1FQVA

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SKP2
publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 119
structure length 325
sequence length 325
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fqvA00
2Z81A 3TSRE 1U0ND 5B4PA 3A79B 4LSXA 4QC0A 4C2BB 4L3AA 4NKHA 4R0AA 4RCAB 1FQVA 4P8SA 3G3BA 2P1MB 4MN8B 1JL5A 4FHOA 4Q62A 3SB4A 1A9NA 1FO1A 4V2CA 3C6OB 1O6SA 5GS0A 1IO0A 4R58A 4BV4R 4J0MA 4U09A 4U7LA 5GMFA 4CC4C 3RGXA 4PEQB 1H6UA 4L3FA 1OTOA 1KOHA 2WQUA 3RGZA 4WYKA 4ECOA 4BSUA 3RFJA 5AWCA 1DCEA 4FMZA 4CC4A 4CILA 4RWTC 5IYXC 2Q4GW 2O6SA 2RR6A 2Z64A 4BSRA 5IJCA 2V9SA 4IM6A 3RIZA 3RW6A 4CP6A 2P1QB 5B0NA 3FXIA 3WPCA 3PMHG 4ECNA 3UL7A 3W3KA 4P91A 4R08A 2Y5QA 4PSJA 5D3IA 2P1OB 2ELLA 3ULVA 2IFGA 1LTXA 4QBZA 4Y61B 2OMVA 4LI1A 3O53A 4C2AB 3CIGA 3W3NA 1XKUA 1GWBA 1K5GC 4R6JA 3ZYJA 3E2JA 2XOTA 4Q3GA 3VQ1A 2BEXA 1XCDA 5HDHA 1OTMA 3VQ2A 3W3JA 4R6GA 4AY9X 1OTNA 4WP6A 3E6JA 5AWBA 1PGVA 2Z62A 4KXFB 4Z61C 4V2EA 2R9UA 1ZIWA 4YEBB 2OMXA 1O6TA 4M7EC 4CNCA 4OQTA 3WPIA 2WQXA 5GMHA 4M7EA 4GLPA 5HZLB 4PQ8A 3M19A 3UL8A 2UZYA 3UL9A 5IJDA 4MQWX 4AW4A 3OJAA 3OGLB 1YRGA 4GT6A 1FS2A 2OMYA 1WWLA 2V70A 3BZ5A 3ULUA 2CA6A 3RJ0A 3KJ4A 4G8AA 3WPGA 2Z7XB 2OMWA 2OMTA 1M9LA 1OGQA 2FT3A 3P72A 5GS2B 4R6AA 4XGOA 1P8VA 2RA8A 4XSQA 3G39A 2WFHA 2WQVA 4FCGA 3RFEA 3CIYA 2A0ZA 1W8AA 2V9TB 3WPBA 1Z7XW 3JB9j 3ZYNA 1O6VA 4LXRA 3G06A 3RW7A 3E4GA 4PERA 1XEUA 1H6TA 2O6QA 5LFNA 4R5DA 4TZHA 2OMUA 1K5DC 4QXEA 4Z79A 3WPEA 4U08A 4LI2A 1KOOA 4FS7A 5A5CA 3O6NA 3UN9A 4UFRA 4NKGA 4LSXC 3W3LA 1A4YA 4LSCA 2P1PB 1DS9A 1XECA 2UZXA 1D0BA 3OGKB 1FT8A 4U06A 4EZGA 2JQDA 3ULAA 3ZYOA 1G9UA 2Z7XA 4Z94G 1P8TA 2XWTC 3ZYIA 4R09A 4Q3IA 2BNHA 5IJBA 5CMNA 4LSAA 4RCWA 5GMGA 3OJAB 3W3GA 1M0ZA 2WQWA 4V2DA 3G3AA 4KT1A 4LXSA 4HQ1A 3M18A 1SQ0B 1M10B 2Z63A 3CVRA 4KNGA 4R6FA 4FDWA 4Z8GA 2O6RA 2Z66A 5CMPA 3C6PB 1M9SA 3OGMB 5GQRK 4Z64C 2JE1A 