1FRGH

Crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
220
structure length
220
Chain Sequence
EVLLVESGGDLVKPGGFLKLSCAASGFTFSSFGMSWVRHTPDKRLEWVATISNGGGYTYYQDSVKGRFTISRDNAKNTLFLEMTSLKSEDAGLYYCARRERYDEKGFAYWGRGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a peptide complex of anti-influenza peptide antibody Fab 26/9. Comparison of two different antibodies bound to the same peptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
molecule keywords IGG2A 26/9 FAB (LIGHT CHAIN)
total genus 48
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1frgH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1frgH01
3SBWC 4G6KL 4L8SB 3SGDI 4BZ1L 3UTTE 1GOFA 1UZ6F 4X0KB 4K8RL 1FYTA 3GBLA 5DLML 2HFTA 5I8OH 1GHFL 3X12B 5EC2A 4MA8L 1DQLH 5GRXG 5JQHC 4YK4B 1YEKL 4P4RB 1JPST 1G0DA 1NLDH 4U6YB 5BVJA 1DFBL 3L3IA 4L1DA 1TVDA 1QFWI 5EBWB 3WJJA 3S5LB 2DQGL 1Z0NA 5TDNB 2GJ6B 1V3KA 1A6UL 2H32H 3MYZA 2J8UF 2XA3A 2DN7A 5GGSB 3NIGF 4HS8L 2IC2A 4MB3A 1VEOA 3HRPA 4F7PB 5CEZE 3D25A 4E41E 2CRMA 1A6AB 2XNAA 3ARYA 1DQQB 1S7SA 5HGHB 2D7TH 4FQJL 5FYJH 5KSUB 1MAMH 1ULVA 3GHBL 4LPWA 5E9DD 4LLMA 4RAUB 2H6PA 3S98A 5D2NE 2MJWA 1CLYH 1JGLL 4KKLD 1NCCL 2OJEB 4WWKB 4JM2A 1E4XH 1GZPB 3VXTB 3RGVC 1LO2L 2EIDA 4CBPA 5CAYB 4I0PA 5D7LA 4I3SL 3G6JE 4HFUH 5DVOA 2OL3A 1SYVA 4LQFL 3VA6A 3HG1E 3B5HA 2IQAB 2P4AB 3CVHL 4YPJA 1QFOA 3LCYA 3KHQA 5HYJB 1CXHA 4UU9B 1CFQB 2AV1B 3MUGA 3IDIA 1OARL 1R3JA 4GAYA 1WCBA 3DETD 4R4BA 4JPVL 2YSSA 3P77B 1R3IH 3FJTA 3IJSA 4BKLA 4EVNB 3G9VA 1QHOA 3RWJB 3DJ9A 3CVIH 4WU7B 2WIIB 4Y5VC 4R0LB 1NCAH 3E3QC 1F4YH 3VRIA 5I1EL 3H9SB 3T04D 4NSKB 3L3DB 3JWOC 2BY0A 4D0CA 3FFDA 1U2CA 5IMOA 3PXHA 5AZ2L 1KJ3H 1BEYL 1CXIA 3DX8B 1WF5A 5D96C 3SDAD 3VFOB 2X1XR 4ODUA 3RKDD 5L6YL 3VXNA 9CGTA 1NC4A 2OXHA 1CFTB 4TSAL 1CD9B 4ODHH 1C5BL 1QVOA 4I48B 3HAEB 3OKNA 4OLUL 3BPCA 1EX0A 1HEZA 3I02B 3CXDL 1AFVH 3CSPA 4LLVA 4L8DA 2OYPA 3T8XB 2X89D 4YQXH 5DQJA 4ELKA 3QPXH 4FTVD 5I66B 4OT1L 3PP3H 2R15A 3TC9A 5EUOE 1IEBB 3C5ZA 1UM6L 4MXQC 3IU3A 3KLHD 3VFRA 1JPFB 5CP7B 3QDGB 4HIHB 4Y2OA 3RNQA 2ZG3A 2VSCA 5B39G 1EAPA 4K94L 3BRDA 4LGRB 2B1HH 1ADQL 1D6EA 3FRUB 2R1XB 4YHLL 1C1EH 2E6PA 3CDGB 4ZAKC 4F33B 1RZJC 2CR6A 3DROA 4BFGA 4B0MM 2YN5A 3RWHB 4XNMB 3JWOL 4ELME 3MCLL 1YEJH 4KRPC 3AXLB 5MEPA 3LD8B 1RIUL 2P24B 3OX8B 5MENA 3TA3D 1KUMA 5EORH 4GUPA 1NBVH 1XR9B 2EDFA 2RQ8A 1T3FB 3U1SH 4PG2C 3GMOA 2Z35A 4N8VB 1A3RH 5F7DA 3TLRA 1N5AB 2AEPL 2W0FA 1BIIA 5SWSA 2ATPB 1UWXK 1VKXB 3I9GL 5CBAB 4QGTA 1BJMA 1HNFA 1NCCH 2C3XA 5C7XH 3MR9B 4DZ8B 1E4KA 4BSVB 5F9DC 2WANA 3NN8B 3PP3K 4CL7A 3TF7C 2F8XC 1YEIH 5CKGA 4IDJH 2PCPB 4PV8B 5IJKA 4HJJH 4Q9QH 2KZ1B 4HT1L 3ZYOA 3QIBB 4YE4L 1OT1A 5K9KB 3C09B 3KJ4B 1MSPA 4GW5A 1MCWW 4OAWA 3N1FC 5CZVL 2W0KA 4OQTH 4RGNE 1K4DA 2B0SL 1T7ZA 5A2JH 4HG4K 5IT2H 2W0LA 3IS0X 4OLWL 4OQ1A 1ZLWK 2F54E 5E8OB 3DUUB 1JNLH 4X6DE 1MWAA 2XIDA 2AQ1A 1FL6A 4Y4HB 1ZVYA 3VFWB 1A9BA 4HLZH 4OTXL 1LO0L 3MBXL 5DWUL 1GIGL 4B5EA 1UG9A 2XWJA 2W9DH 1C16A 2DQEL 5KSAC 1TZGH 5I8KL 4P4KA 5F70A 4K8RH 1SJXA 2ITDA 1IGFH 3ARXA 4YXLL 5CMAA 4I18C 1LDSA 4G6KH 2HFFA 3TH2T 3PABA 1YQ2A 4P4KD 4YNYA 4ODXA 4GKOA 5BRZD 4IMLB 3QCVL 5FCSH 2X6MA 1ZHBA 3SDYH 1RUPL 3D0LB 2AQ3A 1OF2B 4LPYA 3G6DL 5HGGS 3KPMA 5AAWA 1Q1JL 3WJJC 5F1OB 2ADFL 5KSUA 5C08D 2PTVA 1WICA 1CWVA 4WI4A 3MCKB 3CMGA 3S9DB 4XMPH 3ARRA 3ZT7A 1IILE 3LQAH 4IOIA 1DANU 4NNYB 3L95A 4X98A 5FK9A 4FABH 2NY4C 3SCMB 1CXKA 5EU6A 1YMMD 2A73B 2I5YH 4LGPB 4P0DA 1MIEH 1GZPA 1YQVH 5DMJB 5TDOA 4NRYA 4PJAE 1NMAH 1XMWA 1S7TA 3FN0H 1JZ7A 4PJDB 3V0WH 4PLJC 4Y88A 2EYTA 4P48A 3S36L 2VITA 2AJVH 5JIHA 5GGTA 4OZ4B 4OZFB 4G5ZH 3GBML 3LOWA 1QBLH 3HRZB 3VXUD 3MUJA 1DN2A 5CEZL 3LKNB 4XWGL 5CEXA 2XNAB 1P69B 4JG1L 2H3NA 4EIZC 4CVUA 1IGJB 1W72L 1OPGH 3LQMA 1CDIA 3NFNB 3TBWA 4YJZL 3BQUB 2YMXL 3MFFB 4JFDB 2DMKA 5C0CA 3LRSB 1DFBH 5FGBC 1DBJH 1HINH 4F7EA 5J6HA 3SGKA 4JVWA 2RBLA 2XYCA 3D48R 3UDWA 1MCPH 2IWGA 4LU5H 1PQZA 5AYUL 3BESR 5IHLB 3MGTA 5T1LB 1JK8A 3TZVD 1NEZB 4GRWF 1RJLA 3P9MB 2WAHA 2W0PA 3B4NA 3FB6B 4HZLA 4RSVA 3ZT6A 3TVMB 5DYOB 2VO5A 3ZT5A 4PJ8D 3ZYJA 5E2VH 4I0CC 5C7XL 2ERJB 4HIIB 4LSRH 1I9EA 1U8IA 5GPRA 5EZIL 4HXAL 5IBLC 3VXQA 5B38A 3QG6B 1Q0YL 1DLFL 4D3CL 4GG8A 3CUPB 3EOAA 3UTPE 4V1DE 4AMKH 4YXKH 1YJDH 4I2XA 4AT6A 1FL3A 4UQ3A 1T66C 1XGYL 3MMEB 