1FR2A

Crystal structure of the e9 dnase domain with a mutant immunity protein im9(e41a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFAEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE E9 DNASE DOMAIN WITH A MUTANT IMMUNITY PROTEIN IM9(E41A)
rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords COLICIN E9 IMMUNITY PROTEIN
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1fr2A00
1GXGA 1EMVA 1GXHA 2K5XA 2GZFA 4UHPB 1E0HA 1MZ8A 2JBGA 2GZIA 2VLPA 5EW5E 2VLQA 1ZNVA 1UNKA 1CEIA 4F37A 2ERHA 2VLNA 2K0DX 2GZJA 7CEIA 1UJZA 1IMQA 1BXIA 3U43A 2JB0A 2GZGA 2GYKA 2NO8A 2VLOA 2WPTA 3GJNA 2GZEA 2JAZA 3GKLC 1AYIA 1IMPA 4QKOA 1FR2A
chains in the Genus database with same CATH superfamily
1Q81Q 1L0IA 3H0DA 3I55P 1Q7YQ 1VQ6P 3DS4A 5EW5E 2KOQA 2PEQA 4PWVB 1VQ4P 2CQ8A 1VQ5P 4H2YC 2K2QA 5F2NA 2PY8A 1L0HA 4PH0A 2MY5A 4U0FA 5HV8A 2GDYA 2FQ1A 1YJ9P 2MR8A 3GKLC 3NTEA 1GXGA 1IUQA 2K94A 4H2WC 1MZ8A 4WYMA 3CXCO 4R0MA 2L9FA 3DS0A 3H47A 2KOSA 2GDWA 4U0BA 1YJNP 2CG5B 2CWOA 1JJ2O 1IMQA 2NO8A 2JAZA 4IPYA 2L0QA 2L6EA 1IMPA 1NQ4A 2LIUA 4UHPB 5BS1A 2GZIA 1KQSO 1Z6MA 1T8KA 3CMAP 2M8LA 5HGOA 3CC4P 2EFJA 1Q86Q 5JPAA 1M1KQ 1YI2P 2GZJA 2K0YA 3DPHA 2BHVA 2DGYA 1DV5A 1RO2A 4COCA 3CMEP 3EJDA 3G21A 2JBGA 3GZMA 2X2BA 5F2OA 1W2BO 2N5IA 4XFZA 2PEJA 1Q82Q 4H2XC 2VLOA 3G28A 2MF4A 1YIJP 4QKOA 2KGCA 3G71P 3CC2P 2GZFA 2FVEA 5CZDB 1ZMBA 3CPWO 2Z46A 4U0AA 2KGAA 2LL8A 2CNRA 3HYBA 1KLPA 1VQPP 3OW2O 2EG5A 1VQMP 5HGLA 3RG6C 2XT1A 1M90Q 1KC8Q 2KR5A 1UNKA 5EJDA 2N6YA 2QA4P 2VLNA 2JYLA 1F80D 4XROA 2FADA 5I4TG 2FACA 2EHTA 2ONTA 3G1GA 2M5RA 5HVCA 1RO0A 2JU1A 1QVGO 2JO0A 2KW2A 3CCVP 2OARA 2XV6A 1E6JP 3G0VA 1QRJA 3DS1A 3G4SP 3P05A 1K73Q 2E1MA 2FAEA 2EHSA 1EIAA 1M74A 1AF8A 1GXHA 3G29A 3LMOA 2KGEA 1VQ7P 3G1IA 2PEMA 1DNYA 2M8PA 2LOLA 1X3OA 1CEIA 3M1MA 1VQKP 3DTJA 2KGDA 2L22A 3I56P 1ACPA 2L4BA 1EOQA 2AVAA 2M8NA 2KG6A 4GR2A 3E2DA 2GYKA 2JQ4A 3RG2A 1VQOP 2CGQA 1YHQP 4QNBA 4U0CA 1HY8A 2MD9A 1NJIQ 4CA3A 2MVVA 3CD6P 1S72P 2N98A 2FVAA 3CCQP 2XXMA 1VKUA 3CCLP 2QEXP 2PNGA 3CCJP 4F37A 5KP6B 5KP8B 2LF4A 3CCMP 3B4QA 3WBHA 2AFDA 2FHSC 2N50A 3Q20A 2ROQA 4MRTC 3B5IA 2KG8A 4NEOA 2FVFA 2KOPA 1BAJA 1ZNVA 2GDXA 1GPJA 2K93A 2JU2A 1A8OA 1VQ9P 4XFYA 2JB0A 2WPTA 3GJNA 2KWLA 1HQBA 2LIWA 4M0IA 1VQLP 1OR5A 2LMLA 2K92A 2JGPA 1VQNP 1K9MQ 3DS5A 3G6EP 3CCUP 2P9XA 1UJZA 3CCRP 3CCEP 2Z45A 2DNWA 4BPHA 1N8RQ 4BPFA 2N5HA 2K5XA 1RNIA 1YJWP 4COPA 4XRQA 2PEKA 2VLPA 2PEOA 3MGEA 2MVUA 1K30A 2PEIA 2AF8A 2JYGA 3DS3A 4U0DA 3DS2A 1KD1Q 5HGMA 2KG9A 2PENA 