2P1NB 1OZNA 2ASSB 2ASTB 2JE0A 1DFJI 4R5CA 4R07A 1XWDC 5AWDA 4K17A 3RFSA 5AZ5A 3E3ZA 4H09A 3G04C 3GOZA 4I6JB 4B8CD 4J4LA 1OOKG 4BSSA 3WPFA 4FD0A 2ID5A 3WPHA 3C6NB 4ARNA 2OMZA 5FTTB 3DZEA 3WPDA 2Z82A 1QYYA 4ARRA 2Z65A 4XOSA 3W3MA 1P9AG 4CNMA 5B0TA 4PKIG 3WN4A 5AWAA 3REZA
chains in the Genus database with same CATH superfamily
2Z81A 3TSRE 1U0ND 5B4PA 3A79B 4LSXA 4QC0A 4C2BB 4L3AA 4NKHA 4R0AA 4RCAB 1FQVA 4P8SA 3G3BA 2P1MB 4MN8B 1JL5A 4FHOA 4Q62A 3SB4A 1A9NA 1FO1A 4V2CA 3C6OB 1O6SA 5GS0A 1IO0A 4R58A 4BV4R 4J0MA 4U09A 4U7LA 5GMFA 4CC4C 3RGXA 4PEQB 1H6UA 4L3FA 1OTOA 1KOHA 2WQUA 3RGZA 4WYKA 4ECOA 4BSUA 3RFJA 5AWCA 1DCEA 4FMZA 4CC4A 4CILA 4RWTC 5IYXC 2Q4GW 2O6SA 2RR6A 2Z64A 4BSRA 5IJCA 2V9SA 4IM6A 3RIZA 3RW6A 4CP6A 2P1QB 5B0NA 3FXIA 3WPCA 3PMHG 4ECNA 3UL7A 3W3KA 4P91A 4R08A 2Y5QA 4PSJA 5D3IA 2P1OB 2ELLA 3ULVA 2IFGA 1LTXA 4QBZA 4Y61B 2OMVA 4LI1A 3O53A 4C2AB 3CIGA 3W3NA 1XKUA 1GWBA 1K5GC 4R6JA 3ZYJA 3E2JA 2XOTA 4Q3GA 3VQ1A 2BEXA 1XCDA 5HDHA 1OTMA 3VQ2A 3W3JA 4R6GA 4AY9X 1OTNA 4WP6A 3E6JA 5AWBA 1PGVA 2Z62A 4KXFB 4Z61C 4V2EA 2R9UA 1ZIWA 4YEBB 2OMXA 1O6TA 4M7EC 4CNCA 4OQTA 3WPIA 2WQXA 5GMHA 4M7EA 4GLPA 5HZLB 4PQ8A 3M19A 3UL8A 2UZYA 3UL9A 5IJDA 4MQWX 4AW4A 3OJAA 3OGLB 1YRGA 4GT6A 1FS2A 2OMYA 1WWLA 2V70A 3BZ5A 3ULUA 2CA6A 3RJ0A 3KJ4A 4NZRM 4G8AA 3WPGA 2Z7XB 2OMWA 2OMTA 1M9LA 1OGQA 4NZTM 2FT3A 3P72A 5GS2B 4R6AA 4XGOA 1P8VA 2RA8A 4XSQA 3G39A 2WFHA 2WQVA 4FCGA 3RFEA 3CIYA 2A0ZA 1W8AA 2V9TB 3WPBA 1Z7XW 3JB9j 3ZYNA 1O6VA 4LXRA 3G06A 3RW7A 3E4GA 4PERA 1XEUA 1H6TA 2O6QA 5LFNA 4R5DA 4TZHA 2OMUA 1K5DC 4QXEA 4Z79A 3WPEA 4U08A 4LI2A 1KOOA 4FS7A 5A5CA 3O6NA 3UN9A 4UFRA 4NKGA 4LSXC 3W3LA 1A4YA 4LSCA 2P1PB 1DS9A 1XECA 2UZXA 1D0BA 3OGKB 1FT8A 4U06A 4EZGA 2JQDA 3ULAA 3ZYOA 1G9UA 2Z7XA 4Z94G 1P8TA 2XWTC 3ZYIA 4R09A 4Q3IA 2BNHA 5IJBA 5CMNA 4LSAA 4RCWA 5GMGA 3OJAB 3W3GA 1M0ZA 2WQWA 4V2DA 3G3AA 4KT1A 4LXSA 