3KWWB 4HUKB 4KAQH 5DMGC 2X9YA 1QPXA 1JZ4A 4Z7VE 4DUXA 5GS2H 2HVJA 1GGTA 4WCYL 4EN3B 4M7JH 5DUMH 1LK3H 5BW7A 1LNUB 4JFED 1RULL 4ZS7H 2DQJH 4TNWK 4NJ9L 3KXFA 2R2BA 1NPUA 2ZSVB 3MLZL 2X05A 2OP4H 1C08A 3O3BA 1NC4B 2H26A 4MNQD 1BAFH 5TF1L 5JW4R 4C57C 4WWKC 5IFAL 3NPSB 5FYJU 4UV7H 4LVOB 4XCFH 5C0DB 3CU1A 3UJJL 4MJ4A 4B50A 2Y07H 4LLQA 5EIIA 1HQ4B 1NFIA 1F2XK 2Q1EA 3VFOA 2IG2H 4E41D 4MHHG 2HJKA 2Z35B 2E3VA 1RK1A 5IT2L 3C5ZB 1B0GA 1CFTA 4ZXBA 1ZANL 2HH0H 1M71B 5IMLB 4XC1L 5EDXA 1H3GA 3GMMB 5T1DH 3RGVD 3BP4B 3TYFA 3QQNA 5IB3B 1RMFL 2Q8AL 1AD9B 2X41A 3BN3B 1X3DA 3VI3F 5DJDB 4EI6A 4I0PD 4R4ND 1SJHA 4J3OC 1J0IA 3FN0L 5C0GB 5CJ8A 3WEXA 4PLKC 3OKLA 1JPGA 2NY1B 3RPIA 1BREA 5DRXB 1BM3L 3SE4A 1CGYA 3ZTNH 2CMRL 5BZDB 1ZSDB 4TUKH 1RUAL 4C56E 1UKTA 2I25N 4QRRA 4N1HB 4YFLI 4IRZL 2CDGA 5FHBH 4GRWH 2X4NB 2A9ML 1WCBB 5I1CL 1FPTH 1KLFA 3CX5K 1ZHNB 2A6DA 4LLWA 4QRRD 4QXTA 3T4AB 25C8H 1SVZA 4OCWL 2FDBP 2ORBH 2EYRA 5CSZA 5GSRA 4HXBL 4PREB 1QR4A 5HHME 1AE6H 4HH8A 2XWTA 4NNPL 4APQB 1NBZA 1MCSA 4JDZB 4X7TA 1MCNA 4YHIB 5MEOA 1EBPA 1HNGA 3QIBD 3VFGH 1T5WB 2AJ3B 2YHGA 4HUXB 5HYQB 4JHWL 4S1SL 5DMIH 1F02I 1LMKA 4LHUB 3OMZA 5IBLD 2GYSA 4PJBA 5C09A 1J10A 3B9KC 4WHCA 4XVSH 1ORSA 1LDPH 4ODUB 5T3XD 1OGAD 3CSGA 1T22B 4P23C 3I6KA 3KS0J 4P46A 2B2XH 3LKPB 4RBPK 3GO1L 1D5BB 5E2UH 3VXSB 2W9DL 5BV7L 3HB3D 3W5NA 1WTGT 4BH8A 3DGGA 4P9ML 1UGNA 3G9AB 3BISA 4G43A 3CCHB 3EYUL 3HMWL 2QEJA 3RDTA 5L8KB 1MFBL 3QUMA 3IDYB 4LLUB 2YPLE 5HPMB 3EGSA 3GSXB 1YC7A 5DK0A 3SGKC 2COQA 4L29B 1G6RL 2IFGA 3BN9C 4LCWA 1AD0B 4LGSB 3WO4C 4JY5L 3VCLA 3KPRB 4HGKC 5IEHA 3ZYZA 3GNMH 4JKMA 3DHMA 3D0LA 2D7PA 1A7QL 3CFBA 3RWEB 2Z4QA 2Q86A 3BPNB 4HK0B 3MGOA 4X4XA 5ITBL 4FQXC 2G5RA 2X70A 5DK2B 1XCTB 3X3GL 2LVCA 5DURD 4S2SA 1CGTA 3KYMB 3SKMA 1QO3B 3WBDA 1OTUC 4X9FA 4LCUA 2QL1A 4R8WH 1PFCA 3I85A 3TBSB 5JMRA 1EEZB 3V5KA 3QAZB 3WLBA 2P48B 4X5WA 3D85A 5D7LE 2MNUA 2DLFL 1SVCP 5GGVH 5TDPA 1FYTD 1XGQB 4U1JA 4DJMA 4KKCD 3K2UL 5DGRA 1MJ7H 5GRVL 2IGFL 3S88H 4P2QD 4KY1L 1CL7L 1BM3H 5KSAB 3A6OA 2NW2A 2CLVA 2A0LC 2EH7L 1EEQA 4Y16A 2WBKA 1MI5A 3CK0L 5AYUH 3UYRH 3EJYC 3IFPB 2YPLA 3QEQA 4F2MB 4U1IA 4J3UA 4IRJD 2PYED 4PJIA 4HGMA 5BO1L 1EK3A 1H5BC 3WUWG 1MI5D 3W5MA 1BFSA 2JB6B 3KWWA 3ME0A 1HHHA 4IRJA 4LNRA 2IG2L 4G8GE 3QWRD 2Y1VA 4JHBA 5J11B 2FL5B 1R24B 1D9KB 2E9BA 2BC4B 2HLFD 5EA0L 4UDTA 4WVRA 5CEZH 3D6GA 4HWBA 5D2LF 3F7QA 5E9DA 2W38A 3FB7A 1A9BB 1W72H 1V8HA 2DQGH 3D0VB 2X4UB 3TNNA 3SO5A 1CE6B 2EDOA 5TE7L 5I1LB 1SMAA 1NUFA 4X6CA 3DRQA 3UO1L 1T03H 5HI4C 2W91A 4S1RH 1DP0A 3AAZB 4X4ME 5B38B 1OL0A 3Q6FA 3HLAB 3I6LD 3RY6C 3VW3H 2E7CA 4U1KA 5DK3A 2VDOH 5BRZE 3IVKA 4NWUH 5T1MB 2DQJL 5JXEA 1PZ5A 3LEYH 5L0QC 1X9QA 2B8OT 5EBGA 1E6OH 3BKML 5E5RB 1VSCA 32C2A 2X4RB 3QULB 5EO0A 3X11B 3C08H 3MLTA 1NJ9B 4LPXA 4MXVF 1IMHC 1M7IA 5JW3L 1HCVA 1T89A 2VUOA 4I1NB 3OKEA 1AHWB 3S4SA 3L5XH 5EWIL 3DYOA 1FFOB 5M94B 5FUZH 4KZEL 3TWCH 2BMKB 4LRIA 1T1XB 5HHOB 2V7NA 1L0XA 3GSWB 3FZUC 4JRXB 4OFKA 2LV4A 3OZ9H 1NGZB 3LMJH 4ZAKD 5D7JC 1E28B 3PHOA 4OZ4A 4OZFA 5I1IL 1KN4H 2XACC 2VLRA 5DJCA 3EO9L 4MJID 3L3DA 2IAMC 3RVVD 1MAML 3GHBH 1N6QL 2EDJA 3KXFB 1F13A 5DFTA 1C8PA 1CE1L 5J9PB 1RMFH 3CU7A 4QNPF 3N85H 5T33L 4KHXH 4X9HA 4PB9L 1F6LL 3U4BL 5ADPH 5H37H 2AJXH 3DV6B 1NCUA 3GSOB 4KDVA 1M1SA 3UPCA 4C4KO 4FTVA 2GSIB 4NO0B 1P4BL 4TSAH 2OM5A 3TV3L 3NZHH 2NTSP 3MUHL 3CDFA 5F44A 2QTEA 2EDTA 4HX1B 1OD7A 3N0PB 4H1LG 1DQLL 3HFMH 3CPLB 1WAAF 5ITFA 3BO8B 2VDMH 4KI5D 2BZDA 3N1PC 4NQTA 1T22A 4F9LA 5IB1A 3GB7A 4HDIB 4WIQA 2P42B 1WT5A 4AG4H 1HWHB 2R39A 4ZUWA 4N0YL 1NCAL 1U8LA 4BQ9A 3VWKB 2BVPA 1AO7E 5DUPL 5DEFB 1A4JA 4NQVA 3MA9L 4QRPB 1GOGA 5C3LD 2EC9U 2XRAH 2MQ0A 4XBPB 2VE6B 3WDIA 4DKAA 3GFUA 4F37K 5GJSL 1XCQA 3BGMB 3CVHH 4JFEA 4KRLB 3GJFK 4WO4A 1OHQA 5D2NA 1E4WL 3A6BL 5CJBA 4ZUVA 3MA7A 2BOCA 1ZS8A 1FFQA 1HH6B 3FHAA 1S8DA 1S7WA 3LHPH 5C0NC 5GISH 1U42A 5SX5K 2OJZH 5IOPB 2OX5A 4RCAA 3P0GB 1T1WB 1G6RH 2QQKL 4JRYD 1EERB 1QKZH 1HILA 4PGZA 1OM3H 1C12A 4BH7A 1G7JB 3FB5A 2NY3C 3K8KA 5FIEA 5D7IF 1AGCB 1JF1A 1NGWB 1YMME 4PYGA 4Z0BH 1ZV5A 3PV7A 3WL9B 3O4OB 3SDXF 1B0GB 3VXSA 4N8VA 3RUGA 4ZXBB 1FV1A 5DRWA 1NANH 2X4QA 2WZPD 1Y0LB 3N1GC 3U36B 4NP4L 2EDBA 1A9EB 2HRLA 1OOAA 3EYUH 3CLFH 1VHPA 1XF4A 4P9MH 3QQ3A 3PIQA 3MRGA 4NRXA 2EDNA 1X44A 4WFHE 5C0GA 1EJ6A 3OJ2C 