2Z44A 1QVFO 2XZ1C 1EMVA 1E0HA 4DG9A 5BS2A 5KP7B 2FQ0A 5DCKA 2K0DX 3VRLC 4PXHB 2OTLP 3U43A 1BXIA 2LKIA 5HGNA 1AYIA 1A43A 4GR6A 3G26A 1YITP 3NY7B 1M6EX 2AFEA 4PH1A 2XZ0D 1M6NA 2VLQA 3LRYA 1K8AQ 2ERHA 2N6ZA 3CC7P 3CCSP 7CEIA 4BPGA 2QNWA 4HKGA 5F2KA 4XFXA 2GZEA 3EJEA 2KORA 2KODA 1AUMA 1FR2A 2OTJP 3EJBA 2FQ2A 2KOOA 1VHNA 2LPKA 2MR7A 1D1DA 2VSQA 1VQ8P 3H4EA 2EIAA 3CE7A 2BUOA 4U0EA 2GZGA 4IZ6A 3HZQA 2K0XA 3GZLA 2LTEA
chains in the Genus database with same CATH topology
1GXGA 1EMVA 1GXHA 2K5XA 2GZFA 4UHPB 1E0HA 1MZ8A 2JBGA 2GZIA 2VLPA 5EW5E 2VLQA 1ZNVA 1UNKA 1CEIA 4F37A 2ERHA 2VLNA 2K0DX 2GZJA 7CEIA 1UJZA 1IMQA 1BXIA 3U43A 2JB0A 2GZGA 2GYKA 2NO8A 2VLOA 2WPTA 3GJNA 2GZEA 2JAZA 3GKLC 1AYIA 1IMPA 4QKOA 1FR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXG A;  1EMV A;  1GXH A;  2K5X A;  2GZF A;  4UHP B;  1E0H A;  1MZ8 A;  2JBG A;  2GZI A;  2VLP A;  5EW5 E;  2VLQ A;  1ZNV A;  1UNK A;  1CEI A;  4F37 A;  2ERH A;  2VLN A;  2K0D X;  2GZJ A;  7CEI A;  1UJZ A;  1IMQ A;  1BXI A;  3U43 A;  2JB0 A;  2GZG A;  2GYK A;  2NO8 A;  2VLO A;  2WPT A;  3GJN A;  2GZE A;  2JAZ A;  3GKL C;  1AYI A;  1IMP A;  4QKO A;  1FR2 A; 
#chains in the Genus database with same CATH topology
 1Q81 Q;  1L0I A;  3H0D A;  3I55 P;  1Q7Y Q;  1VQ6 P;  3DS4 A;  5EW5 E;  2KOQ A;  2PEQ A;  4PWV B;  1VQ4 P;  2CQ8 A;  1VQ5 P;  4H2Y C;  2K2Q A;  5F2N A;  2PY8 A;  1L0H A;  4PH0 A;  2MY5 A;  4U0F A;  5HV8 A;  2GDY A;  2FQ1 A;  1YJ9 P;  2MR8 A;  3GKL C;  3NTE A;  1GXG A;  1IUQ A;  2K94 A;  4H2W C;  1MZ8 A;  4WYM A;  3CXC O;  4R0M A;  2L9F A;  3DS0 A;  3H47 A;  2KOS A;  2GDW A;  4U0B A;  1YJN P;  2CG5 B;  2CWO A;  1JJ2 O;  1IMQ A;  2NO8 A;  2JAZ A;  4IPY A;  2L0Q A;  2L6E A;  1IMP A;  1NQ4 A;  2LIU A;  4UHP B;  5BS1 A;  2GZI A;  1KQS O;  1Z6M A;  1T8K A;  3CMA P;  2M8L A;  5HGO A;  3CC4 P;  2EFJ A;  1Q86 Q;  5JPA A;  1M1K Q;  1YI2 P;  2GZJ A;  2K0Y A;  3DPH A;  2BHV A;  2DGY A;  1DV5 A;  1RO2 A;  4COC A;  3CME P;  3EJD A;  3G21 A;  2JBG A;  3GZM A;  2X2B A;  5F2O A;  1W2B O;  2N5I A;  4XFZ A;  2PEJ A;  1Q82 Q;  4H2X C;  2VLO A;  3G28 A;  2MF4 A;  1YIJ P;  4QKO A;  2KGC A;  3G71 P;  3CC2 P;  2GZF A;  2FVE A;  5CZD B;  1ZMB A;  3CPW O;  2Z46 A;  4U0A A;  2KGA A;  2LL8 A;  2CNR A;  3HYB A;  1KLP A;  1VQP P;  3OW2 O;  2EG5 A;  1VQM P;  5HGL A;  3RG6 C;  2XT1 A;  1M90 Q;  1KC8 Q;  2KR5 A;  1UNK A;  5EJD A;  2N6Y A;  2QA4 P;  2VLN A;  2JYL A;  1F80 D;  4XRO A;  2FAD A;  5I4T G;  2FAC A;  2EHT A;  2ONT A;  3G1G A;  2M5R A;  5HVC