4HQ1A 3M18A 1SQ0B 1M10B 2Z63A 3CVRA 4KNGA 4R6FA 4FDWA 4Z8GA 2O6RA 2Z66A 5CMPA 3C6PB 1M9SA 3OGMB 5GQRK 4Z64C 2JE1A 2P1NB 1OZNA 2ASSB 2ASTB 2JE0A 1DFJI 4R5CA 4R07A 1XWDC 5AWDA 4K17A 3RFSA 5AZ5A 3E3ZA 4H09A 3G04C 3GOZA 4I6JB 4B8CD 4J4LA 1OOKG 4BSSA 3WPFA 4FD0A 2ID5A 3WPHA 3C6NB 4ARNA 2OMZA 5FTTB 3DZEA 3WPDA 2Z82A 1QYYA 4ARRA 2Z65A 4XOSA 3W3MA 1P9AG 4CNMA 5B0TA 4PKIG 3WN4A 5AWAA 3REZA
chains in the Genus database with same CATH topology
2Z81A 3TSRE 1U0ND 5B4PA 3A79B 4LSXA 4QC0A 4C2BB 4L3AA 4NKHA 4R0AA 4RCAB 1FQVA 4P8SA 3G3BA 2P1MB 4MN8B 1JL5A 4FHOA 4Q62A 3SB4A 1A9NA 1FO1A 4V2CA 3C6OB 1O6SA 5GS0A 1IO0A 4R58A 4BV4R 4J0MA 4U09A 4U7LA 5GMFA 4CC4C 3RGXA 4PEQB 1H6UA 4L3FA 1OTOA 1KOHA 2WQUA 3RGZA 4WYKA 4ECOA 4BSUA 3RFJA 5AWCA 1DCEA 4FMZA 4CC4A 4CILA 4RWTC 5IYXC 2Q4GW 2O6SA 2RR6A 2Z64A 4BSRA 5IJCA 2V9SA 4IM6A 3RIZA 3RW6A 4CP6A 2P1QB 5B0NA 3FXIA 3WPCA 3PMHG 4ECNA 3UL7A 3W3KA 4P91A 4R08A 2Y5QA 4PSJA 5D3IA 2P1OB 2ELLA 3ULVA 2IFGA 1LTXA 4QBZA 4Y61B 2OMVA 4LI1A 3O53A 4C2AB 3CIGA 3W3NA 1XKUA 1GWBA 1K5GC 4R6JA 3ZYJA 3E2JA 2XOTA 4Q3GA 3VQ1A 2BEXA 1XCDA 5HDHA 1OTMA 3VQ2A 3W3JA 4R6GA 4AY9X 1OTNA 4WP6A 3E6JA 5AWBA 1PGVA 2Z62A 4KXFB 4Z61C 4V2EA 2R9UA 1ZIWA 4YEBB 2OMXA 1O6TA 4M7EC 4CNCA 4OQTA 3WPIA 2WQXA 5GMHA 4M7EA 4GLPA 5HZLB 4PQ8A 3M19A 3UL8A 2UZYA 3UL9A 5IJDA 4MQWX 4AW4A 3OJAA 3OGLB 1YRGA 4GT6A 1FS2A 2OMYA 1WWLA 2V70A 3BZ5A 3ULUA 2CA6A 3RJ0A 3KJ4A 4G8AA 3WPGA 2Z7XB 2OMWA 2OMTA 1M9LA 1OGQA 2FT3A 3P72A 5GS2B 4R6AA 4XGOA 1P8VA 2RA8A 4XSQA 3G39A 2WFHA 2WQVA 4FCGA 3RFEA 3CIYA 2A0ZA 1W8AA 2V9TB 3WPBA 1Z7XW 3JB9j 3ZYNA 1O6VA 4LXRA 3G06A 3RW7A 3E4GA 4PERA 1XEUA 1H6TA 2O6QA 5LFNA 4R5DA 4TZHA 2OMUA 1K5DC 4QXEA 4Z79A 3WPEA 4U08A 4LI2A 1KOOA 4FS7A 5A5CA 3O6NA 3UN9A 4UFRA 4NKGA 4LSXC 3W3LA 1A4YA 4LSCA 2P1PB 1DS9A 1XECA 2UZXA 1D0BA 3OGKB 1FT8A 4U06A 4EZGA 2JQDA 3ULAA 3ZYOA 1G9UA 2Z7XA 4Z94G 1P8TA 2XWTC 3ZYIA 