  1FTO A;  2HFB A;  3L6G A;  3I3V A;  1AH5 A;  1B3F A;  2PMS A;  1MY4 A;  5ITO A;  3CIJ A;  3FIR A;  3N5L A;  5AA4 B;  4JBZ A;  2PT1 A;  3MZ1 A;  3C33 A;  4LZ8 A;  4GWO A;  1J1N A;  3ILT B;  2NWJ A;  5I59 A;  2F34 A;  1IXI A;  1LAH E;  1AOV A;  5JEI A;  1UQW A;  4F18 A;  3K01 A;  2HXW A;  2IA4 A;  1NNK A;  4X1B A;  4THI A;  3TTN A;  3KGC A;  3FVN A;  1MY2 A;  3MVX A;  3TCF A;  4TQU Q;  5AE4 A;  3THI A;  2CZL A;  1B46 A;  3H3G A;  3PMW A;  1IIW A;  2RCB A;  3VXB A;  3K6X A;  3FV2 A;  5TP9 B;  2ZXT A;  1QJM A;  4I8C A;  1N76 A;  4ESW A;  3SKP A;  2NUV A;  2O1L A;  1S50 A;  2DE3 A;  3MWB A;  3O28 A;  4NE4 A;  1MXU A;  3DP8 A;  5I2N A;  4G4P A;  3FV1 A;  3KOT A;  4ELR A;  3KEI A;  3B6Q A;  1OVB A;  3H6W A;  2VGQ A;  1SW2 A;  1HSE A;  1GGG A;  2V3U A;  3IO4 A;  1TT1 A;  3TQL A;  2YPN A;  1LAF E;  3O6I A;  4NED A;  4F3P A;  2Y7R A;  3HCQ A;  4R6K A;  1IEJ A;  1MM6 A;  5DT6 A;  4ZEF A;  5FHO A;  4EUO A;  1HSL A;  3SDF A;  2XHD A;  1O7T A;  3SES A;  4GRK A;  4BDR A;  1JVY A;  1EZO A;  1Y4T A;  5CI5 A;  1NFT A;  3L6H A;  1LB8 A;  3CRB A;  1KWH A;  1EZP A;  3ODB A;  5I2K A;  1MY3 A;  4OEN A;  4NF4 A;  2E0S A;  2R71 A;  4O3B A;  5H8H A;  1R1N A;  3ZSF A;  1QUI A;  1FTJ A;  3IOT A;  4GLI A;  3H03 A;  2PX1 A;  2IEE A;  4OER A;  5I56 A;  3K0V A;  3K1P A;  4KD5 A;  1N3X A;  3KN8 A;  1UTB A;  1I6B A;  3C36 A;  2QS4 A;  4MF3 A;  1Y9U A;  4ESX A;  2D3I A;  4AB6 A;  3IB1 A;  3FVG A;  1TXF A;  4FEC A;  2ALU A;  1ANF A;  5L9S A;  3TUS A;  4G8H A;  5KZT A;  3FXQ A;  2UVH A;  5CMC A;  4F29 A;  3H06 B;  4LON B;  4OEV A;  2DE4 A;  2DWI A;  1DTG A;  2AL4 A;  5CMB A;  1SW4 A;  4PQJ A;  3G3G A;  4F1V A;  4KCC A;  1SVX B;  1DSN A;  4HCW A;  4C0R A;  3UP9 A;  1I6A A;  3W15 C;  2RKM A;  5I58 A;  1UIV A;  3T93 B;  1B3L A;  3UIF A;  2HQ0 A;  3VLU A;  4NTL A;  2Q2C A;  1Q35 A;  4FEB A;  3KSJ A;  4R73 A;  1MXZ A;  3VDF A;  4F2Q A;  4YB7 A;  3RUM A;  5H8Q B;  4BDQ A;  1ZKB A;  3OD7 A;  2QMW A;  1DOT A;  1Z7M E;  4PFW A;  1M5D A;  2DWA A;  3EHS A;  3ONM A;  1F9B A;  4YKI A;  1OMP A;  4WEP A;  3T9X B;  4P11 A;  3PUY E;  4U4S A;  2F7C A;  3M3K A;  5AA4 A;  3V83 A;  1GV8 A;  3A3C A;  1LAG E;  3CSB A;  3K2D A;  1XC1 A;  3RTW B;  1NMU A;  4EQ7 A;  1MG1 A;  2XXI A;  1P1O A;  3S2V A;  1FTM A;  4N07 A;  3S9L C;  3GBA A;  5DEX A;  1RYO A;  1PBQ A;  1D9V A;  5ITP A;  1SI0 A;  2KLF A;  1B6H A;  3CSG A;  3N94 A;  3RTF B;  4OWD A;  4QSC A;  3DLN A;  4LP2 B;  3DP4 A;  4OHN A;  3S9E A;  3R6U A;  3T9V A;  1B0H A;  1JQF A;  4YB5 A;  2QL3 A;  2OLB A;  3T22 A;  4LVQ A;  1B5J A;  2NOO A;  5TP9 A;  1JNF A;  2DS9 A;  1IXC A;  3OSR A;  3I5O A;  4Q30 B;  1ATG A;  3OEM A;  2DWJ A;  1A55 A;  3BFT A;  1DMB A;  4XKP A;  2VOZ A;  3K1M A;  1LFG A;  1EZ9 A;  5ELV A;  3QUJ A;  4ZED A;  5BUU A;  4DXU A;  2DE2 A;  1SYI A;  2XX9 A;  2DVZ A;  4ZEC A;  5A5X A;  5H8N B;  2THI A;  1ZTY A;  4HCY A;  2B3B A;  1H3D A;  4P0I A;  3TTK A;  2UVJ A;  1Z7N E;  3K02 A;  3AXF A;  3BFU A;  3PPR A;  3RN8 A;  3PMX A;  3N6T A;  2F36 A;  1LCT A;  3FZV A;  3FXR A;  1MH4 A;  2B3F A;  1URG A;  3EN3 A;  3M8U A;  2UYE A;  1Y1Z A;  4NF8 B;  4U1O A;  3H7M A;  1FTK A;  3MW0 A;  2ZNT A;  4R72 A;  2Q88 A;  2WKY A;  2I0B A;  3A09 A;  3FJ7 A;  4BDN A;  3PUX E;  4U4X A;  2X7Q A;  5AA1 A;  3K1N A;  1WOD A;  5F7V A;  2ANJ A;  4IO5 A;  4JWO A;  1USY H;  3KG2 A;  2ZYN A;  3IJO B;  4C1U A;  4U22 A;  5FHN A;  2F5X A;  1TWY A;  4U23 A;  3K6W A;  3KN3 A;  2O51 A;  3SEU A;  3CFL A;  2PT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...