4POZC 3VMPA 4R4FL 1H15B 4JB9L 2VLME 2Q3AA 4KY1H 3T2NH 4M1GL 2EKSB 5HDOA 3IJHB 1CN4A 3GDBA 3DUSA 1U8MB 1A3RL 3L3GA 4XCYA 1OQOA 5ISZE 1YEGH 5ID0B 4UQ2B 2XKNA 1MQ8A 1GGBH 4L3CB 3BPOC 5IVZA 3MACH 1Q9KA 1TQBB 1F5WA 4CGTA 4WFED 1WBYA 4FHBD 2FJHA 2VDQL 4D0BA 1PZUB 2VR9A 3FAXA 1CE6A 4JQVA 4UB0H 3JWOH 3MBED 5KTEH 1H3TA 4HUVB 4NM4H 2FX9L 4B7LA 1GGCH 5ILTL 1S7VB 4JO2H 1T2XA 4PGCB 4YHLH 2EKJA 1EXUB 4M62H 5IBTH 1MUJA 1VPOL 3UTZA 3HG1D 3AS2A 5FHAL 5DFVD 1RU9L 1BZ9B 2ILLA 2C4XA 3WCYA 2B4CL 4AQ1B 4IM8A 3M1BA 2WWMD 4P99A 4E42A 3P4NB 3GGWB 1DQML 1IGFL 3QIWA 1UYWL 3EYFB 5GRJH 1YEFH 1W0YT 5DD5H 4DVRL 3LN4B 3CSYB 5I15L 3X11A 1YN6A 3C8KA 3QISA 3U4EB 2X5PA 4GBXB 5KSAA 3ZDYE 5TPWH 5C0CD 3D0VA 2Y36L 2DWDA 4L8CA 2QV2A 1AO7A 4PV9B 4IIQB 2QHRH 4LIQH 1KCVL 2DQIL 4Z7VF 4BKLB 2Z91A 2G2RA 1DCLA 1KG0B 4TPRL 1ETZB 4LNRB 4Q9QL 3P9LB 5DGQA 5A2LH 3JV4A 1ERNA 4IDJL 2DQHH 3CFKB 4PJ5E 5L8LB 4OZIB 1A1OA 3OKMB 4U1KB 4PJXF 5C6TL 2HMID 1G6RB 3CC5B 5EU4B 1N5YL 4M4PA 4NO5B 5IMKA 5L2JB 3I3BA 1I7UA 3OZ9L 1FIGL 2AP2A 3PP4L 3QEGH 2IAMD 1LVEA 2HTLC 3L6FB 4PRID 1LE5B 3HNVH 5F21B 2EDHA 3GRWH 4MXQD 3BKJH 1UA6L 2IMNA 4CKVX 3LQZB 3MJ7A 3O3DA 4ZTOL 5JLZA 1ZWIB 3HUJE 1OW0C 3S37H 1S3KH 4Z0XB 3FT3B 5AD0B 5IESH 2IBBA 3WFBL 1RUQL 3REVA 1JHKL 3M45A 5MEQB 3BSZL 5FUCE 2E8ZA 2HVKA 5IB5B 4M93B 4ZYKB 4DVBB 3KXFD 4IS6B 1S9VB 4MA7L 3ZDZE 4E5XB 1FJ1A 4N8CH 5DC4B 1IGYB 1F90H 4FQXB 4FFZL 4F7TA 1L7TH 1MFEH 1U8LB 1XGTA 1T5XA 4JAMA 3QG6A 1CLZL 3ROOA 3VWKA 3L1OL 5DRZA 3G5VA 1OP3H 1IEHA 5D2LA 4PJ5D 1UM4H 4HUUB 3IF1B 1QQDB 4QRQB 4RMTA 2AABH 4Z7UA 1DTUA 3O4LB 3QSKB 4L4TD 5BS0E 1OTSD 1Z9SA 2IH3B 5IROA 4MNQA 2FEEL 4RGOL 2YD9A 3WXWL 4G7YL 4QHUA 4X5XA 4YHKH 5I16A 4YGAB 2IANA 2NZ9C 3MJ9A 4OIAA 4DUVA 3ILPB 5DJXA 4NP4H 3MV7A 1JGUL 1G7QB 5HGHA 2O61B 3V7MA 1P1ZB 5ITFB 3AS0A 2DQCL 3MRIB 2A6IB 1HQRB 1AC0A 3BUYA 2DL2A 2ZUTA 1N6VA 3GHEL 4M8QA 2AJVL 4OV5B 1KPRA 1I1FA 3GUTB 3F65A 4X6CE 4CRPA 1UXWA 3MLUH 3JTSB 4RFNB 4BSVA 4UDUB 1RD6A 4RFOL 3DBXB 3P73B 3RUGF 2DJUA 3ARUA 1IZJA 1LO3H 3B83A 1FCCA 4NQCD 2HRPH 5JHLL 4H26A 1U2HA 4UTAH 3OXRA 4GLRH 3OAZH 5BV7C 3FQTB 2VL5B 2OCFD 3IETB 2C1OA 4YBLC 3PQYD 5I71B 2R4RH 4PP2A 1M7DA 5M7QA 2D03L 5GHWH 4ZO6A 2B1AH 4Y2DD 5JQ6H 1FFOA 1NKRA 3H7BA 4XNUH 3QDMB 5DQDL 1T04B 3OHXA 4HIEA 3O6LH 1R5IB 1ZHNA 3ES6B 1T1XA 5HHOA 3SEPA 1LP9E 2VTFA 1U3HD 1WISA 5HHOE 4RGNB 4G7VH 1TDQA 4A6YB 3VD4A 5CSZB 4LSUH 3VH8G 2R0LH 3OKDB 2PXYC 3PP4H 2XWTB 4WV1C 5CKAA 1RVFH 3JV0A 4XGZB 4YH6A 1KSRA 1HH9B 3BPLB 1Z3GL 1JZ3A 2PKDA 2H41A 2VERN 3EHBC 1NGQH 4U05A 4LU5L 5IHZA 4I48A 3KPNA 1F4AA 3HG1B 1OGAA 1U92A 3AREB 5HHQA 3HMXL 1JZ8A 5KS9F 3BWUC 5FGCB 3MRNA 3OKOB 1ZHKB 1EAJA 2X89A 3P11H 4ZNEA 1WZ1L 5CBEB 4WFGD 2GHWB 2VMFA 3LZFH 3D9AL 4XCFL 3STZA 5IP4A 4ZS6C 3PWVA 3RDTD 3WNNA 4RRPA 4PJHB 2FHCA 4KUCD 2ZSWB 3JV6B 4H5SB 3V0WL 1FO0H 3GBMH 2VISB 2PTTA 2R0WH 3SE8L 1B88A 4QHLB 4PRBB 4MWFA 4RIRB 5GZOC 5EOCJ 2XKNB 2V2WB 4LLYB 2DBLL 3CH8A 4KUCF 4OFDA 2NYYC 2OMBA 2ZUVA 5ACLA 3N06B 5DD6B 2H8PB 1I8LC 1DUYB 2IALA 2A83B 2A9NL 4Z76A 1S78C 4KI1A 4MVBD 3VFGL 2ESVD 4ZS7L 1AO7B 1NFDB 1MFDH 5GS0H 4K2UL 1RZKL 4Y5XC 1X4YA 4R97C 4AM0B 3QIBC 1N0LA 1Q9OA 1A6ZB 4Z7UE 3GZKA 4JDVB 2D0HA 4WO4D 2W65B 5IQ7L 4L3CA 3DURA 1X7QB 4P2RD 1VEMA 4D0DA 1HKLH 3QP3A 3FFCA 1S7UA 3WIFB 3S34H 1JWMB 5FGCE 3ZTNL 4Q6IA 4UZGA 2BSTB 4DOHE 4KKLC 4RMQA 1PW3A 2BVOA 1KV3A 1MLBA 4G80B 4Y1AD 3FRPA 3DMMD 4HIIA 1I3VA 3OKYA 4J8RA 3UPAA 4R2GD 3EDKA 2P5EB 5C08B 2O5ZH 2SEBA 3NACL 3KLHC 1EMTH 1T7VA 2JIXA 1X5HA 2UWEB 4ZNCD 1UB5B 2XN9B 4EUPH 1AP2B 3UJTH 4MCYB 5I73B 1FL5A 1G9NL 3G5XB 5FA3A 3EJZD 1DQJB 3MJ8B 4FFYL 2R2EA 3UXFA 5F89A 4HS8H 4HAFA 5FYJL 4PB0H 5HBBA 1JGUH 1QPPA 2LVEA 4KHTH 2ZOKB 3MRKB 1F3DH 4QRUB 5ALBH 1DQQA 4R7DB 5K33A 4ZUUB 2YRLA 3S5LA 1FNEB 4JY4B 3RPKA 1BOYA 5BV7H 3ZE2F 2AEQL 2RJMA 4QTHA 1YEDB 2J2ZA 1ZLUH 1YEKH 1GGIL 4XPBL 4LEXL 3G6JF 4QHNB 5HTSA 3T09A 4OD3L 1IEAB 3C5JA 3ESUF 2LU4A 5HHNA 2YR3A 3O0RL 3OTTA 3CAFA 4OFYD 1MCOH 5E94B 4NJAH 1T0NB 2ED8A 1UEYA 4X5XB 1KTLA 3SKNB 2X1WL 3DO7A 3DXAB 5E08L 2XTLA 1AR2A 4Q6YA 4X6CF 3QWOA 3MUZ1 5JXED 1QEWB 3MRBB 4PJ8B 3ZHKA 4M7KH 3T4YB 3WIIL 4L5FL 2X4OB 5EC1B 3OAYK 2DYPA 4EVNA 3BKMH 1QZ1A 3L95B 3U48A 2A74B 4RAUA 3O6FD 1T1ZA 3Q6GH 2GAZA 4IDLA 3X3GH 1JVKA 4P5MA 4HIXL 1R3JB 1JWSB 1K8IA 3I6GA 2AJYH 1EO8H 3QUYD 2P44B 