4R09A 4Q3IA 2BNHA 5IJBA 5CMNA 4LSAA 4RCWA 5GMGA 3OJAB 3W3GA 1M0ZA 2WQWA 4V2DA 3G3AA 4KT1A 4LXSA 4HQ1A 3M18A 1SQ0B 1M10B 2Z63A 3CVRA 4KNGA 4R6FA 4FDWA 4Z8GA 2O6RA 2Z66A 5CMPA 3C6PB 1M9SA 3OGMB 5GQRK 4Z64C 2JE1A 2P1NB 1OZNA 2ASSB 2ASTB 2JE0A 1DFJI 4R5CA 4R07A 1XWDC 5AWDA 4K17A 3RFSA 5AZ5A 3E3ZA 4H09A 3G04C 3GOZA 4I6JB 4B8CD 4J4LA 1OOKG 4BSSA 3WPFA 4FD0A 2ID5A 3WPHA 3C6NB 4ARNA 2OMZA 5FTTB 3DZEA 3WPDA 2Z82A 1QYYA 4ARRA 2Z65A 4XOSA 3W3MA 1P9AG 4CNMA 5B0TA 4PKIG 3WN4A 5AWAA 3REZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z81 A;  3TSR E;  1U0N D;  5B4P A;  3A79 B;  4LSX A;  4QC0 A;  4C2B B;  4L3A A;  4NKH A;  4R0A A;  4RCA B;  1FQV A;  4P8S A;  3G3B A;  2P1M B;  4MN8 B;  1JL5 A;  4FHO A;  4Q62 A;  3SB4 A;  1A9N A;  1FO1 A;  4V2C A;  3C6O B;  1O6S A;  5GS0 A;  1IO0 A;  4R58 A;  4BV4 R;  4J0M A;  4U09 A;  4U7L A;  5GMF A;  4CC4 C;  3RGX A;  4PEQ B;  1H6U A;  4L3F A;  1OTO A;  1KOH A;  2WQU A;  3RGZ A;  4WYK A;  4ECO A;  4BSU A;  3RFJ A;  5AWC A;  1DCE A;  4FMZ A;  4CC4 A;  4CIL A;  4RWT C;  5IYX C;  2Q4G W;  2O6S A;  2RR6 A;  2Z64 A;  4BSR A;  5IJC A;  2V9S A;  4IM6 A;  3RIZ A;  3RW6 A;  4CP6 A;  2P1Q B;  5B0N A;  3FXI A;  3WPC A;  3PMH G;  4ECN A;  3UL7 A;  3W3K A;  4P91 A;  4R08 A;  2Y5Q A;  4PSJ A;  5D3I A;  2P1O B;  2ELL A;  3ULV A;  2IFG A;  1LTX A;  4QBZ A;  4Y61 B;  2OMV A;  4LI1 A;  3O53 A;  4C2A B;  3CIG A;  3W3N A;  1XKU A;  1GWB A;  1K5G C;  4R6J A;  3ZYJ A;  3E2J A;  2XOT A;  4Q3G A;  3VQ1 A;  2BEX A;  1XCD A;  5HDH A;  1OTM A;  3VQ2 A;  3W3J A;  4R6G A;  4AY9 X;  1OTN A;  4WP6 A;  3E6J A;  5AWB A;  1PGV A;  2Z62 A;  4KXF B;  4Z61 C;  4V2E A;  2R9U A;  1ZIW A;  4YEB B;  2OMX A;  1O6T A;  4M7E C;  4CNC A;  4OQT A;  3WPI A;  2WQX A;  5GMH A;  4M7E A;  4GLP A;  5HZL B;  4PQ8 A;  3M19 A;  3UL8 A;  2UZY A;  3UL9 A;  5IJD A;  4MQW X;  4AW4 A;  3OJA A;  3OGL B;  1YRG A;  4GT6 A;  1FS2 A;  2OMY A;  1WWL A;  2V70 A;  3BZ5 A;  3ULU A;  2CA6 A;  3RJ0 A;  3KJ4 A;  4G8A A;  3WPG A;  2Z7X B;  2OMW A;  2OMT A;  1M9L A;  1OGQ A;  2FT3 A;  3P72 A;  5GS2 B;  4R6A A;  4XGO A;  1P8V A;  2RA8 A;  4XSQ A;  3G39 A;  2WFH A;  2WQV A;  4FCG A;  3RFE A;  3CIY A;  2A0Z A;  1W8A A;  2V9T B;  3WPB A;  1Z7X W;  3JB9 j;  3ZYN A;  1O6V A;  4LXR A;  3G06 A;  3RW7 A;  3E4G A;  4PER A;  1XEU A;  1H6T A;  2O6Q A;  5LFN A;  4R5D A;  4TZH A;  2OMU A;  1K5D C;  4QXE A;  4Z79 A;  3WPE A;  4U08 A;  4LI2 A;  1KOO A;  4FS7 A;  5A5C A;  3O6N A;  3UN9 A;  4UFR A;  4NKG A;  4LSX C;  3W3L A;  1A4Y A;  4LSC A;  2P1P B;  1DS9 A;  1XEC A;  2UZX A;  1D0B A;  3OGK B;  1FT8 A;  4U06 A;  4EZG A;  2JQD A;  3ULA A;  3ZYO A;  1G9U A;  2Z7X A;  4Z94 G;  1P8T A;  2XWT C;  3ZYI A;  4R09 A;  4Q3I A;  2BNH A;  5IJB A;  5CMN A;  4LSA A;  4RCW A;  5GMG A;  3OJA B;  3W3G A;  1M0Z A;  2WQW A;  4V2D A;  3G3A A;  4KT1 A;  4LXS A;  4HQ1 A;  3M18 A;  1SQ0 B;  1M10 B;  2Z63 A;  3CVR A;  4KNG A;  4R6F A;  4FDW A;  4Z8G A;  2O6R A;  2Z66 A;  5CMP A;  3C6P B;  1M9S A;  3OGM B;  5GQR K;  4Z64 C;  2JE1 A;  2P1N B;  1OZN A;  2ASS B;  2AST B;  2JE0 A;  1DFJ I;  4R5C A;  4R07 A;  1XWD C;  5AWD A;  4K17 A;  3RFS A;  5AZ5 A;  3E3Z A;  4H09 A;  3G04 C;  3GOZ A;  4I6J B;  4B8C D;  4J4L A;  1OOK G;  4BSS A;  3WPF A;  4FD0 A;  2ID5 A;  3WPH A;  3C6N B;  4ARN A;  2OMZ A;  5FTT B;  3DZE A;  3WPD A;  2Z82 A;  1QYY A;  4ARR A;  2Z65 A;  4XOS A;  3W3M A;  1P9A G;  4CNM A;  5B0T A;  4PKI G;  3WN4 A;  5AWA A;  3REZ A; 
#chains in the Genus database with same CATH topology
