1FQVA

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SKP2
publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 119
structure length 325
sequence length 325
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fqvA00
4Y61B 2V9TB 2XOTA 4XGOA 5A5CA 4CNMA 5GMFA 3W3LA 5B0TA 3C6OB 3RW7A 2CA6A 4L3FA 4CNCA 4ECNA 4R07A 5B4PA 4FMZA 4U06A 4V2CA 1PGVA 1XKUA 4R6GA 4CC4C 3RFSA 5D3IA 2WQUA 4P8SA 5B0NA 4LXRA 3E4GA 3WPEA 5GQRK 3W3GA 3W3MA 2ID5A 3RW6A 1M9SA 2Z7XB 4AW4A 4BSUA 2ASSB 2V9SA 4LSXA 4K17A 2A0ZA 5AWDA 4P91A 2Y5QA 5IJBA 3OGMB 4M7EA 4R6FA 4RWTC 1JL5A 5AZ5A 2BNHA 4I6JB 3RIZA 2WFHA 2R9UA 4TZHA 4XSQA 5CMNA 1H6UA 4OQTA 2RR6A 2V70A 1KOOA 4J0MA 1U0ND 3SB4A 4PEQB 3E6JA 2P1PB 1P8TA 4MN8B 3W3KA 1K5DC 4KT1A 3FXIA 2Z63A 5HZLB 3CIYA 2Z62A 4R09A 1OGQA 3UL7A 3WPDA 3M19A 3ZYJA 3UN9A 4PERA 4Z8GA 2RA8A 1W8AA 4FS7A 2WQVA 3RFJA 3GOZA 4LSXC 2P1QB 3TSRE 3C6NB 2UZXA 4FHOA 4M7EC 3W3JA 4H09A 2O6RA 1A4YA 4R08A 1ZIWA 4EZGA 3O53A 4RCAB 4YEBB 2ELLA 1DS9A 2WQWA 2P1MB 4PKIG 3RGXA 1QYYA 4UFRA 2FT3A 2O6SA 3BZ5A 2Z66A 5HDHA 5IJDA 5GS2B 4LSAA 3G3AA 5CMPA 1XECA 1SQ0B 3C6PB 4FD0A 4U7LA 3G06A 1H6TA 1GWBA 1FS2A 1KOHA 2O6QA 3ZYOA 2P1OB 4Z94G 2JE1A 3WPBA 2OMZA 1IO0A 2XWTC 4FCGA 1M10B 3VQ2A 3G39A 3WPIA 4XOSA 2ASTB 1M9LA 1G9UA 4GT6A 1FO1A 4WP6A 4R5CA 3OGLB 3RFEA 4ECOA 3E2JA 2Z65A 4QXEA 3ULAA 3ZYIA 2Z81A 4BSSA 2WQXA 3M18A 4QBZA 2Z82A 4BSRA 3W3NA 4Q3GA 3CIGA 4V2EA 2OMXA 1XWDC 3OJAA 4WYKA 4U08A 2BEXA 1A9NA 4LI2A 4KNGA 3O6NA 4R6JA 5IYXC 2Q4GW 2OMUA 4R58A 5GMGA 3WPGA 1YRGA 4KXFB 4PQ8A 1OTOA 5FTTB 4C2BB 4AY9X 4Z61C 4QC0A 3JB9j 5GS0A 1O6SA 3PMHG 3OJAB 4Z79A 3ULVA 1Z7XW 4IM6A 4R6AA 3WPHA 3WN4A 4B8CD 1DCEA 1O6VA 5AWAA 2Z64A 2IFGA 4BV4R 4NKHA 2Z7XA 2OMWA 3G3BA 1OTMA 3CVRA 1XCDA 3OGKB 4R0AA 4Q62A 4CILA 1LTXA 5AWBA 5AWCA 3E3ZA 4L3AA 5LFNA 1P9AG 3ZYNA 1XEUA 2OMVA 4Q3IA 2OMYA 3UL9A 3ULUA 1OTNA 2JQDA 1M0ZA 3RGZA 3A79B 1DFJI 1OOKG 