1FR2A

Crystal structure of the e9 dnase domain with a mutant immunity protein im9(e41a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFAEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E9 IMMUNITY PROTEIN
publication title CRYSTAL STRUCTURE OF THE E9 DNASE DOMAIN WITH A MUTANT IMMUNITY PROTEIN IM9(E41A)
rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1fr2A00
3U43A 1GXGA 2NO8A 1BXIA 2ERHA 1MZ8A 1IMQA 3GKLC 2WPTA 1FR2A 2K0DX 1ZNVA 2K5XA 2GZGA 1UNKA 2JBGA 3GJNA 1IMPA 5EW5E 4F37A 2VLOA 2GZIA 4UHPB 2VLQA 1UJZA 2GZJA 4QKOA 2JB0A 1GXHA 2GZFA 1E0HA 2VLNA 1AYIA 2VLPA 7CEIA 1CEIA 1EMVA 2JAZA 2GYKA 2GZEA
chains in the Genus database with same CATH superfamily
1ZMBA 2OTLP 2XZ0D 1VKUA 3VRLC 1IMQA 2K0XA 2KWLA 3H47A 2KOQA 5BS2A 3LRYA 3DPHA 2CG5B 2K5XA 2JO0A 3LMOA 2PEIA 2MD9A 1OR5A 2JGPA 4QKOA 3P05A 4XFYA 5HGOA 1VQ9P 4U0FA 2XZ1C 2OARA 1EMVA 3DTJA 2L4BA 1Q81Q 1A43A 2DNWA 3B5IA 5F2NA 4COPA 1W2BO 3WBHA 2CGQA 2N5IA 3GJNA 4F37A 2PNGA 1DNYA 3GZLA 1BAJA 1K73Q 2AFDA 1L0IA 1M6NA 2LPKA 3EJEA 1K8AQ 4U0BA 1VQ7P 2PEKA 2L0QA 2L9FA 5EJDA 3G4SP 3DS2A 2KR5A 4CA3A 3CC2P 2PENA 2MVVA 2XT1A 1YIJP 4BPHA 2Z44A 1VQOP 2AF8A 2FVEA 1RO0A 3G0VA 2MY5A 3OW2O 2GDWA 2GZGA 4MRTC 1QRJA 2M8LA 3G1GA 4BPFA 2LMLA 1YJ9P 1AYIA 7CEIA 2CQ8A 2GZEA 4XRQA 3U43A 1VQPP 1GXGA 1BXIA 1M90Q 2MF4A 1JJ2O 2K0DX 1Z6MA 1KLPA 3DS0A 2K0YA 2EIAA 2M8PA 4PXHB 4R0MA 1ACPA 2QNWA 3CCQP 2PEQA 1KC8Q 2JU2A 3G28A 2EFJA 2AVAA 3G71P 2Z45A 1IUQA 4H2XC 3GKLC 2AFEA 1VHNA 4BPGA 2MVUA 3DS4A 3CE7A 4COCA 2JU1A 2DGYA 1E0HA 2EHSA 2FQ1A 2PEOA 2KGCA 2N6YA 2FHSC 1QVGO 4XROA 5DCKA 4IZ6A 4GR2A 5KP7B 4PH1A 1Q7YQ 1YI2P 1N8RQ 3CMAP 2VSQA 4HKGA 2VLPA 2GDXA 1VQ5P 2LKIA 4H2YC 2LF4A 3NY7B 5I4TG 2N50A 1X3OA 2KW2A 5HGMA 2KOSA 2MR8A 2MR7A 2GZIA 1GPJA 2JB0A 3HZQA 2QEXP 4PH0A 4U0AA 2KOOA 2XXMA 2LIWA 1NQ4A 2JYGA 2M5RA 1Q82Q 2BHVA 1YHQP 1DV5A 4M0IA 4U0EA 2PEMA 2X2BA 2JQ4A 2BUOA 4PWVB 5HGNA 2KG9A 3G1IA 1VQ8P 2KG8A 1HQBA 2KG6A 2M8NA 2ERHA 2WPTA 2KGDA 2KODA 2N5HA 1T8KA 5HV8A 5F2KA 2KOPA 1KD1Q 3G26A 1A8OA 1VQKP 1UJZA 2KGEA 2FQ0A 2EHTA 3G29A 1GXHA 3DS3A 4NEOA 1AUMA 1F80D 3EJBA 3CC7P 5BS1A 1VQ4P 1NJIQ 3CCSP 2QA4P 2K94A 3CMEP 4UHPB 2FACA 1YJWP 5KP8B 3H0DA 3CC4P 2L22A 3EJDA 2CNRA 2LIUA 1VQNP 1VQLP 2NO8A 3CCUP 3CCLP 1FR2A 1VQMP 1M1KQ 2VLOA 2XV6A 2FQ2A 2KGAA 4U0CA 2GZFA 3M1MA 1CEIA 5CZDB 2FAEA 3MGEA 4IPYA 4H2WC 1HY8A 2LOLA 3HYBA 1YITP 3I56P 1D1DA 2E1MA 3H4EA 3RG6C 3CD6P 5HVCA 2K93A 1RO2A 2N6ZA 3CCMP 1EIAA 4QNBA 3CCJP 2FVFA 2GDYA 2ROQA 3I55P 3CCRP 2JYLA 3CCVP 