 2Z81 A;  3TSR E;  1U0N D;  5B4P A;  3A79 B;  4LSX A;  4QC0 A;  4C2B B;  4L3A A;  4NKH A;  4R0A A;  4RCA B;  1FQV A;  4P8S A;  3G3B A;  2P1M B;  4MN8 B;  1JL5 A;  4FHO A;  4Q62 A;  3SB4 A;  1A9N A;  1FO1 A;  4V2C A;  3C6O B;  1O6S A;  5GS0 A;  1IO0 A;  4R58 A;  4BV4 R;  4J0M A;  4U09 A;  4U7L A;  5GMF A;  4CC4 C;  3RGX A;  4PEQ B;  1H6U A;  4L3F A;  1OTO A;  1KOH A;  2WQU A;  3RGZ A;  4WYK A;  4ECO A;  4BSU A;  3RFJ A;  5AWC A;  1DCE A;  4FMZ A;  4CC4 A;  4CIL A;  4RWT C;  5IYX C;  2Q4G W;  2O6S A;  2RR6 A;  2Z64 A;  4BSR A;  5IJC A;  2V9S A;  4IM6 A;  3RIZ A;  3RW6 A;  4CP6 A;  2P1Q B;  5B0N A;  3FXI A;  3WPC A;  3PMH G;  4ECN A;  3UL7 A;  3W3K A;  4P91 A;  4R08 A;  2Y5Q A;  4PSJ A;  5D3I A;  2P1O B;  2ELL A;  3ULV A;  2IFG A;  1LTX A;  4QBZ A;  4Y61 B;  2OMV A;  4LI1 A;  3O53 A;  4C2A B;  3CIG A;  3W3N A;  1XKU A;  1GWB A;  1K5G C;  4R6J A;  3ZYJ A;  3E2J A;  2XOT A;  4Q3G A;  3VQ1 A;  2BEX A;  1XCD A;  5HDH A;  1OTM A;  3VQ2 A;  3W3J A;  4R6G A;  4AY9 X;  1OTN A;  4WP6 A;  3E6J A;  5AWB A;  1PGV A;  2Z62 A;  4KXF B;  4Z61 C;  4V2E A;  2R9U A;  1ZIW A;  4YEB B;  2OMX A;  1O6T A;  4M7E C;  4CNC A;  4OQT A;  3WPI A;  2WQX A;  5GMH A;  4M7E A;  4GLP A;  5HZL B;  4PQ8 A;  3M19 A;  3UL8 A;  2UZY A;  3UL9 A;  5IJD A;  4MQW X;  4AW4 A;  3OJA A;  3OGL B;  1YRG A;  4GT6 A;  1FS2 A;  2OMY A;  1WWL A;  2V70 A;  3BZ5 A;  3ULU A;  2CA6 A;  3RJ0 A;  3KJ4 A;  4NZR M;  4G8A A;  3WPG A;  2Z7X B;  2OMW A;  2OMT A;  1M9L A;  1OGQ A;  4NZT M;  2FT3 A;  3P72 A;  5GS2 B;  4R6A A;  4XGO A;  1P8V A;  2RA8 A;  4XSQ A;  3G39 A;  2WFH A;  2WQV A;  4FCG A;  3RFE A;  3CIY A;  2A0Z A;  1W8A A;  2V9T B;  3WPB A;  1Z7X W;  3JB9 j;  3ZYN A;  1O6V A;  4LXR A;  3G06 A;  3RW7 A;  3E4G A;  4PER A;  1XEU A;  1H6T A;  2O6Q A;  5LFN A;  4R5D A;  4TZH A;  2OMU A;  1K5D C;  4QXE A;  4Z79 A;  3WPE A;  4U08 A;  4LI2 A;  1KOO A;  4FS7 A;  5A5C A;  3O6N A;  3UN9 A;  4UFR A;  4NKG A;  4LSX C;  3W3L A;  1A4Y A;  4LSC A;  2P1P B;  1DS9 A;  1XEC A;  2UZX A;  1D0B A;  3OGK B;  1FT8 A;  4U06 A;  4EZG A;  2JQD A;  3ULA A;  3ZYO A;  1G9U A;  2Z7X A;  4Z94 G;  1P8T A;  2XWT