4NKGA 4RCWA 4U09A 5GMHA 1OZNA 3WPCA 4CP6A 3WPFA 3RJ0A 4FDWA 4R5DA 4ARNA 4ARRA 3REZA 1K5GC 3KJ4A 5IJCA 4C2AB 1O6TA 4HQ1A 4PSJA 1D0BA 4LI1A 4CC4A 4GLPA 4V2DA 2JE0A 3DZEA 4J4LA 4Z64C 1FQVA 2P1NB 4LXSA 3UL8A 1P8VA 3G04C 4G8AA 3VQ1A 4MQWX 2UZYA 1FT8A 3P72A 1WWLA 2OMTA 4LSCA
chains in the Genus database with same CATH superfamily
4Y61B 2V9TB 2XOTA 4XGOA 5A5CA 4CNMA 5GMFA 3W3LA 5B0TA 3C6OB 3RW7A 2CA6A 4L3FA 4CNCA 4ECNA 4R07A 5B4PA 4FMZA 4U06A 4V2CA 1PGVA 1XKUA 4R6GA 4CC4C 3RFSA 4NZRM 5D3IA 2WQUA 4P8SA 5B0NA 4LXRA 3E4GA 3WPEA 5GQRK 3W3GA 3W3MA 2ID5A 3RW6A 1M9SA 2Z7XB 4AW4A 4BSUA 2ASSB 2V9SA 4LSXA 4K17A 2A0ZA 5AWDA 4P91A 2Y5QA 5IJBA 3OGMB 4M7EA 4R6FA 4RWTC 1JL5A 4NZTM 5AZ5A 2BNHA 4I6JB 3RIZA 2WFHA 2R9UA 4TZHA 4XSQA 5CMNA 1H6UA 4OQTA 2RR6A 2V70A 1KOOA 4J0MA 1U0ND 3SB4A 4PEQB 3E6JA 2P1PB 1P8TA 4MN8B 3W3KA 1K5DC 4KT1A 3FXIA 2Z63A 5HZLB 3CIYA 2Z62A 4R09A 1OGQA 3UL7A 3WPDA 3M19A 3ZYJA 3UN9A 4PERA 4Z8GA 2RA8A 1W8AA 4FS7A 2WQVA 3RFJA 3GOZA 4LSXC 2P1QB 3TSRE 3C6NB 2UZXA 4FHOA 4M7EC 3W3JA 4H09A 2O6RA 1A4YA 4R08A 1ZIWA 4EZGA 3O53A 4RCAB 4YEBB 2ELLA 1DS9A 2WQWA 2P1MB 4PKIG 3RGXA 1QYYA 4UFRA 2FT3A 2O6SA 3BZ5A 2Z66A 5HDHA 5IJDA 5GS2B 4LSAA 3G3AA 5CMPA 1XECA 1SQ0B 3C6PB 4FD0A 4U7LA 3G06A 1H6TA 1GWBA 1FS2A 1KOHA 2O6QA 3ZYOA 2P1OB 4Z94G 2JE1A 3WPBA 2OMZA 1IO0A 2XWTC 4FCGA 1M10B 3VQ2A 3G39A 3WPIA 4XOSA 2ASTB 1M9LA 1G9UA 4GT6A 1FO1A 4WP6A 4R5CA 3OGLB 3RFEA 4ECOA 3E2JA 2Z65A 4QXEA 3ULAA 3ZYIA 2Z81A 4BSSA 2WQXA 3M18A 4QBZA 2Z82A 4BSRA 3W3NA 4Q3GA 3CIGA 4V2EA 2OMXA 1XWDC 3OJAA 4WYKA 4U08A 2BEXA 1A9NA 4LI2A 4KNGA 3O6NA 4R6JA 5IYXC 2Q4GW 2OMUA 4R58A 5GMGA 3WPGA 1YRGA 4KXFB 4PQ8A 1OTOA 5FTTB 4C2BB 4AY9X 4Z61C 4QC0A 3JB9j 5GS0A 1O6SA 3PMHG 3OJAB 4Z79A 3ULVA 1Z7XW 4IM6A 4R6AA 3WPHA 3WN4A 4B8CD 1DCEA 1O6VA 5AWAA 2Z64A 2IFGA 4BV4R 4NKHA 2Z7XA 2OMWA 3G3BA 1OTMA 3CVRA 1XCDA 3OGKB 4R0AA 4Q62A 4CILA 1LTXA 5AWBA 