3NTEA 2N98A 2K92A 1M6EX 1M74A 3CPWO 1RNIA 3CXCO 2L6EA 2Z46A 1YJNP 2FADA 1VQ6P 3RG2A 2JBGA 1IMPA 2FVAA 2K2QA 3Q20A 1AF8A 2VLQA 2GZJA 4WYMA 3DS1A 1S72P 5JPAA 4DG9A 1Q86Q 1MZ8A 2P9XA 3DS5A 3G6EP 3B4QA 1K30A 2ONTA 1K9MQ 2CWOA 2LTEA 2PEJA 2OTJP 2LL8A 5F2OA 3G21A 1KQSO 1UNKA 4XFZA 1E6JP 4U0DA 4GR6A 2KORA 3CCEP 2EG5A 1ZNVA 3GZMA 1L0HA 1QVFO 5EW5E 5KP6B 3E2DA 5HGLA 1EOQA 2VLNA 4XFXA 2JAZA 2GYKA 2PY8A
chains in the Genus database with same CATH topology
3U43A 1GXGA 2NO8A 1BXIA 2ERHA 1MZ8A 1IMQA 3GKLC 2WPTA 1FR2A 2K0DX 1ZNVA 2K5XA 2GZGA 1UNKA 2JBGA 3GJNA 1IMPA 5EW5E 4F37A 2VLOA 2GZIA 4UHPB 2VLQA 1UJZA 2GZJA 4QKOA 2JB0A 1GXHA 2GZFA 1E0HA 2VLNA 1AYIA 2VLPA 7CEIA 1CEIA 1EMVA 2JAZA 2GYKA 2GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  1GXG A;  2NO8 A;  1BXI A;  2ERH A;  1MZ8 A;  1IMQ A;  3GKL C;  2WPT A;  1FR2 A;  2K0D X;  1ZNV A;  2K5X A;  2GZG A;  1UNK A;  2JBG A;  3GJN A;  1IMP A;  5EW5 E;  4F37 A;  2VLO A;  2GZI A;  4UHP B;  2VLQ A;  1UJZ A;  2GZJ A;  4QKO A;  2JB0 A;  1GXH A;  2GZF A;  1E0H A;  2VLN A;  1AYI A;  2VLP A;  7CEI A;  1CEI A;  1EMV A;  2JAZ A;  2GYK A;  2GZE A; 
#chains in the Genus database with same CATH topology
 1ZMB A;  2OTL P;  2XZ0 D;  1VKU A;  3VRL C;  1IMQ A;  2K0X A;  2KWL A;  3H47 A;  2KOQ A;  5BS2 A;  3LRY A;  3DPH A;  2CG5 B;  2K5X A;  2JO0 A;  3LMO A;  2PEI A;  2MD9 A;  1OR5 A;  2JGP A;  4QKO A;  3P05 A;  4XFY A;  5HGO A;  1VQ9 P;  4U0F A;  2XZ1 C;  2OAR A;  1EMV A;  3DTJ A;  2L4B A;  1Q81 Q;  1A43 A;  2DNW A;  3B5I A;  5F2N A;  4COP A;  1W2B O;  3WBH A;  2CGQ A;  2N5I A;  3GJN A;  4F37 A;  2PNG A;  1DNY A;  3GZL A;  1BAJ A;  1K73 Q;  2AFD A;  1L0I A;  1M6N A;  2LPK A;  3EJE A;  1K8A Q;  4U0B A;  1VQ7 P;  2PEK A;  2L0Q A;  2L9F A;  5EJD A;  3G4S P;  3DS2 A;  2KR5 A;  4CA3 A;  3CC2 P;  2PEN A;  2MVV A;  2XT1 A;  1YIJ P;  4BPH A;  2Z44 A;  1VQO P;  2AF8 A;  2FVE A;  1RO0 A;  3G0V A;  2MY5 A;  3OW2 O;  2GDW A;  2GZG A;  4MRT C;  1QRJ A;  2M8L A;  3G1G A;  4BPF A;  2LML A;  1YJ9 P;  1AYI A;  7CEI A;  2CQ8 A;  2GZE A;  4XRQ A;  3U43 A;  1VQP P;  1GXG A;  1BXI A;  1M90 Q;  2MF4 A;  1JJ2 O;  2K0D X;  1Z6M A;  1KLP A;  3DS0 A;  2K0Y A;  2EIA A;  2M8P A;  4PXH B;  4R0M A;  1ACP A;  2QNW A;  3CCQ P;  2PEQ A;  1KC8 Q;  2JU2 A;  3G28 A;  2EFJ A;  2AVA A;  3G71 P;  2Z45 A;  1IUQ A;  4H2X C;  3GKL C;  2AFE A;  1VHN A;  4BPG A;  2MVU A;  3DS4 A;  3CE7 A;  4COC A;  2JU1 A;  2DGY A;  1E0H A;  2EHS A;  2FQ1 A;  2PEO A;  2KGC A;  2N6Y A;  2FHS