C;  3ZYI A;  4R09 A;  4Q3I A;  2BNH A;  5IJB A;  5CMN A;  4LSA A;  4RCW A;  5GMG A;  3OJA B;  3W3G A;  1M0Z A;  2WQW A;  4V2D A;  3G3A A;  4KT1 A;  4LXS A;  4HQ1 A;  3M18 A;  1SQ0 B;  1M10 B;  2Z63 A;  3CVR A;  4KNG A;  4R6F A;  4FDW A;  4Z8G A;  2O6R A;  2Z66 A;  5CMP A;  3C6P B;  1M9S A;  3OGM B;  5GQR K;  4Z64 C;  2JE1 A;  2P1N B;  1OZN A;  2ASS B;  2AST B;  2JE0 A;  1DFJ I;  4R5C A;  4R07 A;  1XWD C;  5AWD A;  4K17 A;  3RFS A;  5AZ5 A;  3E3Z A;  4H09 A;  3G04 C;  3GOZ A;  4I6J B;  4B8C D;  4J4L A;  1OOK G;  4BSS A;  3WPF A;  4FD0 A;  2ID5 A;  3WPH A;  3C6N B;  4ARN A;  2OMZ A;  5FTT B;  3DZE A;  3WPD A;  2Z82 A;  1QYY A;  4ARR A;  2Z65 A;  4XOS A;  3W3M A;  1P9A G;  4CNM A;  5B0T A;  4PKI G;  3WN4 A;  5AWA A;  3REZ A; 
#chains in the Genus database with same CATH homology
 2Z81 A;  3TSR E;  1U0N D;  5B4P A;  3A79 B;  4LSX A;  4QC0 A;  4C2B B;  4L3A A;  4NKH A;  4R0A A;  4RCA B;  1FQV A;  4P8S A;  3G3B A;  2P1M B;  4MN8 B;  1JL5 A;  4FHO A;  4Q62 A;  3SB4 A;  1A9N A;  1FO1 A;  4V2C A;  3C6O B;  1O6S A;  5GS0 A;  1IO0 A;  4R58 A;  4BV4 R;  4J0M A;  4U09 A;  4U7L A;  5GMF A;  4CC4 C;  3RGX A;  4PEQ B;  1H6U A;  4L3F A;  1OTO A;  1KOH A;  2WQU A;  3RGZ A;  4WYK A;  4ECO A;  4BSU A;  3RFJ A;  5AWC A;  1DCE A;  4FMZ A;  4CC4 A;  4CIL A;  4RWT C;  5IYX C;  2Q4G W;  2O6S A;  2RR6 A;  2Z64 A;  4BSR A;  5IJC A;  2V9S A;  4IM6 A;  3RIZ A;  3RW6 A;  4CP6 A;  2P1Q B;  5B0N A;  3FXI A;  3WPC A;  3PMH G;  4ECN A;  3UL7 A;  3W3K A;  4P91 A;  4R08 A;  2Y5Q A;  4PSJ A;  5D3I A;  2P1O B;  2ELL A;  3ULV A;  2IFG A;  1LTX A;  4QBZ A;  4Y61 B;  2OMV A;  4LI1 A;  3O53 A;  4C2A B;  3CIG A;  3W3N A;  1XKU A;  1GWB A;  1K5G C;  4R6J A;  3ZYJ A;  3E2J A;  2XOT A;  4Q3G A;  3VQ1 A;  2BEX A;  1XCD A;  5HDH A;  1OTM A;  3VQ2 A;  3W3J A;  4R6G A;  4AY9 X;  1OTN A;  4WP6 A;  3E6J A;  5AWB A;  1PGV A;  