5AWCA 3E3ZA 4L3AA 5LFNA 1P9AG 3ZYNA 1XEUA 2OMVA 4Q3IA 2OMYA 3UL9A 3ULUA 1OTNA 2JQDA 1M0ZA 3RGZA 3A79B 1DFJI 1OOKG 4NKGA 4RCWA 4U09A 5GMHA 1OZNA 3WPCA 4CP6A 3WPFA 3RJ0A 4FDWA 4R5DA 4ARNA 4ARRA 3REZA 1K5GC 3KJ4A 5IJCA 4C2AB 1O6TA 4HQ1A 4PSJA 1D0BA 4LI1A 4CC4A 4GLPA 4V2DA 2JE0A 3DZEA 4J4LA 4Z64C 1FQVA 2P1NB 4LXSA 3UL8A 1P8VA 3G04C 4G8AA 3VQ1A 4MQWX 2UZYA 1FT8A 3P72A 1WWLA 2OMTA 4LSCA
chains in the Genus database with same CATH topology
4Y61B 2V9TB 2XOTA 4XGOA 5A5CA 4CNMA 5GMFA 3W3LA 5B0TA 3C6OB 3RW7A 2CA6A 4L3FA 4CNCA 4ECNA 4R07A 5B4PA 4FMZA 4U06A 4V2CA 1PGVA 1XKUA 4R6GA 4CC4C 3RFSA 5D3IA 2WQUA 4P8SA 5B0NA 4LXRA 3E4GA 3WPEA 5GQRK 3W3GA 3W3MA 2ID5A 3RW6A 1M9SA 2Z7XB 4AW4A 4BSUA 2ASSB 2V9SA 4LSXA 4K17A 2A0ZA 5AWDA 4P91A 2Y5QA 5IJBA 3OGMB 4M7EA 4R6FA 4RWTC 1JL5A 5AZ5A 2BNHA 4I6JB 3RIZA 2WFHA 2R9UA 4TZHA 4XSQA 5CMNA 1H6UA 4OQTA 2RR6A 2V70A 1KOOA 4J0MA 1U0ND 3SB4A 4PEQB 3E6JA 2P1PB 1P8TA 4MN8B 3W3KA 1K5DC 4KT1A 3FXIA 2Z63A 5HZLB 3CIYA 2Z62A 4R09A 1OGQA 3UL7A 3WPDA 3M19A 3ZYJA 3UN9A 4PERA 4Z8GA 2RA8A 1W8AA 4FS7A 2WQVA 3RFJA 3GOZA 4LSXC 2P1QB 3TSRE 3C6NB 2UZXA 4FHOA 4M7EC 3W3JA 4H09A 2O6RA 1A4YA 4R08A 1ZIWA 4EZGA 3O53A 4RCAB 4YEBB 2ELLA 1DS9A 2WQWA 2P1MB 4PKIG 3RGXA 1QYYA 4UFRA 2FT3A 2O6SA 3BZ5A 2Z66A 5HDHA 5IJDA 5GS2B 4LSAA 3G3AA 5CMPA 1XECA 1SQ0B 3C6PB 4FD0A 4U7LA 3G06A 1H6TA 1GWBA 1FS2A 1KOHA 2O6QA 3ZYOA 2P1OB 4Z94G 2JE1A 3WPBA 2OMZA 1IO0A 2XWTC 4FCGA 1M10B 3VQ2A 3G39A 3WPIA 4XOSA 2ASTB 1M9LA 1G9UA 4GT6A 1FO1A 4WP6A 4R5CA 3OGLB 3RFEA 4ECOA 3E2JA 2Z65A 4QXEA 3ULAA 3ZYIA 2Z81A 4BSSA 2WQXA 3M18A 4QBZA 2Z82A 4BSRA 3W3NA 4Q3GA 3CIGA 4V2EA 2OMXA 1XWDC 3OJAA 4WYKA 4U08A 2BEXA 1A9NA 4LI2A 4KNGA 3O6NA 4R6JA 5IYXC 2Q4GW 2OMUA 4R58A 5GMGA 3WPGA 1YRGA 4KXFB 4PQ8A 1OTOA 5FTTB 4C2BB 4AY9X 4Z61C 4QC0A 3JB9j 5GS0A 1O6SA 3PMHG 3OJAB 4Z79A 3ULVA 1Z7XW 4IM6A 4R6AA 3WPHA 3WN4A 4B8CD 1DCEA 1O6VA 5AWAA 