1FR2A

Crystal structure of the e9 dnase domain with a mutant immunity protein im9(e41a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFAEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF THE E9 DNASE DOMAIN WITH A MUTANT IMMUNITY PROTEIN IM9(E41A)
rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords COLICIN E9 IMMUNITY PROTEIN
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1fr2A00
1FR2A 5EW5E 2K0DX 1GXGA 1EMVA 2GZIA 2GZEA 2WPTA 2GZJA 2JAZA 1MZ8A 2VLOA 2VLNA 2ERHA 1IMQA 1GXHA 2JB0A 4F37A 2JBGA 2GZFA 4UHPB 1IMPA 2VLQA 1BXIA 1CEIA 1AYIA 2GYKA 1UJZA 2NO8A 1UNKA 2VLPA 3U43A 2K5XA 4QKOA 7CEIA 2GZGA 3GKLC 3GJNA 1E0HA 1ZNVA
chains in the Genus database with same CATH superfamily
2KOSA 1ACPA 2LF4A 2GZEA 1VHNA 3I55P 4BPHA 2VLOA 1QVGO 4XRQA 2JYGA 2N6ZA 4HKGA 3OW2O 4COPA 1UJZA 2VLPA 1YHQP 3LMOA 2M5RA 2LTEA 2PEOA 3WBHA 1GXGA 2KR5A 2MY5A 4XFYA 3EJBA 3EJDA 4GR6A 5HGOA 2L9FA 5DCKA 2GDWA 2KGCA 1ZNVA 3NTEA 2AVAA 1Q81Q 4U0FA 2VLNA 2LIWA 3E2DA 1M74A 2PEKA 2E1MA 1VQ7P 3G0VA 3CC4P 5BS2A 2K5XA 5EJDA 1D1DA 3G1IA 2AFEA 4H2YC 3CCMP 4CA3A 2GZFA 2CG5B 1BXIA 3H0DA 3HZQA 1CEIA 1AYIA 1JJ2O 2M8LA 2FADA 2EIAA 1HQBA 1QVFO 1DNYA 1YIJP 1W2BO 1RO0A 2KOPA 1X3OA 1S72P 1YI2P 1IMQA 2BHVA 2MVUA 2PEQA 4U0DA 1VQMP 3CC2P 1EIAA 3CC7P 1VQ5P 3CCVP 5I4TG 2GYKA 2QNWA 3G4SP 2KGDA 4QNBA 1K73Q 2CQ8A 7CEIA 4GR2A 1FR2A 5EW5E 2JGPA 2KGAA 5HGLA 4H2WC 1VQ8P 1QRJA 2ROQA 5KP8B 2CNRA 1Q7YQ 2FQ2A 3G29A 1M6EX 1T8KA 2FQ0A 2EFJA 2MR8A 2DGYA 2LPKA 3DPHA 2KODA 4XFXA 2EHSA 2LL8A 2K92A 1YJWP 1YJNP 1L0IA 3DS1A 3CE7A 2PEIA 1GXHA 2JB0A 2K0YA 5KP7B 2KOQA 2L22A 3I56P 4QKOA 3HYBA 3RG6C 5HGMA 1DV5A 3MGEA 3RG2A 3H47A 2PY8A 1BAJA 2GDYA 2JQ4A 2GZJA 1HY8A 4U0CA 3LRYA 2XT1A 1E6JP 2N50A 2EG5A 2L4BA 2Z46A 3P05A 1GPJA 2N5IA 4PH1A 3CMAP 2BUOA 2OTJP 4PWVB 2FQ1A 2FAEA 2GZIA 2WPTA 4U0AA 2JAZA 1K9MQ 2OARA 4XFZA 2MF4A 3M1MA 1IMPA 3GZMA 1VQ6P 3CCRP 2AF8A 1IUQA 1VQKP 2PEJA 3B4QA 4BPGA 5HV8A 1UNKA 2ONTA 5KP6B 2GZGA 1K30A 3CXCO 2L6EA 1OR5A 2LIUA 1KQSO 3G21A 1RO2A 2VLQA 2Z44A 2XV6A 4R0MA 2QA4P 1VQ9P 2JU1A 2VSQA 3H4EA 1RNIA 2XXMA 3G6EP 2EHTA 2FACA 2M8PA 1E0HA 2LKIA 4PXHB 3G28A 4WYMA 1L0HA 4DG9A 1A43A 2DNWA 3CCSP 2Z45A 4F37A 3DS4A 2MR7A 1VQLP 2JBGA 2JYLA 4M0IA 1NJIQ 3CCUP 1KC8Q 3CD6P 3GZLA 2X2BA 2CWOA 2KORA 5JPAA 4MRTC 1Q82Q 1EMVA 2KG9A 4IPYA 2XZ1C 3NY7B 2XZ0D 3EJEA 2KWLA 5HVCA 3G1GA 4U0BA 4PH0A 4UHPB 2LMLA 4COCA 3DS2A 2L0QA 4BPFA 2NO8A 5F2NA 2GDXA 2JO0A 2KGEA 1VQOP 2KG8A 2KG6A 2K0DX 1YITP 2K94A 4U0EA 2ERHA 5HGNA 1M6NA 1Z6MA 3CPWO 1M1KQ 