2NY2B 5ALCL 4D9LL 1EEYA 4RNRB 4P9HH 3W81A 4Y4KB 4IOFD 2R0ZL 4Z7VA 1IM3B 3C5SA 4WV1A 3OR7B 4PGDA 2I24N 5C0BE 4QGYA 5KSAD 3WMSA 2BK8A 2B5IC 3ILQD 4M03A 4M43L 2FR4B 3OJDA 4YQXL 1AKJD 2VRAA 3IYLW 2A6DB 1ZA6B 4LLWB 2LU7A 4QXTB 5DRZB 3T4AA 2EIBA 6CGTA 3VFMB 4JN2B 2VDLH 2FB4L 4ORGB 3VE0A 2HTKD 4KU1A 2D4FA 4PJBF 3EO0B 1DBBH 1BD2D 1NC4D 4MMZC 5EFIA 1KIPA 1BVZA 4WI6A 3GSWA 2IH3A 3LKQA 3IRPX 5FYKD 4G8GD 5D71H 2Y6SD 5EU4A 3FQNB 4YHNB 4YHKL 3QH3B 5I1GL 4HQQH 1P7KA 2CDFB 4U1GB 3FN3A 1RZFL 3C5ZD 4ZMAT 4MJIB 3DROB 4JZOA 4OCYL 4KWUA 4WI3A 1SEQL 3TO4A 1H3XA 5C09E 4GKZB 4YPGA 5JNYB 3BHBB 5CWSA 2Z0BA 5E24E 3WN5A 1MJ7L 3MRQB 2H32B 2Y5TB 1CK0L 1FL3B 3REVB 2VSDA 4JFPA 3UJIH 4AEEA 4CJ0A 4F33A 1MHHA 3VXOB 5EU5B 5JR1L 1AQKH 1VFBA 3P30H 2UZIL 1T3FA 3D39E 3CZFA 4N5ED 2LAGB 5C3TA 4WHTA 3JTTA 3AXLA 3BKCL 4Q2ZA 1OSZB 1HHIA 2D0FA 3C08L 2AS5M 4JGJA 4F7CA 5DQ9A 1B9ZA 5EOCH 1BD2E 4LEOA 4PJGA 5CILH 2R1XA 3A6CH 2VQTA 3OV6A 2G9HB 4WY7L 3SQOH 5I1JL 4KJWC 4P9HC 4RFNC 1FDLH 1TZIA 2A83A 4XNMA 1U8OB 3H9YA 4XTRD 4I0PC 4HFWB 4FXKA 4HUWB 3ZDZF 4HV8A 5F9JB 4ZDHB 2FX7L 4KV5F 3KYKL 1EDQA 2CR3A 1B90A 1ZKAA 3AMKA 1U8QB 1BBDL 1R3LB 5H35A 4UNUA 3QUZA 4GQPH 4Y19E 5C9JB 5EBMA 3VWJA 5HYIA 1C12B 4BH7B 3AM8C 5HGBA 4J12A 5D2NB 5IHZB 4P2YA 3LS5L 3MLWH 4OGZA 3VXMB 5I1HH 5B3JF 5C0IA 1WZMA 3WKNA 3E6FB 4G6AD 4U1JB 5ALBL 3VXSD 4EOWH 1QVOB 3W0WA 1IAIM 4G5ZL 5GGUB 4ZFZB 3OKNB 2DJ4A 5CHNB 4WW1B 1ZHKA 3U0WH 5T33H 2HT4D 2XZCH 1H3PH 4LARH 4RGNC 1KCLA 5BO1H 1IQDB 4ZD3L 1IL1A 4XNQB 4X6DA 1UT9A 3IFPA 5AZ2H 3ZL4L 3L3JA 2XTJE 4P5TC 5I74C 3EDEA 3WL9A 1FVDB 4QLRA 3RAJH 3X14B 2XN9D 1G0YR 2Z92A 5GZNC 5MP6H 5EWIH 5F97E 1XIWB 5HYSB 3BMWA 4KVNL 4NKMB 5FO8B 2CK0H 4ONFH 1FNFA 2W1NA 3IU4H 1CD0A 2P47B 4KK6C 1NBVL 4M7KL 1AGEB 5JMOC 4U6HB 3K81A 4OF7A 3NVQA 5EORL 1NGPH 2ADJB 5EU6B 2ZNWA 3SKOA 4HXAH 1LE9B 3QJFB 4R90H 5E6ZA 3MFFA 1D7FA 3IJHA 4N90E 2KBGA 4W4OC 2V5YA 5EOTB 3E6HA 3MODL 4MNHB 5MENE 1R3KB 4PJCB 1HI6A 2YBRA 3RIAF 3LH2L 5E94A 4JGMA 4X98B 5FK9B 1RZFH 4JCLA 4AH2B 4TOYL 4JQXC 4K94H 3SKNA 4Y4FC 1WFUA 3EYSH 4ONGL 3BPNC 4PJDA 1FO0L 3TZVB 1GOHA 3MR9A 1OT2A 43C9B 1DBBL 4Q9RL 3RKPA 3O8XD 1KF9B 4KDTA 4LSTL 2UUDK 1T1ZB 4PTTB 3RFZC 3VXUA 1NL0L 5L88H 1SY6H 3U0TA 1CDGA 3BKYL 4U1SA 1AGFB 3H42H 3D18B 4U1MA 3SE9H 4BFIA 4N0FB 2XZAH 5CP3A 4UV7L 2J6EH 1A7BA 4Y4KA 3B8SA 2G2RB 5HHNB 1NGYB 3WKML 2X09A 1IGCL 2CKBH 4K9EL 2APXA 4Y5YC 2YD1A 2VITB 1MHEB 2Q8BH 2YD8A 3T3PE 4PLNC 5D1QC 3RX5A 3BDXA 2FX7H 4QYOA 5JXAH 2YD5A 5ECJE 1WZKA 2J3SA 5F7LB 5C0JB 2ESVA 4ZPTA 1I9RH 2Y5EA 4AIOA 2BNRE 3U9PL 3CNKA 1KGCE 2HLAA 2Z9TA 2F58H 3U30B 1JYWA 1N3NA 2GJZB 4K8RD 5EC1A 2FJGA 3DARA 4ZQKA 5IF0B 4AY0A 1MJ8H 4ODTH 5CMAB 1ZVHA 5B3JE 1DL7H 4AENB 3TJEL 2IADA 2WP3O 2BXYA 4UBDC 4JM4H 2MPAH 3FONA 3BGFB 4YR6B 5J89A 4L4JA 4BK4A 4DKFH 5DDHB 4P2OB 3TT3L 5L9DH 5L2JA 3DMMA 1F11A 1QLEL 4GG6F 5LWYL 1P7QB 3LEVH 2MMXA 4P4KC 4KMLB 5EZIH 3EDDA 4LBEB 3BYTA 3RIFK 2JIXB 3MGAA 2JJTA 4X6FA 3GMMA 4FQ1H 3L3OB 2I07A 3O3EB 3NCYP 1IAII 3P4MB 1K6QL 1AIFB 3NAAH 3KR3L 5TE4H 1Q8MA 4KRPB 4P2CG 2Y9RT 3OKLB 1PD6A 4PJAA 1S5HA 1I85C 2GTWB 3HZYB 4L4TA 1RK0B 2ZWLT 4H25B 1MCKA 3CLEL 1LNUA 3S35L 4I77L 5I1HL 4RRPG 4G7YH 2FZ3A 5J1AA 5DMKA 2NY3B 3ARGB 2ATKA 5IB4B 4EQ2A 1EFQA 3DRQB 3MYJA 1JNHA 4E41A 1BIHA 4EI6B 4KKBC 3RGVB 4JZOB 1YEHL 1CICB 3F7VB 3KYNA 5GGTL 4GRMB 4CN4A 4JFOB 3CFCL 1BAFL 5TF1H 2CDEA 3VRIB 1HIML 3RJQB 3EO1B 1BQHA 3L1OH 3HE6C 4O2EA 3RNKA 1WWAX 5DHVB 4JFYA 4WY7H 3UTPD 4KK8C 5H94A 3FB6A 3QNXA 1SJEA 4NQCA 4HJ0C 5I1DA 3C60B 1S5IH 2F9BT 4MX7A 3DXAE 4NNPH 4WHYH 1OSZA 1P2CA 3D3VE 4H8WC 3RHWF 3B5GA 1A6TB 5MI0C 1QSEE 2GSGA 3ECBA 1MCIA 2R4RL 4F9PA 4XCNA 5EU3A 2R1WA 4U1HB 1N64L 4L4TE 3UJIL 1JTOA 1U8OA 5B4MC 5DJ8A 1MRFL 5C07D 5CEYA 1B3JA 4WJ5B 5ISZB 1RIVL 2APTA 2PO6D 4TUKL 43CAA 4I3SH 3EGSB 3GSXA 1HDMB 5GRUH 5D93C 2C1OB 5E2VL 3MV9A 5GRWA 4LVNB 3F5WA 1MELA 5E8NB 2HA1A 1C5DA 4ZD3H 1Y18B 3KPRA 3RX8A 3QDMA 3MV9D 2GEEA 2YXMA 2MKLC 4Y19A 4C54A 1L9MA 3O4LD 4ELMF 4LAQH 2DQHL 3GMPA 1MFBH 4LDEB 1DR9A 5KVEH 3KPRD 2OZ4H 1MHPL 2WUBH 1NBZB 4G6MH 4JDZA 4I13B 4NFDA 5EO9B 5ANMB 3CFDA 4D8PA 3FTGB 1LE9A 5AWNH 3DWTA 4G43B 4G42B 4HS6A 1SJVA 3FT4A 3H0TA 1NLBH 4PRNA 1YECH 3VGGA 1R3KA 2VDPL 1X5JA 2XFXB 4FZEL 3WXWH 2QADC 4JR9H 3G08A 1NFDE 4ZUWB 2HFGH 2HKHH 1Q0XL 2KDGA 4LDLB 5A16A 