2Z64A 2IFGA 4BV4R 4NKHA 2Z7XA 2OMWA 3G3BA 1OTMA 3CVRA 1XCDA 3OGKB 4R0AA 4Q62A 4CILA 1LTXA 5AWBA 5AWCA 3E3ZA 4L3AA 5LFNA 1P9AG 3ZYNA 1XEUA 2OMVA 4Q3IA 2OMYA 3UL9A 3ULUA 1OTNA 2JQDA 1M0ZA 3RGZA 3A79B 1DFJI 1OOKG 4NKGA 4RCWA 4U09A 5GMHA 1OZNA 3WPCA 4CP6A 3WPFA 3RJ0A 4FDWA 4R5DA 4ARNA 4ARRA 3REZA 1K5GC 3KJ4A 5IJCA 4C2AB 1O6TA 4HQ1A 4PSJA 1D0BA 4LI1A 4CC4A 4GLPA 4V2DA 2JE0A 3DZEA 4J4LA 4Z64C 1FQVA 2P1NB 4LXSA 3UL8A 1P8VA 3G04C 4G8AA 3VQ1A 4MQWX 2UZYA 1FT8A 3P72A 1WWLA 2OMTA 4LSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y61 B;  2V9T B;  2XOT A;  4XGO A;  5A5C A;  4CNM A;  5GMF A;  3W3L A;  5B0T A;  3C6O B;  3RW7 A;  2CA6 A;  4L3F A;  4CNC A;  4ECN A;  4R07 A;  5B4P A;  4FMZ A;  4U06 A;  4V2C A;  1PGV A;  1XKU A;  4R6G A;  4CC4 C;  3RFS A;  5D3I A;  2WQU A;  4P8S A;  5B0N A;  4LXR A;  3E4G A;  3WPE A;  5GQR K;  3W3G A;  3W3M A;  2ID5 A;  3RW6 A;  1M9S A;  2Z7X B;  4AW4 A;  4BSU A;  2ASS B;  2V9S A;  4LSX A;  4K17 A;  2A0Z A;  5AWD A;  4P91 A;  2Y5Q A;  5IJB A;  3OGM B;  4M7E A;  4R6F A;  4RWT C;  1JL5 A;  5AZ5 A;  2BNH A;  4I6J B;  3RIZ A;  2WFH A;  2R9U A;  4TZH A;  4XSQ A;  5CMN A;  1H6U A;  4OQT A;  2RR6 A;  2V70 A;  1KOO A;  4J0M A;  1U0N D;  3SB4 A;  4PEQ B;  3E6J A;  2P1P B;  1P8T A;  4MN8 B;  3W3K A;  1K5D C;  4KT1 A;  3FXI A;  2Z63 A;  5HZL B;  3CIY A;  2Z62 A;  4R09 A;  1OGQ A;  3UL7 A;  3WPD A;  3M19 A;  3ZYJ A;  3UN9 A;  4PER A;  4Z8G A;  2RA8 A;  1W8A A;  4FS7 A;  2WQV A;  3RFJ A;  3GOZ A;  4LSX C;  2P1Q B;  3TSR E;  3C6N B;  2UZX A;  4FHO A;  4M7E C;  3W3J A;  4H09 A;  2O6R A;  1A4Y A;  4R08 A;  1ZIW A;  4EZG A;  3O53 A;  4RCA B;  4YEB B;  2ELL A;  1DS9 A;  2WQW A;  2P1M B;  4PKI G;  3RGX A;  1QYY A;  4UFR A;  2FT3 A;  2O6S A;  3BZ5 A;  2Z66 A;  5HDH A;  5IJD A;  5GS2 B;  4LSA A;  3G3A A;  5CMP A;  1XEC A;  1SQ0 B;  3C6P B;  4FD0 A;  4U7L A;  3G06 A;  1H6T