2Z62 A;  4KXF B;  4Z61 C;  4V2E A;  2R9U A;  1ZIW A;  4YEB B;  2OMX A;  1O6T A;  4M7E C;  4CNC A;  4OQT A;  3WPI A;  2WQX A;  5GMH A;  4M7E A;  4GLP A;  5HZL B;  4PQ8 A;  3M19 A;  3UL8 A;  2UZY A;  3UL9 A;  5IJD A;  4MQW X;  4AW4 A;  3OJA A;  3OGL B;  1YRG A;  4GT6 A;  1FS2 A;  2OMY A;  1WWL A;  2V70 A;  3BZ5 A;  3ULU A;  2CA6 A;  3RJ0 A;  3KJ4 A;  4G8A A;  3WPG A;  2Z7X B;  2OMW A;  2OMT A;  1M9L A;  1OGQ A;  2FT3 A;  3P72 A;  5GS2 B;  4R6A A;  4XGO A;  1P8V A;  2RA8 A;  4XSQ A;  3G39 A;  2WFH A;  2WQV A;  4FCG A;  3RFE A;  3CIY A;  2A0Z A;  1W8A A;  2V9T B;  3WPB A;  1Z7X W;  3JB9 j;  3ZYN A;  1O6V A;  4LXR A;  3G06 A;  3RW7 A;  3E4G A;  4PER A;  1XEU A;  1H6T A;  2O6Q A;  5LFN A;  4R5D A;  4TZH A;  2OMU A;  1K5D C;  4QXE A;  4Z79 A;  3WPE A;  4U08 A;  4LI2 A;  1KOO A;  4FS7 A;  5A5C A;  3O6N A;  3UN9 A;  4UFR A;  4NKG A;  4LSX C;  3W3L A;  1A4Y A;  4LSC A;  2P1P B;  1DS9 A;  1XEC A;  2UZX A;  1D0B A;  3OGK B;  1FT8 A;  4U06 A;  4EZG A;  2JQD A;  3ULA A;  3ZYO A;  1G9U A;  2Z7X A;  4Z94 G;  1P8T A;  2XWT C;  3ZYI A;  4R09 A;  4Q3I A;  2BNH A;  5IJB A;  5CMN A;  4LSA A;  4RCW A;  5GMG A;  3OJA B;  3W3G A;  1M0Z A;  2WQW A;  4V2D A;  3G3A A;  4KT1 A;  4LXS A;  4HQ1 A;  3M18 A;  1SQ0 B;  1M10 B;  2Z63 A;  3CVR A;  4KNG A;  4R6F A;  4FDW A;  4Z8G A;  2O6R A;  2Z66 A;  5CMP A;  3C6P B;  1M9S A;  3OGM B;  5GQR K;  4Z64 C;  2JE1 A;  2P1N B;  1OZN A;  2ASS B;  2AST B;  2JE0 A;  1DFJ I;  4R5C A;  4R07 A;  1XWD C;  5AWD A;  4K17 A;  3RFS A;  5AZ5 A;  3E3Z A;  4H09 A;  3G04 C;  3GOZ A;  4I6J B;  4B8C D;  4J4L A;  1OOK G;  4BSS A;  3WPF A;  4FD0 A;  2ID5 A;  3WPH A;  3C6N B;  4ARN A;  2OMZ A;  5FTT B;  3DZE A;  3WPD A;  2Z82 A;  1QYY A;  4ARR A;  2Z65 A;  4XOS A;  3W3M A;  1P9A G;  4CNM A;  5B0T A;  4PKI G;  3WN4 A;  5AWA A;  3REZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...