4XXCC 3TO4D 4HK0A 2Q86B 4LCWD 4OKDA 1HOCA 2V5TA 2X70B 4U6XA 2R0LL 1IAMA 3EZ8A 3VCLB 4X4YA 4J4PA 4MA7H 3W11C 1IAOB 2JLLA 1FYTE 4IMKA 1DVFB 2VE6A 4QF1A 2OTWB 5FKAA 2CLRA 2CXGA 3JSSA 2ADJA 5ADOH 1FG2A 3TBSA 2PCPA 1OTUD 3BGMA 3R1GL 4P2RA 3RTQD 1A4KB 1KEGH 3KGRA 3PE9A 4U1LB 4NZDA 4L29A 3OR6B 3KYMA 5KANI 1NH6A 3TJEH 1R5VB 2P5EE 3D39B 1CFNA 4XBGB 4P23D 2YD6A 3IU4L 4JDVA 3MA7B 5F9WC 2UWEE 1U8PA 5M95B 3LEXA 4WDIA 3BW9B 3NIFE 3EDJA 3TYGH 1IT9H 3DIFB 3GI9H 4QWWD 1T7WA 4OBSA 5E8DH 3LEYL 3WJLC 3FFCD 4Z95H 4KMTH 3QXDB 1QSFA 1RHHB 3CFCH 1RZ8A 4FXGA 4JRYA 4Y16C 1G7IB 1J8HE 1MLBB 4G80A 3SE4C 2GK0B 5EU7C 4P3WA 4ODWA 4P5TB 1QLFB 3GHEH 1A3QA 2QSVA 1MQKH 5HJ3A 2FWOB 5DUBB 5I1AA 5EUKB 1X7QA 2VR5A 2J88L 3VG0H 3LDBB 4LCYB 4KQ3L 3UMTA 2PYEA 1R6VA 2WMPA 1I75A 5B4MD 4O58H 5IEKB 2HWZL 5C0EA 1NFKA 4WUUB 1INQA 2UZXB 2ZOKA 3MRKA 4LSTH 3HUJB 1RZKC 2AKRA 1CE1H 2P8MB 5EPMA 3VGHA 4AJ0A 1AR1D 4M00A 2G75B 1G1YA 1Q72L 2HG5B 4JZJB 3PNWA 1IQWL 3V5HB 5FEBA 3U6RB 3HI1A 3FO2B 4I0KA 1ZGLB 3MJ8A 2JJTC 2G5BA 3LEVL 4P46C 2C3VA 4RWYL 2MTPA 1Q9KB 1ES0B 3CFEB 3O9WC 4PRHA 4MZ2A 2J4WL 3QDJA 1LEGB 1OAYL 2JJVA 4ZFFB 1WBZA 3RL2B 2YK1H 1FLRL 5TQ0L 3QXTA 3RP1A 3AUVA 3L5XL 5DS8B 5IHBA 3BP7A 5KOVC 5MHSE 4E41B 2DLIA 1DL7L 2X4RA 3QULA 1EXUA 5EO0B 1RIHH 1G9NC 4FMFA 2QKIB 2J12B 3FKUS 4A2LA 3U0PA 1CZ8L 2IMMA 3F7VA 3QHFH 4MCZB 4NUJB 1U8NA 2YPKB 1CF8L 2VL4A 3I02A 3WIHL 3QPQD 1O5DT 4FOMA 5I8KH 3DMMB 3I50L 5GSVB 2AQ2A 1IKFL 3BZ4A 4DWHA 5ABDE 3V6OC 1RJLB 4MS8C 1HXMA 2XY2A 4PS4H 4IIQC 3DVNA 4W81A 5TF0A 3O8XA 2D31A 1UXSB 3WHXA 2DIBA 4S1DD 5I1KH 1BD2A 4XT1C 5KSBF 2VDKL 2DLTA 4NNXA 3P0VL 2ATKB 2BNRD 1R3HA 3ZTJH 1TNNA 4U1IB 3IJSB 4OQTL 5F88B 5FYLE 3ELAT 3VMNA 3F7PC 2IPTH 3A0OA 2ICWB 5EA0H 4XMLL 1D5XA 3HZKA 3WNPA 2HT3C 1QRNA 4QOKA 2WLZA 1MHPH 4X8JB 4PJAB 1MCWM 5HVGB 5D1ZA 5C0AA 1U95A 2R1YA 3QQ9D 4PJ9A 1RK0A 1VFOA 4PRDA 5LAXB 1ROWA 5TH2A 1TCRA 2PTUA 1I3UA 3FFDB 3M17A 4PYHA 5JW4Q 2DI7A 2AW2A 3MRDB 4G9FE 4PJ9D 1WT5C 2RAMA 5HDBE 5DTFA 4PD4K 4NUGL 5IF0A 2I9TB 5GRUL 3B43A 4WFGE 4DTGL 4OKVB 3VXNB 2AJSL 4YBLB 5T5FH 3PDDA 5JOFA 1J0JA 1EO8L 2BOCB 4XBEL 4AL8L 4G8IB 3EO0A 1VACB 2OBGA 4R7NA 5C07B 4M6AA 5ICZA 2H1PH 2DTMH 3V5DB 4X7FC 4P2OA 3ZKQD 4LSVH 1KEGL 4KAQL 5IB5A 4LF3A 5JUEL 3RQ3A 1NUDA 1KIUA 1FZKB 1S5IL 3MCLH 4YGVA 2GTZB 3KPLB 3EOTH 1YEGL 5CJQH 2G60H 5HDLA 5HY9B 1IM9B 4JAMB 3KJ6L 5ACMA 1S8DB 3B9KB 3VFUB 4XX1G 4U6XB 3MOAH 3NIDE 3P3YA 1CT8A 4LP5A 4QRPA 4Y7MA 5HGDB 5LGJA 4H0IA 5BJTA 3VXME 5E70A 4KKCC 1TZGL 2ZOLA 1ZLSH 1N7ML 2VNCA 3L3HA 4GSDH 5FF6B 1W8NA 3V7AE 3H3PH 5B8CA 1PY4A 3GMNA 1KOAA 4YDJB 4OLZL 5DD0L 1JHTA 1HWGB 1NGXB 3IDYC 5GS1A 3L3KB 5E8NA 3I3DA 2NTFB 1TVBA 5LQBL 2MQCA 5I73C 4JO1H 3QEHA 2EC8A 2PR4L 2KQMA 1NQBA 4JPIB 4LAQL 3VWJD 1KPRB 3WN5C 1I1AA 1YMHB 4HT1H 2XWJB 4E0RA 3TJHC 4JFFA 4XPHL 4AIZA 1HXYB 1RHFA 4XNZB 4O02H 5DD5L 3ARDC 2K9UA 1HSBB 5E0QA 2L0DA 2ICEB 1HHKA 5C2BH 3FOLA 3NACH 4ZDHA 4BJLA 2R4SH 3PGCB 2IJ0C 4PRNB 4YHIA 5F3BB 5BV7B 2QQKH 2YD4A 4GRWE 2XN9A 1MIEL 3K3QA 3QJHA 5J13B 1SQ2N 4LKCB 3SCMA 4U6TA 5T5NG 1NMAL 3V8OA 4LLDB 5I1DB 3BYYA 1SYSA 2AK4B 3QCTH 1WC7A 1I3GL 4GW5B 4P5TD 4AEFA 1V7ML 1ORSB 1WQVT 1MRDH 5CILL 3DX7A 1FGVL 3GSUB 5F7YC 2AJYL 1ZLVK 4ZUUA 1D5BA 2YD7A 2M2DA 5LXGH 5A2IH 4ISVA 4Q58C 5HI5D 1OTSC 4X6DF 4MAYD 3K7UA 4NPYA 4NQEE 4MDJA 2Z93B 1XGYH 3L5IA 2NX5E 3T0ED 1KNOA 2EE9A 2PO6A 4K3EH 4NQSA 2XKUA 3HZVA 3TPUB 3WUWA 5CIPH 3SKUD 2FH8A 5C0CE 3MBEA 3STBA 1BWMA 5EBLB 1IKNC 2LABA 1UA6H 1LEKA 1FVDA 5HHXH 1XR9A 3EAKA 2IANE 5AZEH 3FQWA 3LV3B 5IUSA 2OI9C 4YWGL 5GRZA 1KACB 1TTGA 2OTUB 4P46D 5FECA 2JELH 3QIWC 3RKDC 1CGXA 3HG1A 2R2HA 1Y18A 4BELD 1FC2D 4MD5B 2B20A 2H2PC 5F7NC 4NN5B 2KPNA 3QFDA 3INUL 3BMVA 2F54A 5CJXA 2CJUL 5IWLC 3KYOB 4TPRH 2ENYA 4N68A 3AVEA 2FGWH 5I1GH 4XAWL 3V6ZB 1IGIH 5GGQL 1M05B 2GJ6D 1EGJA 2IPTL 1K8DA 4BYHA 5LBSH 4J1UB 3W9EB 1EUUA 4PJEE 1WSST 3P0VH 3MOBH 3NPZB 1XAUA 3CFKA 4OZIA 5ANME 4XI5D 2YPKA 5IHUH 3P40A 4Y2DC 1XF2B 4ONHA 1NDMB 2C3GA 4AEIH 1J0KA 4R0LC 3I75B 5T3XE 4JCMA 2EICA 3STLA 1NAML 4HW6A 4UTBH 2D9QB 3B5TA 4YDKL 1BQHG 5JDSA 1I8MB 3T0BA 2NLJA 4J4PD 2HJFA 3TGXA 3U82B 3S4SG 2OP4L 2FYYA 3QRGH 1A5FH 1LWRA 4BK5A 1A14H 4L3EE 2DB8A 2ZSVA 5FOJA 4PRIA 2J8UB 5HI3C 3VFPB 2ED7A 1F90L 1KB9K 1BZQK 2BVQB 1DE4A 5KW9L 2FGZA 2YSSB 2E7BA 25C8L 1RAMA 2AJZA 