A;  1GWB A;  1FS2 A;  1KOH A;  2O6Q A;  3ZYO A;  2P1O B;  4Z94 G;  2JE1 A;  3WPB A;  2OMZ A;  1IO0 A;  2XWT C;  4FCG A;  1M10 B;  3VQ2 A;  3G39 A;  3WPI A;  4XOS A;  2AST B;  1M9L A;  1G9U A;  4GT6 A;  1FO1 A;  4WP6 A;  4R5C A;  3OGL B;  3RFE A;  4ECO A;  3E2J A;  2Z65 A;  4QXE A;  3ULA A;  3ZYI A;  2Z81 A;  4BSS A;  2WQX A;  3M18 A;  4QBZ A;  2Z82 A;  4BSR A;  3W3N A;  4Q3G A;  3CIG A;  4V2E A;  2OMX A;  1XWD C;  3OJA A;  4WYK A;  4U08 A;  2BEX A;  1A9N A;  4LI2 A;  4KNG A;  3O6N A;  4R6J A;  5IYX C;  2Q4G W;  2OMU A;  4R58 A;  5GMG A;  3WPG A;  1YRG A;  4KXF B;  4PQ8 A;  1OTO A;  5FTT B;  4C2B B;  4AY9 X;  4Z61 C;  4QC0 A;  3JB9 j;  5GS0 A;  1O6S A;  3PMH G;  3OJA B;  4Z79 A;  3ULV A;  1Z7X W;  4IM6 A;  4R6A A;  3WPH A;  3WN4 A;  4B8C D;  1DCE A;  1O6V A;  5AWA A;  2Z64 A;  2IFG A;  4BV4 R;  4NKH A;  2Z7X A;  2OMW A;  3G3B A;  1OTM A;  3CVR A;  1XCD A;  3OGK B;  4R0A A;  4Q62 A;  4CIL A;  1LTX A;  5AWB A;  5AWC A;  3E3Z A;  4L3A A;  5LFN A;  1P9A G;  3ZYN A;  1XEU A;  2OMV A;  4Q3I A;  2OMY A;  3UL9 A;  3ULU A;  1OTN A;  2JQD A;  1M0Z A;  3RGZ A;  3A79 B;  1DFJ I;  1OOK G;  4NKG A;  4RCW A;  4U09 A;  5GMH A;  1OZN A;  3WPC A;  4CP6 A;  3WPF A;  3RJ0 A;  4FDW A;  4R5D A;  4ARN A;  4ARR A;  3REZ A;  1K5G C;  3KJ4 A;  5IJC A;  4C2A B;  1O6T A;  4HQ1 A;  4PSJ A;  1D0B A;  4LI1 A;  4CC4 A;  4GLP A;  4V2D A;  2JE0 A;  3DZE A;  4J4L A;  4Z64 C;  1FQV A;  2P1N B;  4LXS A;  3UL8 A;  1P8V A;  3G04 C;  4G8A A;  3VQ1 A;  4MQW X;  2UZY A;  1FT8 A;  3P72 A;  1WWL A;  2OMT A;  4LSC A; 
#chains in the Genus database with same CATH topology