A;  1RO0 A;  2JU1 A;  1QVG O;  2JO0 A;  2KW2 A;  3CCV P;  2OAR A;  2XV6 A;  1E6J P;  3G0V A;  1QRJ A;  3DS1 A;  3G4S P;  3P05 A;  1K73 Q;  2E1M A;  2FAE A;  2EHS A;  1EIA A;  1M74 A;  1AF8 A;  1GXH A;  3G29 A;  3LMO A;  2KGE A;  1VQ7 P;  3G1I A;  2PEM A;  1DNY A;  2M8P A;  2LOL A;  1X3O A;  1CEI A;  3M1M A;  1VQK P;  3DTJ A;  2KGD A;  2L22 A;  3I56 P;  1ACP A;  2L4B A;  1EOQ A;  2AVA A;  2M8N A;  2KG6 A;  4GR2 A;  3E2D A;  2GYK A;  2JQ4 A;  3RG2 A;  1VQO P;  2CGQ A;  1YHQ P;  4QNB A;  4U0C A;  1HY8 A;  2MD9 A;  1NJI Q;  4CA3 A;  2MVV A;  3CD6 P;  1S72 P;  2N98 A;  2FVA A;  3CCQ P;  2XXM A;  1VKU A;  3CCL P;  2QEX P;  2PNG A;  3CCJ P;  4F37 A;  5KP6 B;  5KP8 B;  2LF4 A;  3CCM P;  3B4Q A;  3WBH A;  2AFD A;  2FHS C;  2N50 A;  3Q20 A;  2ROQ A;  4MRT C;  3B5I A;  2KG8 A;  4NEO A;  2FVF A;  2KOP A;  1BAJ A;  1ZNV A;  2GDX A;  1GPJ A;  2K93 A;  2JU2 A;  1A8O A;  1VQ9 P;  4XFY A;  2JB0 A;  2WPT A;  3GJN A;  2KWL A;  1HQB A;  2LIW A;  4M0I A;  1VQL P;  1OR5 A;  2LML A;  2K92 A;  2JGP A;  1VQN P;  1K9M Q;  3DS5 A;  3G6E P;  3CCU P;  2P9X A;  1UJZ A;  3CCR P;  3CCE P;  2Z45 A;  2DNW A;  4BPH A;  1N8R Q;  4BPF A;  2N5H A;  2K5X A;  1RNI A;  1YJW P;  4COP A;  4XRQ A;  2PEK A;  2VLP A;  2PEO A;  3MGE A;  2MVU A;  1K30 A;  2PEI A;  2AF8 A;  2JYG A;  3DS3 A;  4U0D A;  3DS2 A;  1KD1 Q;  5HGM A;  2KG9 A;  2PEN A;  2Z44 A;  1QVF O;  2XZ1 C;  1EMV A;  1E0H A;  4DG9 A;  5BS2 A;  5KP7 B;  2FQ0 A;  5DCK A;  2K0D X;  3VRL C;  4PXH B;  2OTL P;  3U43 A;  1BXI A;  2LKI A;  5HGN A;  1AYI A;  1A43 A;  4GR6 A;  3G26 A;  1YIT P;  3NY7 B;  1M6E X;  2AFE A;  4PH1 A;  2XZ0 D;  1M6N A;  2VLQ A;  3LRY A;  1K8A Q;  2ERH A;  2N6Z A;  3CC7 P;  3CCS P;  7CEI A;  4BPG A;  2QNW A;  4HKG A;  5F2K A;  4XFX A;  2GZE A;  3EJE A;  2KOR A;  2KOD A;  1AUM A;  1FR2 A;  2OTJ P;  3EJB A;  2FQ2 A;  2KOO A;  1VHN A;  2LPK A;  2MR7 A;  1D1D A;  2VSQ A;  1VQ8 P;  3H4E A;  2EIA A;  3CE7 A;  2BUO A;  4U0E A;  2GZG A;  4IZ6 A;  3HZQ A;  2K0X A;  3GZL A;  2LTE A; 
#chains in the Genus database with same CATH homology
 1GXG A;  1EMV A;  1GXH A;  2K5X A;  2GZF A;  4UHP B;  1E0H A;  1MZ8 A;  2JBG A;  2GZI A;  2VLP A;  5EW5 E;  2VLQ A;  1ZNV A;  1UNK A;  1CEI A;  4F37 A;  2ERH A;  2VLN A;  2K0D X;  2GZJ A;  7CEI A;  1UJZ A;  1IMQ A;  1BXI A;  3U43 A;  2JB0 A;  2GZG A;  2GYK A;  2NO8 A;  2VLO A;  2WPT A;  3GJN A;  2GZE A;  2JAZ A;  3GKL C;  1AYI A;  1IMP A;  4QKO A;  1FR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...