2JU2A 2M8NA 4H2XC 2LOLA 2QEXP 1A8OA 2N98A 2KOOA 2OTLP 4IZ6A 1N8RQ 3CCJP 3CCLP 2PNGA 3GKLC 5BS1A 2CGQA 2P9XA 2N5HA 3Q20A 1Q86Q 1F80D 1K8AQ 3DS3A 1AF8A 1KD1Q 1AUMA 2PEMA 1YJ9P 5F2KA 3U43A 1VKUA 1NQ4A 1ZMBA 2MVVA 1VQPP 2K0XA 2FHSC 3DS0A 4NEOA 2AFDA 1M90Q 3B5IA 2PENA 1VQNP 5CZDB 1KLPA 1VQ4P 5F2OA 3G26A 3GJNA 4XROA 1EOQA 3G71P 2K93A 1MZ8A 3DTJA 3CCEP 2K2QA 2N6YA 3CMEP 2MD9A 2FVEA 2KW2A 2FVFA 3CCQP 3VRLC 3DS5A 2FVAA
chains in the Genus database with same CATH topology
1FR2A 5EW5E 2K0DX 1GXGA 1EMVA 2GZIA 2GZEA 2WPTA 2GZJA 2JAZA 1MZ8A 2VLOA 2VLNA 2ERHA 1IMQA 1GXHA 2JB0A 4F37A 2JBGA 2GZFA 4UHPB 1IMPA 2VLQA 1BXIA 1CEIA 1AYIA 2GYKA 1UJZA 2NO8A 1UNKA 2VLPA 3U43A 2K5XA 4QKOA 7CEIA 2GZGA 3GKLC 3GJNA 1E0HA 1ZNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR2 A;  5EW5 E;  2K0D X;  1GXG A;  1EMV A;  2GZI A;  2GZE A;  2WPT A;  2GZJ A;  2JAZ A;  1MZ8 A;  2VLO A;  2VLN A;  2ERH A;  1IMQ A;  1GXH A;  2JB0 A;  4F37 A;  2JBG A;  2GZF A;  4UHP B;  1IMP A;  2VLQ A;  1BXI A;  1CEI A;  1AYI A;  2GYK A;  1UJZ A;  2NO8 A;  1UNK A;  2VLP A;  3U43 A;  2K5X A;  4QKO A;  7CEI A;  2GZG A;  3GKL C;  3GJN A;  1E0H A;  1ZNV A; 
#chains in the Genus database with same CATH topology
 2KOS A;  1ACP A;  2LF4 A;  2GZE A;  1VHN A;  3I55 P;  4BPH A;  2VLO A;  1QVG O;  4XRQ A;  2JYG A;  2N6Z A;  4HKG A;  3OW2 O;  4COP A;  1UJZ A;  2VLP A;  1YHQ P;  3LMO A;  2M5R A;  2LTE A;  2PEO A;  3WBH A;  1GXG A;  2KR5 A;  2MY5 A;  4XFY A;  3EJB A;  3EJD A;  4GR6 A;  5HGO A;  2L9F A;  5DCK A;  2GDW A;  2KGC A;  1ZNV A;  3NTE A;  2AVA A;  1Q81 Q;  4U0F A;  2VLN A;  2LIW A;  3E2D A;  1M74 A;  2PEK A;  2E1M A;  1VQ7 P;  3G0V A;  3CC4 P;  5BS2 A;  2K5X A;  5EJD A;  1D1D A;  3G1I A;  2AFE A;  4H2Y C;  3CCM P;  4CA3 A;  2GZF A;  2CG5 B;  1BXI A;  3H0D A;  3HZQ A;  1CEI A;  1AYI A;  1JJ2 O;  2M8L A;  2FAD A;  2EIA A;  1HQB A;  1QVF O;  1DNY A;  1YIJ P;  1W2B O;  1RO0 A;  2KOP A;  1X3O A;  1S72 P;  1YI2 P;  1IMQ A;  2BHV A;  2MVU A;  2PEQ A;  4U0D A;  1VQM P;  3CC2 P;  1EIA A;  3CC7 P;  1VQ5 P;  3CCV P;  5I4T G;  2GYK A;  2QNW A;  3G4S P;  2KGD A;  4QNB A;  1K73 Q;  2CQ8 A;  7CEI A;  4GR2 A;  1FR2 A;  5EW5 E;  2JGP A;  2KGA A;  5HGL A;  4H2W C;  1VQ8 P;  1QRJ A;  2ROQ A;  5KP8 B;  2CNR A;  1Q7Y Q;  2FQ2 A;  3G29 A;  1M6E X;  1T8K A;  2FQ0 A;  2EFJ A;  2MR8 A;  2DGY A;  2LPK A;  3DPH A;  2KOD A;  4XFX A;  2EHS A;  2LL8 A;  2K92 A;  1YJW P;  1YJN P;  1L0I A;  3DS1 A;  3CE7 A;  2PEI A;  1GXH A;  2JB0 A;  2K0Y A;  5KP7 B;  2KOQ A;  2L22 A;  3I56 P;  4QKO A;  3HYB A;  3RG6 C;  5HGM A;  1DV5 A;  3MGE A;  3RG2 A;  3H47 A;  2PY8 A;  1BAJ A;  2GDY A;  2JQ4 A;  2GZJ A;  1HY8 A;  4U0C A;  3LRY A;  2XT1 A;  1E6J P;  2N50 A;  2EG5 A;  2L4B A;  2Z46 A;  3P05 A;  1GPJ A;  2N5I A;  4PH1 A;  3CMA P;  2BUO A;  2OTJ P;  4PWV B;  2FQ1 A;  2FAE A;  2GZI A;  2WPT A;  4U0A A;  2JAZ A;  1K9M Q;  2OAR A;  4XFZ A;  2MF4 A;  3M1M A;  1IMP A;  3GZM A;  1VQ6 P;  3CCR P;  2AF8 A;  1IUQ A;  1VQK P;  2PEJ A;  3B4Q A;  4BPG A;  5HV8 A;  1UNK A;  2ONT A;  5KP6 B;  2GZG A;  1K30 A;  3CXC O;  2L6E A;  1OR5 A;  2LIU A;  1KQS O;  3G21 A;  1RO2 A;  2VLQ A;  2Z44 A;  2XV6 A;  4R0M A;  2QA4 P;  1VQ9 P;  2JU1 A;  2VSQ A;  3H4E A;  1RNI A;  2XXM A;  3G6E P;  2EHT A;  2FAC A;  2M8P A;  1E0H A;  2LKI A;  4PXH B;  3G28 A;  4WYM A;  1L0H A;  4DG9 A;  1A43 A;  2DNW A;  3CCS P;  2Z45 A;  4F37 A;  3DS4 A;  2MR7 A;  1VQL P;  2JBG A;  2JYL A;  4M0I A;  1NJI Q;  3CCU P;  1KC8 Q;  3CD6 P;  3GZL A;  2X2B A;  2CWO A;  2KOR A;  5JPA A;  4MRT C;  1Q82 Q;  1EMV A;  2KG9 A;  4IPY A;  2XZ1 C;  3NY7 B;  2XZ0 D;  3EJE A;  2KWL A;  5HVC A;  3G1G A;  4U0B A;  4PH0 A;  4UHP B;  2LML A;  4COC A;  3DS2 A;  2L0Q A;  4BPF A;  2NO8 A;  5F2N A;  2GDX A;  2JO0 A;  2KGE A;  1VQO P;  2KG8 A;  2KG6 A;  2K0D X;  1YIT P;  2K94 A;  4U0E A;  2ERH A;  5HGN A;  1M6N A;  1Z6M A;  3CPW O;  1M1K Q;  2JU2 A;  2M8N A;  4H2X C;  2LOL A;  2QEX P;  1A8O A;  2N98 A;  2KOO A;  2OTL P;  4IZ6 A;  1N8R Q;  3CCJ P;  3CCL P;  2PNG A;  3GKL C;  5BS1 A;  2CGQ A;  2P9X A;  2N5H A;  3Q20 A;  1Q86 Q;  1F80 D;  1K8A Q;  3DS3 A;  1AF8 A;  1KD1 Q;  1AUM A;  2PEM A;  1YJ9 P;  5F2K A;  3U43 A;  1VKU A;  1NQ4 A;  1ZMB A;  2MVV A;  1VQP P;  2K0X A;  2FHS C;  3DS0 A;  4NEO A;  2AFD A;  1M90 Q;  3B5I A;  2PEN A;  1VQN P;  5CZD B;  1KLP A;  1VQ4 P;  5F2O A;  3G26 A;  3GJN A;  4XRO A;  1EOQ A;  3G71 P;  2K93 A;  1MZ8 A;  3DTJ A;  3CCE P;  2K2Q A;  2N6Y A;  3CME P;  2MD9 A;  2FVE A;  2KW2 A;  2FVF A;  3CCQ P;  3VRL C;  3DS5 A;  2FVA A; 
#chains in the Genus database with same CATH homology
 1FR2 A;  5EW5 E;  2K0D X;  1GXG A;  1EMV A;  2GZI A;  2GZE A;  2WPT A;  2GZJ A;  2JAZ A;  1MZ8 A;  2VLO A;  2VLN A;  2ERH A;  1IMQ A;  1GXH A;  2JB0 A;  4F37 A;  2JBG A;  2GZF A;  4UHP B;  1IMP A;  2VLQ A;  1BXI A;  1CEI A;  1AYI A;  2GYK A;  1UJZ A;  2NO8 A;  1UNK A;  2VLP A;  3U43 A;  2K5X A;  4QKO A;  7CEI A;  2GZG A;  3GKL C;  3GJN A;  1E0H A;  1ZNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...