 4Y61 B;  2V9T B;  2XOT A;  4XGO A;  5A5C A;  4CNM A;  5GMF A;  3W3L A;  5B0T A;  3C6O B;  3RW7 A;  2CA6 A;  4L3F A;  4CNC A;  4ECN A;  4R07 A;  5B4P A;  4FMZ A;  4U06 A;  4V2C A;  1PGV A;  1XKU A;  4R6G A;  4CC4 C;  3RFS A;  4NZR M;  5D3I A;  2WQU A;  4P8S A;  5B0N A;  4LXR A;  3E4G A;  3WPE A;  5GQR K;  3W3G A;  3W3M A;  2ID5 A;  3RW6 A;  1M9S A;  2Z7X B;  4AW4 A;  4BSU A;  2ASS B;  2V9S A;  4LSX A;  4K17 A;  2A0Z A;  5AWD A;  4P91 A;  2Y5Q A;  5IJB A;  3OGM B;  4M7E A;  4R6F A;  4RWT C;  1JL5 A;  4NZT M;  5AZ5 A;  2BNH A;  4I6J B;  3RIZ A;  2WFH A;  2R9U A;  4TZH A;  4XSQ A;  5CMN A;  1H6U A;  4OQT A;  2RR6 A;  2V70 A;  1KOO A;  4J0M A;  1U0N D;  3SB4 A;  4PEQ B;  3E6J A;  2P1P B;  1P8T A;  4MN8 B;  3W3K A;  1K5D C;  4KT1 A;  3FXI A;  2Z63 A;  5HZL B;  3CIY A;  2Z62 A;  4R09 A;  1OGQ A;  3UL7 A;  3WPD A;  3M19 A;  3ZYJ A;  3UN9 A;  4PER A;  4Z8G A;  2RA8 A;  1W8A A;  4FS7 A;  2WQV A;  3RFJ A;  3GOZ A;  4LSX C;  2P1Q B;  3TSR E;  3C6N B;  2UZX A;  4FHO A;  4M7E C;  3W3J A;  4H09 A;  2O6R A;  1A4Y A;  4R08 A;  1ZIW A;  4EZG A;  3O53 A;  4RCA B;  4YEB B;  2ELL A;  1DS9 A;  2WQW A;  2P1M B;  4PKI G;  3RGX A;  1QYY A;  4UFR A;  2FT3 A;  2O6S A;  3BZ5 A;  2Z66 A;  5HDH A;  5IJD A;  5GS2 B;  4LSA A;  3G3A A;  5CMP A;  1XEC A;  1SQ0 B;  3C6P B;  4FD0 A;  4U7L A;  3G06 A;  1H6T A;  1GWB A;  1FS2 A;  1KOH A;  2O6Q A;  3ZYO A;  2P1O B;  4Z94 G;  2JE1 A;  3WPB A;  2OMZ A;  1IO0 A;  2XWT C;  4FCG A;  1M10 B;  3VQ2 A;  3G39 A;  3WPI A;  4XOS A;  2AST B;  1M9L A;  1G9U A;  4GT6 A;  1FO1 A;  4WP6 A;  4R5C A;  3OGL B;  3RFE A;  4ECO A;  3E2J A;  2Z65 A;  4QXE A;  3ULA A;  3ZYI A;  2Z81 A;  4BSS A;  2WQX A;  3M18 A;  4QBZ A;  2Z82 A;  4BSR A;  3W3N A;  4Q3G A;  3CIG A;  4V2E A;  2OMX A;  1XWD C;  3OJA A;  4WYK A;  4U08 A;  2BEX A;  1A9N A;  4LI2 A;  4KNG A;  3O6N A;  4R6J A;  5IYX C;  2Q4G W;  2OMU A;  4R58 A;  5GMG A;  3WPG A;  1YRG A;  4KXF B;  4PQ8 A;  1OTO A;  5FTT B;  4C2B B;  4AY9 X;  4Z61 C;  4QC0 A;  3JB9 j;  5GS0 A;  1O6S A;  3PMH G;  3OJA B;  4Z79 A;  3ULV A;  1Z7X W;  4IM6 A;  4R6A A;  3WPH A;  3WN4 A;  4B8C D;  1DCE A;  1O6V