2PUQT 5F6HJ 4GAJL 5KTEL 4KROC 4PLOB 4O51B 5DJ6B 3OXSA 4UQ2A 5IG7B 4NZRL 3DRTB 3BW9A 2YEZB 3KNBA 2NY2C 3H9SA 4KC3B 4M48H 3B2VH 4OLEA 4J3XA 1D5MA 1A7QH 4CVZA 5C9KA 2HLAB 5F7UA 3P77A 5KSVA 1TIUA 1CD1B 2OK0H 2B5IB 1YYLH 4PGEB 1MJUH 2VZSA 3NA4A 3EYQC 3S35X 3I84A 4MA1B 3JWNC 5MERB 4Y5VA 3VWKD 4H1LA 4K9EC 3CUPA 5E6YA 3T2OA 3AFLA 3QWRA 3O6KL 3VMOA 3CD4A 4RQQB 2N7AA 5IEKA 2UYLB 1G7QA 1MCCA 3U0WL 5D7LB 3GSQB 4G8EB 4Z7UB 4ZFOL 3DX6A 4OZGB 1FVEB 4QT5B 2AXGB 2A6IA 4WI2A 1HQRA 1L7IH 3NA9H 1ND0A 4JO1L 1LEIA 3IETA 4JM2F 3ZZ1A 4UU9A 3MV7B 5HHMD 3MV7D 1J8KA 1LK2A 3VGAB 3KYKH 4BSWB 3RZCC 1TZHA 4P3CH 3WSQH 1BBDH 3IDUA 5IR1B 1FZOB 4JM2D 1WIOA 5HGAA 2AJUH 1I1FB 4YWGH 1VACA 3K2MC 1I7RA 4R6UA 5DMIL 2C1PB 4XVTL 2E7HA 5INDA 3ARFC 3DMMC 5ICZB 3H9HB 1UJTA 1PX4A 5EBWA 3IDGA 4NQEA 1QLEH 1GSMA 3SBWA 4XHJD 4JKLA 3WIHH 4LF3B 3KDMB 4GH7B 2YZ1A 2NTFA 4UV4H 4BZ2L 4R90L 5SWZB 5IIEB 1JMZA 3EOBB 1OCWL 1Q94A 5IESL 4PFEA 1OTTD 2CSPA 2JB5H 1XZ0B 3LPWA 5DJ0A 5F7DB 1YDPB 1MCFA 3QUYA 4IRZH 3ZKND 2DDQH 5MEOB 4LSVL 3LKSA 4JM4L 4C56B 4LPUA 3PL6A 3NZ8B 5GS0L 1SJHB 4R26L 1JV5B 3O2VL 3TIEB 4Z7QF 4ODTL 1EBAA 4WEBL 1OAUL 2EDRA 1RZ7H 5DJ8B 3WYRA 4IS6A 4E5XA 3DVNB 35C8H 3UTQB 5FYKU 1BD2B 2GITA 2ATPA 2NY0D 4FQJH 5DVLA 3CCHA 2R29H 4UINH 3QFJB 1ZT4B 2N7BA 3NCMA 3C8HA 5C8JA 3RZCD 1D5ZB 4Y4FB 4Y4HA 2WNGA 1J0ZA 4ZFOA 2R1YB 1IGIL 1VGKA 3EDFA 5TE4L 2P24A 3QI9C 4Y4HD 2NY3D 5F7EL 2VXUL 2EEAA 2FHFA 1K6QH 3NAAL 3RVXD 3TN0D 4CU7A 3FQRB 3PWVB 1Z3GH 1S9WB 4L4VD 4XNXL 3GMOB 3QA3B 3MROA 3SHSA 3VGBA 5IW1A 1I8KB 2EDLA 1UB6B 5DI8B 5F8RC 1MFAH 4YBHA 2EXYC 5I1IH 3BD3A 1ZLVH 3GMPB 4F37F 1FVCA 1R0AL 1Q9WB 1PSKL 5HD8D 1YY8A 1I1YA 5D2LE 1T0MA 4NKOA 3V4PH 4OLVL 3SDDB 5IQ7H 4PV8A 2XA8L 1OVZA 4Z18A 3RY5A 3T8XA 4WGWB 4WUKL 3TPUA 3WUWB 2X9XA 3TCXA 3D85B 1KT2B 2CRIA 1OAKL 5F7MC 4CW1B 4KI5E 2MWCA 2EZ0C 2ID5A 4F8QA 3MNVA 4NQUA 3HAEH 2ZNXA 1S9YA 1M6OA 2G9HA 4QYOB 4MSWB 5DT1H 1BOGB 4QRPD 3B8YA 2H8PA 2A9NH 2F74A 3MXWH 4JZNA 4Z76B 5K9QG 4MYWB 3HNTL 1ORQB 3MLSL 4UTBL 4PRIE 1LO0H 3MBXH 5DWUH 3HR5B 3RWDB 2JB6A 4S1RL 1A6ZA 2JJSA 1JN6B 4JO4H 2L7JA 4L3ED 4RDQG 4JFDA 5T3ZD 4O2FA 4LCUB 2F53A 1R24A 2DL9A 5C92A 4MAUL 3QBTB 1L7IL 3ARQA 5DUBA 5ACZB 3FB7B 1D6VL 3QXAB 2UWEF 4EQ3A 5EUKA 3W0WD 3W9DA 1A7OH 3RVTC 4E0RB 4JG1H 5EUOB 3QG7L 3LVEA 3MGTB 2IPKB 2FGWL 2CRZA 1RZ8B 4FXGB 4JRYB 5KVEL 3PGCA 5I17A 5HYJE 4FFWD 1INQB 4UT9H 1CXFA 1WAAE 4HUVA 1MFCL 4UI2A 3CH1B 2J5LB 1ZVSA 2IQ9L 4I3RH 3TNMA 1QFPA 2P1YA 4YDVA 5EOQH 5D70L 3DOSA 3UPRB 2EYSA 1TJIL 2RCSH 4Y8AA 1PQZB 3QDJD 4DN3H 5DRNB 3ALXA 4LCWB 5T1LA 4GW1A 5C0ND 5DO2D 3RY6A 3TT1H 4M6OH 2XTJC 1UM5L 1KELH 4OLYL 1QEWA 3MRBA 4TSCL 5T1LD 3BDYL 4N1CA 2FD6H 1KXQE 4PGDB 3CFBB 2ADGB 3PWUA 3MLXH 1D9KD 3OWEA 1X5AA 2AKRB 2P8MA 4RGMC 3T0EA 1FZMB 5IB2B 2DWEA 3PDGA 4AMKL 4KK9C 4NQSB 3UC0H 4TUJA 3FB8A 1NSNL 4HLJA 1TZHB 2NY6D 1YJDL 1KPVA 5IR1A 2X4PB 5KS9E 1RUPH 1N59B 1CDHA 4NJAL 1W0WA 3IFNL 4Y0GA 2VWEE 3O0RH 3MC0A 3L9RA 2APVA 2BSED 3T2NL 1XGUA 2VLJB 4MJ5A 1IBGL 4R4FH 1IJ9A 2A1WL 1ZHBB 1R5WA 2Q20A 3KDMA 4AG4L 4G6FB 5FB8B 3TFKD 1LO4L 1ZAGA 2AJUL 3G5ZA 2PXYB 2JCCF 4LCCA 3ZSSA 3FO0L 3U30C 3QHTC 1YECL 1L0QA 1UWGH 4JGUA 2RFXA 4U0RC 4TTGA 5GIRB 3HI5H 2SEBB 4NCC1 4FZEH 5D93B 2A77L 1X5XA 3WUZA 3D18A 4U1MB 1BMGA 3MZGB 1KXTB 5F1NA 2BVPB 2DLEA 3ARGC 4MNGA 2E9JA 5D1ZD 5DEFA 5C0AD 4Y5YB 4ERSH 4I5BB 3O2DA 5BXFA 5A3IC 3V7AG 3IFOB 5F89B 4DFHA 3GSQA 5CEYB 2DMBA 2E9WA 1SBSH 3T0WA 5E7BA 1BPVA 4JRXE 4JFHE 1JPGB 4C59B 4LP4A 4HJJL 3WD5H 1H9VA 4JFEB 2KQNA 2VLLB 4ZTPH 1YYMH 3IT8D 1JGEA 1RU9H 2B4CC 3U7WL 1OAUH 2ARJQ 1UYWH 2BRQA 5MHSD 3MLSH 3MRDA 1P6FA 5GISL 1XGTB 1ZOXA 2BVQA 1RZ7L 3BGFC 4POUB 1R3HB 5DTFB 4P2OD 3U46B 3MRMA 4GG6A 3GI9L 2I5YL 1A1MB 1JNNL 2I9LA 4KJPC 2WP3T 2VR4A 3F12A 3HE7C 3NTCL 3RPIB 4EZMA 4GS7C 1VA9A 3NFPB 3WIIH 4WUKH 2FBOJ 4QRSB 2DM7A 4H0HB 1QBML 3ULVD 2BOBA 5ERWA 2ZUQC 5D5MF 2ZCKH 4MD4A 4V1DD 2X4NA 1FPTL 5KZCD 5F6IB 3X13A 4MA3A 3PG2A 1FLRH 4WHTB 3BE1H 3MLYH 3ALWA 2XN9E 3ULVF 2Z31D 1FVCB 2VLKB 3BD5A 4QEGA 1D6EB 3NIDF 4LEXH 3GM0A 1OWWA 3C6SB 3AROA 1OAZL 2AERT 3QEGL 5EZJB 3RWHA 4KJWD 2BHUA 1MHHB 3GSNH 5IFHL 3WDHA 1LO5A 3UX9B 3TO2B 2D7TL 1MVFA 4KXZH 1U3HC 5FKPA 1VGKB 5F9JA 1JL8A 2K7PA 2XQYK 3L3JB 1TTFA 2NY5L 4W4NA 4OF5A 1FORL 1HHIB 4U4BA 4A6YL 1I1AD 2DOCA 1H0DA 4XVUD 1C7TA 1XF3B 5JW5B 