C;  1QVG O;  4XRO A;  5DCK A;  4IZ6 A;  4GR2 A;  5KP7 B;  4PH1 A;  1Q7Y Q;  1YI2 P;  1N8R Q;  3CMA P;  2VSQ A;  4HKG A;  2VLP A;  2GDX A;  1VQ5 P;  2LKI A;  4H2Y C;  2LF4 A;  3NY7 B;  5I4T G;  2N50 A;  1X3O A;  2KW2 A;  5HGM A;  2KOS A;  2MR8 A;  2MR7 A;  2GZI A;  1GPJ A;  2JB0 A;  3HZQ A;  2QEX P;  4PH0 A;  4U0A A;  2KOO A;  2XXM A;  2LIW A;  1NQ4 A;  2JYG A;  2M5R A;  1Q82 Q;  2BHV A;  1YHQ P;  1DV5 A;  4M0I A;  4U0E A;  2PEM A;  2X2B A;  2JQ4 A;  2BUO A;  4PWV B;  5HGN A;  2KG9 A;  3G1I A;  1VQ8 P;  2KG8 A;  1HQB A;  2KG6 A;  2M8N A;  2ERH A;  2WPT A;  2KGD A;  2KOD A;  2N5H A;  1T8K A;  5HV8 A;  5F2K A;  2KOP A;  1KD1 Q;  3G26 A;  1A8O A;  1VQK P;  1UJZ A;  2KGE A;  2FQ0 A;  2EHT A;  3G29 A;  1GXH A;  3DS3 A;  4NEO A;  1AUM A;  1F80 D;  3EJB A;  3CC7 P;  5BS1 A;  1VQ4 P;  1NJI Q;  3CCS P;  2QA4 P;  2K94 A;  3CME P;  4UHP B;  2FAC A;  1YJW P;  5KP8 B;  3H0D A;  3CC4 P;  2L22 A;  3EJD A;  2CNR A;  2LIU A;  1VQN P;  1VQL P;  2NO8 A;  3CCU P;  3CCL P;  1FR2 A;  1VQM P;  1M1K Q;  2VLO A;  2XV6 A;  2FQ2 A;  2KGA A;  4U0C A;  2GZF A;  3M1M A;  1CEI A;  5CZD B;  2FAE A;  3MGE A;  4IPY A;  4H2W C;  1HY8 A;  2LOL A;  3HYB A;  1YIT P;  3I56 P;  1D1D A;  2E1M A;  3H4E A;  3RG6 C;  3CD6 P;  5HVC A;  2K93 A;  1RO2 A;  2N6Z A;  3CCM P;  1EIA A;  4QNB A;  3CCJ P;  2FVF A;  2GDY A;  2ROQ A;  3I55 P;  3CCR P;  2JYL A;  3CCV P;  3NTE A;  2N98 A;  2K92 A;  1M6E X;  1M74 A;  3CPW O;  1RNI A;  3CXC O;  2L6E A;  2Z46 A;  1YJN P;  2FAD A;  1VQ6 P;  3RG2 A;  2JBG A;  1IMP A;  2FVA A;  2K2Q A;  3Q20 A;  1AF8 A;  2VLQ A;  2GZJ A;  4WYM A;  3DS1 A;  1S72 P;  5JPA A;  4DG9 A;  1Q86 Q;  1MZ8 A;  2P9X A;  3DS5 A;  3G6E P;  3B4Q A;  1K30 A;  2ONT A;  1K9M Q;  2CWO A;  2LTE A;  2PEJ A;  2OTJ P;  2LL8 A;  5F2O A;  3G21 A;  1KQS O;  1UNK A;  4XFZ A;  1E6J P;  4U0D A;  4GR6 A;  2KOR A;  3CCE P;  2EG5 A;  1ZNV A;  3GZM A;  1L0H A;  1QVF O;  5EW5 E;  5KP6 B;  3E2D A;  5HGL A;  1EOQ A;  2VLN A;  4XFX A;  2JAZ A;  2GYK A;  2PY8 A; 
#chains in the Genus database with same CATH homology
 3U43 A;  1GXG A;  2NO8 A;  1BXI A;  2ERH A;  1MZ8 A;  1IMQ A;  3GKL C;  2WPT A;  1FR2 A;  2K0D X;  1ZNV A;  2K5X A;  2GZG A;  1UNK A;  2JBG A;  3GJN A;  1IMP A;  5EW5 E;  4F37 A;  2VLO A;  2GZI A;  4UHP B;  2VLQ A;  1UJZ A;  2GZJ A;  4QKO A;  2JB0 A;  1GXH A;  2GZF A;  1E0H A;  2VLN A;  1AYI A;  2VLP A;  7CEI A;  1CEI A;  1EMV A;  2JAZ A;  2GYK A;  2GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...