A;  5AWA A;  2Z64 A;  2IFG A;  4BV4 R;  4NKH A;  2Z7X A;  2OMW A;  3G3B A;  1OTM A;  3CVR A;  1XCD A;  3OGK B;  4R0A A;  4Q62 A;  4CIL A;  1LTX A;  5AWB A;  5AWC A;  3E3Z A;  4L3A A;  5LFN A;  1P9A G;  3ZYN A;  1XEU A;  2OMV A;  4Q3I A;  2OMY A;  3UL9 A;  3ULU A;  1OTN A;  2JQD A;  1M0Z A;  3RGZ A;  3A79 B;  1DFJ I;  1OOK G;  4NKG A;  4RCW A;  4U09 A;  5GMH A;  1OZN A;  3WPC A;  4CP6 A;  3WPF A;  3RJ0 A;  4FDW A;  4R5D A;  4ARN A;  4ARR A;  3REZ A;  1K5G C;  3KJ4 A;  5IJC A;  4C2A B;  1O6T A;  4HQ1 A;  4PSJ A;  1D0B A;  4LI1 A;  4CC4 A;  4GLP A;  4V2D A;  2JE0 A;  3DZE A;  4J4L A;  4Z64 C;  1FQV A;  2P1N B;  4LXS A;  3UL8 A;  1P8V A;  3G04 C;  4G8A A;  3VQ1 A;  4MQW X;  2UZY A;  1FT8 A;  3P72 A;  1WWL A;  2OMT A;  4LSC A; 
#chains in the Genus database with same CATH homology
 4Y61 B;  2V9T B;  2XOT A;  4XGO A;  5A5C A;  4CNM A;  5GMF A;  3W3L A;  5B0T A;  3C6O B;  3RW7 A;  2CA6 A;  4L3F A;  4CNC A;  4ECN A;  4R07 A;  5B4P A;  4FMZ A;  4U06 A;  4V2C A;  1PGV A;  1XKU A;  4R6G A;  4CC4 C;  3RFS A;  5D3I A;  2WQU A;  4P8S A;  5B0N A;  4LXR A;  3E4G A;  3WPE A;  5GQR K;  3W3G A;  3W3M A;  2ID5 A;  3RW6 A;  1M9S A;  2Z7X B;  4AW4 A;  4BSU A;  2ASS B;  2V9S A;  4LSX A;  4K17 A;  2A0Z A;  5AWD A;  4P91 A;  2Y5Q A;  5IJB A;  3OGM B;  4M7E A;  4R6F A;  4RWT C;  1JL5 A;  5AZ5 A;  2BNH A;  4I6J B;  3RIZ A;  2WFH A;  2R9U A;  4TZH A;  4XSQ A;  5CMN A;  1H6U A;  4OQT A;  2RR6 A;  2V70 A;  1KOO A;  4J0M A;  1U0N D;  3SB4 A;  4PEQ B;  3E6J A;  2P1P B;  1P8T A;  4MN8 B;  3W3K A;  1K5D C;  4KT1 A;  3FXI A;  2Z63 A;  5HZL B;  3CIY A;  2Z62 A;  4R09 A;  1OGQ A;  3UL7 A;  3WPD A;  3M19 A;  3ZYJ A;  3UN9 A;  4PER A;  4Z8G A;  2RA8 A;  1W8A A;  4FS7 A;  2WQV A;  3RFJ A;  3GOZ A;  4LSX C;  2P1Q B;  3TSR E;  3C6N B;  2UZX A;  4FHO A;  4M7E C;  3W3J A;  4H09 A;  2O6R A;  1A4Y A;  4R08 A;  1ZIW A;  