4HS3B 2NXYD 3BJLA 4DQOH 2QADB 3FL7A 1FAIL 4MSWA 4UINL 3MRHB 5I0ZA 4Y4FA 4F15C 4EI5A 1H15A 3S36H 1R5IA 3ES6A 1UM4L 5K9JH 1ZK9A 4PRPE 3QDHA 1A7NL 3PF2A 1JFQL 5DR5H 5DHVA 3MXWL 4JPWH 4P5TA 1T0MB 3GMLB 5C0DA 4ZOBA 3HNTH 5C9JA 5I1AB 2XZZA 4Z7WB 3TBVA 2XWBA 3IDMB 3TP4A 1U8JA 4N0CC 5E6IC 1LK3L 4KGJA 3VFTB 1SEBA 4XB7A 4B53A 1TJGH 1YNLH 1RULH 1G84A 3V5KB 4PJFE 2CIIB 4HCRH 4N9GA 1NGPL 1JHLL 3ZHDA 4XNUL 2ADIA 3WFBH 3RVUC 3MGOB 3LN4A 4HGWA 1K9TA 1I9IL 1IC5L 1VCAA 3PL6D 1XF4B 3QWQB 4YIQB 3RI5K 5FCUH 2E6QA 3GEWB 4YO0A 3LD8C 5FGSA 1X6LA 1K3IA 4LPVA 1RUAH 3DTXB 4DEPB 2E5EA 4HAGA 4XBEH 5D7JD 3VRLF 5IJVB 2FATL 3P0YH 4Y16B 2BCKB 1NAKL 1P4IL 1OAYH 4PJBE 1WC7B 1LO3L 3VFNA 5JPNA 2YPVL 1YYML 1WUNT 3IGAA 3W82A 5D6CB 3RVWC 3E6HB 3S5LG 5C6TH 1TJIH 2RCSL 3W39B 4CVWA 5IEHB 1CCZA 4OIBA 3PHQA 2V2TB 1FRGL 3VXUB 3MUGB 3QFJE 1LP9B 2W07A 3BKYH 4GKNA 3KPSD 1G9ML 1UZ8B 2F54D 1U6AH 1IGML 2C7UA 4YHZL 3SDCC 3B9EA 5INCB 5IK3B 2H9GB 2EDDA 1UQSA 4ERSL 4WNQB 3EYVA 2VYRE 3CH1A 5KOMC 4F7MA 5C86A 3PWLA 4GSDL 5FV1L 2JCCA 3FT3A 1KIRA 4W6YB 5AD0A 3NBNA 4L4VA 3KXFE 2YWZA 5TPWL 4MMXC 4LVNC 5D6DC 4OZHF 2LE9A 4P46B 3MNZA 3EYSL 1MCBA 3A67H 1INEL 5CD3B 5IGXH 4Y4KD 4K7PY 3TVMD 1RVFL 2JTDA 2PXYA 5HPOA 2PW1A 4R97B 1CR9H 4JFHD 4JEGB 3CX2A 4LVHB 1WJ3A 2A1WH 1EUTA 4Q0XH 3LQZA 4YHOL 1NCDH 3UZEA 5F7HA 4KQ4L 3VDBA 3TEUA 5AZEL 3U7AA 3TBTA 4BQ6A 1OD9A 3MZTA 4M7LT 3RTQA 4EDXA 1AI1L 4FRWA 2DRUA 3FB8B 3PGFH 1D3CA 1EZVY 3OKEB 5D2LB 4DKFL 4UAOC 3GI8H 3HPLA 3O45A 4P23A 2Z92B 3HE7A 3IDNA 1DQJA 1S7QB 2YZ8A 1DUZA 5T3ZE 1J87A 1A1OB 4FQXA 4QRUA 3LSOA 4PBVC 3HE7D 1YC8A 4XPGL 5E2WH 4OSUL 3T0EB 4P2QA 3QYCA 1U93A 4MJ6B 5C1MB 1AGEA 4YUEH 1AGDB 3ULVE 1F42A 5BMFH 2OL3L 3KLAA 3MPCA 4EUPB 3ZKSD 4AL8H 4FQCL 2JIXD 5GXBB 2F58L 5J6GB 3BH8A 3PWPB 5GGSY 4D94A 4QTHB 1CLCA 5EZOH 4OI8A 3O41A 3U2SB 1RURL 4AZ8A 4LAJH 1RUKH 3O3DB 1CICA 3MJGX 1JI2A 2VIRA 2R9HC 4N9OB 2DICA 4JFOA 3WD5L 4O51A 4DCQA 4OTXH 1AFVL 2GSIA 1T0NA 4NO0A 4D9RE 5AEAA 5EUOA 1MOEA 4PJGF 3RL1B 4Z78B 4GBXD 2BDNL 1MNUH 2PNDA 3G6JA 4PGBB 4A6YH 3ARBC 5E8EA 1EGJL 2WUCL 1BGXL 4GBXA 1S9VA 2XV6B 4JANA 1TPXC 1N5AA 1J0HA 2W0FB 3Q1SH 5CJ5A 5LBSL 2A6JB 5KZCB 3ZE0E 2OR7A 1A6TA 2UV3A 4ZUTB 4IRJC 3EFDL 2ZUXA 1QFHA 2Z91B 2ZP0T 1FNHA 5IBUB 2I60L 4Q6IC 1JNHB 4QRRE 2X10A 4OFYA 4JDTL 4NHUA 1T20A 3JV4B 2YA1A 1F4XL 1CQKA 1A21A 1LEGA 4NKDB 2D7NA 5KVFH 1PG7W 5FA4B 2YC1A 4L4TB 3LQAL 1S7RB 1D9KA 4K55A 2B39A 3EOYG 2EIZA 1K4DB 3ZLQC 4K23H 5DMKB 2AEWA 2DYPD 4TULL 5GGVL 5I76B 3ALPA 1OARH 4JZJC 4XVJH 5J9PA 5F9OH 1DEEB 2VABB 5I1LA 4JN2A 1HYRC 1IC5H 1RQ5A 3NTCH 4AK1A 1FNLA 2CKBB 4JREC 3TYFB 4TVSa 3SJVB 5FDWA 2HLFC 1URLA 5J1SC 4OGXL 1WK0A 1FFRA 4OF6A 4ZAKA 5ADOL 2VXSH 3DBXA 1KENL 5AUMA 3FN9A 1I3GH 1I8IB 3VFVA 3FQUA 1EV2E 3RIFF 3G04B 1DQTA 3VXPB 5B39B 4LRNH 4BUHA 1KCKA 3E2HB 3JWDL 4P3CL 5HVHC 2VH5L 4K7FA 4J6RL 3WE6A 2XG5A 1YN7A 4U1NB 4U7SA 3RZCA 2VLKA 1T2QL 3UTQA 3ZKXC 4FQIL 3V9FA 5IQ9A 3MRLB 4OCSH 3MCG1 3C6SA 1NAMH 2ESVE 1NLBL 2FO4B 5D1XD 3BPCB 1TITA 4JR9L 3BEVA 8FABB 5CBEA 5HI5C 5AWNL 5TE7H 5KVDL 3GBNH 4KJPD 4C56A 5JO5B 4G8GA 4ODVL 2CLZB 2H32A 1DVFA 1DDHB 2CXKA 5DVMA 3O4LA 3V52L 3IXAA 2BP3A 3S3JA 1XF1A 3HMXH 1FHGA 3ARDB 1NGWA 2ZSWA 2NY5C 4HHAB 3FOMA 2J1KA 1DVFD 3WXVH 3C2SA 2LAAA 5CUSH 1TETH 3N85L 2O61A 3BT2H 5GGRA 2CJUH 4Z5RB 4OLXL 3DX9A 5DVKA 2YPVH 2B7DT 1CDBA 3O3AA 2YUWA 1ZS8B 4Z7NE 2XY1A 1JTTA 5D7IB 5D5MA 1OLZA 4HBCH 3JTSA 5DUML 4X7CC 4OZHA 3HNSH 4U49A 1HK6A 2I27N 4DZBB 5J3HC 3B2UD 1F58L 3CMOH 3QDGE 1Z6JT 1G1CA 3LEXB 2DJSA 1KCUL 1H8NA 1M7DB 4X6BB 1YZZA 5TDOB 2GT9B 2Z31A 3GB7B 1FSKB 4PJHE 4LLAA 2X1OA 2NY0C 5CD3A 1FH5L 1QNZH 1CFNB 3I2CL 5E9DE 2VDOL 5GJTL 4NFBA 3EJJX 2F19L 1F4XH 4X4YB 3DSFH 1U8PB 3S3SA 2Z4QB 3LS4H 1UZ6E 5SWSE 3EKCA 1KJ2A 5KVFL 1TMCB 2YRPA 4L8SA 3PWNA 3L3HB 2A73A 2XQBH 4KKAC 1QSFD 3FO9B 2R2EB 2VXUH 5D2NC 1A4KA 4H88H 4XC1H 3MLRH 3VA2C 1QO3A 4R9HA 3HC4L 2VQUA 4XBGA 3RWIA 3L7EB 4GW4B 1KB5A 5E4IA 4JRYE 2IH1A 1E27B 1MEXL 4ODXB 4RMUA 2OZ4L 4G6ML 2W9EL 4WI9A 3FFCB 1BGXH 1QFUH 1QSZA 4UT7L 2OTPA 3UTSE 3TIDA 3IKCA 5D9SB 4KHTL 1OM3L 1FBIL 3UJJH 4FQLL 5INCA 3FT2A 4F7PA 4P49A 3CFDB 3C5JB 3Q5TA 4ZODA 1QTYT 2LTQB 4F7MB 3QJFA 4TTDD 3T1FB 2XKSA 3HUJF 4HMDA 4P9HL 3BAEH 5FM5M 5FHAH 2BRRH 4MCYA 3MRRB 5DT1L 2NXZC 1KYOK 1JUFA 3SY0B 5FGBA 1B0RB 1T7YA 4NO5A 