4EZG A;  3O53 A;  4RCA B;  4YEB B;  2ELL A;  1DS9 A;  2WQW A;  2P1M B;  4PKI G;  3RGX A;  1QYY A;  4UFR A;  2FT3 A;  2O6S A;  3BZ5 A;  2Z66 A;  5HDH A;  5IJD A;  5GS2 B;  4LSA A;  3G3A A;  5CMP A;  1XEC A;  1SQ0 B;  3C6P B;  4FD0 A;  4U7L A;  3G06 A;  1H6T A;  1GWB A;  1FS2 A;  1KOH A;  2O6Q A;  3ZYO A;  2P1O B;  4Z94 G;  2JE1 A;  3WPB A;  2OMZ A;  1IO0 A;  2XWT C;  4FCG A;  1M10 B;  3VQ2 A;  3G39 A;  3WPI A;  4XOS A;  2AST B;  1M9L A;  1G9U A;  4GT6 A;  1FO1 A;  4WP6 A;  4R5C A;  3OGL B;  3RFE A;  4ECO A;  3E2J A;  2Z65 A;  4QXE A;  3ULA A;  3ZYI A;  2Z81 A;  4BSS A;  2WQX A;  3M18 A;  4QBZ A;  2Z82 A;  4BSR A;  3W3N A;  4Q3G A;  3CIG A;  4V2E A;  2OMX A;  1XWD C;  3OJA A;  4WYK A;  4U08 A;  2BEX A;  1A9N A;  4LI2 A;  4KNG A;  3O6N A;  4R6J A;  5IYX C;  2Q4G W;  2OMU A;  4R58 A;  5GMG A;  3WPG A;  1YRG A;  4KXF B;  4PQ8 A;  1OTO A;  5FTT B;  4C2B B;  4AY9 X;  4Z61 C;  4QC0 A;  3JB9 j;  5GS0 A;  1O6S A;  3PMH G;  3OJA B;  4Z79 A;  3ULV A;  1Z7X W;  4IM6 A;  4R6A A;  3WPH A;  3WN4 A;  4B8C D;  1DCE A;  1O6V A;  5AWA A;  2Z64 A;  2IFG A;  4BV4 R;  4NKH A;  2Z7X A;  2OMW A;  3G3B A;  1OTM A;  3CVR A;  1XCD A;  3OGK B;  4R0A A;  4Q62 A;  4CIL A;  1LTX A;  5AWB A;  5AWC A;  3E3Z A;  4L3A A;  5LFN A;  1P9A G;  3ZYN A;  1XEU A;  2OMV A;  4Q3I A;  2OMY A;  3UL9 A;  3ULU A;  1OTN A;  2JQD A;  1M0Z A;  3RGZ A;  3A79 B;  1DFJ I;  1OOK G;  4NKG A;  4RCW A;  4U09 A;  5GMH A;  1OZN A;  3WPC A;  4CP6 A;  3WPF A;  3RJ0 A;  4FDW A;  4R5D A;  4ARN A;  4ARR A;  3REZ A;  1K5G C;  3KJ4 A;  5IJC A;  4C2A B;  1O6T A;  4HQ1 A;  4PSJ A;  1D0B A;  4LI1 A;  4CC4 A;  4GLP A;  4V2D A;  2JE0 A;  3DZE A;  4J4L A;  4Z64 C;  1FQV A;  2P1N B;  4LXS A;  3UL8 A;  1P8V A;  3G04 C;  4G8A A;  3VQ1 A;  4MQW X;  2UZY A;  1FT8 A;  3P72 A;  1WWL A;  2OMT A;  4LSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...