3BP6B 1T6VN 3GGWA 2GFBA 4QT5A 4HEPG 2W60B 2D4DA 2IPUK 4CMMA 1YUHB 2X7LA 3QHFL 4M7JL 2CIKA 3DVGB 4BSJA 3EFFB 4PJGE 3RL2A 1QRKA 2P8PB 2ADFH 2QQNH 4HJGB 4XX1E 1PYWB 2NY7L 1C16B 4GG8B 3UZQA 3IDXL 4PV9A 5CZKA 3SGEI 4EKXA 3RVWD 3ULUL 2X42A 5JIIA 4WENB 5GZND 5DC0A 4LSRL 1X5KA 4YHYB 4JN1H 5IVXA 1OB1B 4OCXH 1CGVA 2BNUB 4OIIL 2D31B 1T4KA 1UWEL 1WBYB 4L9LC 4S1QH 2CDFA 2QLVB 4O9HL 5B3NA 3KPSA 4H20L 2IBZY 2I60H 5DS8A 1MFCH 4RMRA 1RK1B 1AGBA 3HPJB 4XMLH 3U2SA 3VXUE 2HTKC 1U36A 1MAKA 3MLWL 1U8IB 3LS5H 5HSFA 2BNRB 2WIIA 4RZCA 2BXZA 5C0BB 3KPPA 3GBNL 4LPCA 1G7LA 2Y5TA 1ZGLM 3W2DL 5KSBB 1N4XL 3FQXB 1N7MH 3NMEA 1MWAH 4C55A 1ITBB 4M5ZH 3UCRA 3LKRA 5DDHA 4KK5C 5FO9B 4PG9B 5BXFB 4MAUH 3TVMA 2Z8WC 5DC9B 4UQ3B 4GT7A 5K93A 5FO7A 1QA9A 5FYLH 2YWYA 3JTTB 5KBNC 1NCBL 1GL4B 3LB6C 3EIFA 3CFJB 4CVXB 3BHBA 4M5YL 4XXDA 3RBSA 1G7MB 3VXQB 3DI3B 4TUOA 1CLZH 4JO3L 4WW2B 2H3NB 4YUEL 2K1MA 4KROB 4JQXA 1T7XA 5C8JB 2G60L 3NFNA 3TBWB 2FNBA 5EU5A 3H7BB 4XVUC 3T77A 4HXBH 1CIUA 3IDNB 3S7GA 1HHGB 3O4LE 4JO2L 1F58H 3DPBA 2APBA 3SDXE 1JGVL 1ONQB 4V1DA 3B6SA 1KCUH 5TGBB 5D8JL 2P5WE 3L7FA 1QR1B 4M7ZC 4YC2C 4ZTOH 4PRAA 4GMSH 1AQKL 3BKJL 3D87B 5GGSA 3SDAB 3ILQC 1CFSA 3QCTL 1U8HB 4OB5L 5D1XB 4JPIA 1UB6A 4CN1A 1A64A 4NUGH 3E1F1 2AV7B 4M8QB 4BM7A 3OG4B 2Y4SA 3EHBD 2EXYD 1F2QA 3QCUL 4Z9KB 1JPTL 4HC1H 4UT6L 3R8BB 1GJIA 3V5DA 4S0TD 2VKXA 5F3BA 5HGDA 1DJSA 4OZGA 4D9RD 2WQRA 1L4IA 4EN3C 4JFZL 1B4JH 4NN7C 5CGYD 5GS1C 2V7HB 3MXVL 4KFZC 1NCTA 3TA3B 5IV2B 5J0BA 1J86A 4I18B 4NDMB 4XP1H 1HSAA 3VGAC 1SYVB 3WFDH 1I1AC 5TDPB 1F45A 1U41A 5C08E 3UYOD 4BH8B 3D1MC 3DGGB 2W9EH 3GSRA 4ODVH 3INUH 4G8GB 3HZMA 3SDXB 1OW0A 3GMQB 1HH6A 5KVDH 2FECI 4XNQA 4RGOH 5LGJB 4U6HA 1KJ2B 1U91A 1UWGL 1LDPL 4ZPVA 4JFFD 4Y4FD 2Y06L 3FO9A 4NQED 1BFTA 4NQEB 3V6OA 5KN5A 3LS4L 3GJFH 1CTOA 2F19H 1FC1A 43CAB 3E2HC 4MNHA 4OGXH 1HDMA 4F57H 5FM8A 3GIZL 1TVBB 2VZVA 12E8L 4D9QD 2V2XA 3DYMA 2I9TA 2ZUSA 4D0DB 5JUEH 2EYRB 3G6AB 4PUBL 1JWMA 1J1PH 4MQTB 2MPAL 4N1EA 4OGAC 4OCWH 2RB8A 4R7NB 5D7JA 4RAVA 4X6EA 5C07A 2NW3B 1IZKA 3DVIA 1HI6B 1LD9B 4U3CA 3NGBB 3K1DA 1ZVSB 4HK3N 3T0DA 2D7MA 5DRXA 4ZSOA 1FE8L 1N8ZB 3AY4C 4UMGA 3MUY1 1PG7L 1C1EL 2YUVA 5FFLA 3T0AA 2Q8BL 1ADQH 2VLKD 1B0WA 2Q3ZA 2BRRL 4JPWL 2VXTL 3BEVB 8FABA 1QSED 2R0WL 4QXUL 1WTLA 2NLJB 5F7WC 3K0WA 2DI8A 5ESVA 3MOBL 1XR8B 3OGOE 2XQYG 5HHPB 1BFVL 3ISWA 3S4SB 3REWA 4M6MH 1EH9A 3D69B 1BHGA 5EU6E 4I77H 3Q2CA 3HS0B 4NT6A 2BMKA 5BVPH 3HC4H 1E6JH 4YHZH 2AVGA 4NQDA 2KL6A 2OTUA 3IGAB 4GKSA 2P8LA 1T2JA 4XTRC 1HCFX 3PHOB 1ZT1A 2AXJA 2VLRB 4UOW1 3W0WB 4KGLA 3PGDA 3CK0H 4NQXB 3UYRL 7FABL 2GFBB 2HTLD 1BIIB 1JPTH 4OZIF 3PJSB 1DQDL 1K8DB 3SE3C 5I18L 3MRNB 2VWEC 4BUGA 1P4IH 4ZS6D 4MZ3A 2DIAA 4LHJB 3TWCL 1NKOA 2YXFA 3OXSB 3KPPB 4G7VL 2P7TB 1JZ5A 1EEUA 3ULUD 3DETC 2NX5D 3T0EE 5F93C 3IJYA 2VLMD 4S0SD 1ACYH 3O6FB 4JFEE 1PEZA 1JK8B 4JRWA 4JRXA 2VISA 32C2B 1MJ8L 5FO7B 5DUPH 3VFSB 4PJIF 1BVKA 1VADB 3GMRB 1MVUA 1RZKH 4IOFC 4FQXD 2YOCA 4MD0B 5J1AB 5DZLA 1EHLH 3CXHK 4C83B 3FFCE 4XHJC 1NCBH 1N3NB 2GJZA 1JWSA 3C5ZC 5D96B 2MHAA 3G5YA 4XRCB 2GY7B 5DEGB 2F53D 5F1KC 4UIMA 3V6FA 2WV3A 4X6CB 3KYNB 4NO3B 5IGXL 5C2UB 4M1CC 1NCWH 1EVUA 2PYFB 5K9JL 3FONB 3GKWL 1IM3A 3C5SB 4U3XA 4XB8A 2BC4A 4K7PL 3DVFA 3RA7H 4FNLL 3IKCB 5D9SA 3LPFA 3IAQA 4G6FD 3QUMH 4ZUVB 1EHAA 1FO0B 1G9NH 5CGYC 4MQ7B 3QO0A 3UTSB 4OZGF 3GIVA 1PLGL 3NABL 3IDIB 1NGQL 4FFYH 1TFHA 5J56B 4NKIL 4DW2L 1AGFA 2H2PD 1DN0B 4XMKH 4XWOD 3SGDH 1QQDA 4NNYA 2R23A 4HWZB 3IDGB 1GXEA 4PRHD 5I2IA 5H2BB 4QWWC 4OJFL 3QEUA 3O11B 1IC7H 4F15B 5CJXC 1KBGH 1X6NA 3S34L 1GGCL 5INDB 5I16B 4ODBD 2EIEA 1GCFA 5ESAB 1Q94B 4GMTL 5IBTL 3RUGB 1E4WH 3A6BH 1QBAA 4QXGH 4TVPH 5J13C 2C3HA 3DGCR 3QUYB 3WFEH 3HRZA 3UBXI 4YZFE 4TULH 3KPOB 5E08H 3VFWA 1P5UA 4X9IA 2VC2L 3LRSA 4M1CD 4TNWF 4OM1L 1ITCA 5GSRB 5F7KC 3KYAA 3LKSB 1R5WB 4B41A 2DM2A 4WTXA 1J5OL 3B9VA 4M4RA 4LQ1A 3ZKMD 1Q0XH 2DQEH 3OJVC 3UBXG 4Z7OE 5SV3A 5KVGH 3OXRB 4NC1C 3LB6D 2BY3A 3QUZB 1GIGH 3ZMRA 4HQQL 4PY7B 4I18A 3T4YA 4JDTH 4FG6C 4G9FB 2ZUYA 3VDAA 1JF6A 4HGWB 3VRJB 4HWBL 1KPUB 5JDJA 3GSRB 2V5SA 2VJXA 3DECA 4HBQA 4O58L 2HH0L 5GGUA 4ZFZA 1XGRA 3HZMB 4PB9H 3U4BH 4NN5C 3T2PA 4XPTL 2F8OA 2BNQB 4XNZC 3UAJC 2YMXH 1UJ3C 4O5LL 4V2CB 1BFVH 2BCKA 3F58L 2CLZA 2D7QA 1MNUL 1NGZA 4XBPA 5CZVH 1K85A 3Q48A 4XCEA 1ZT7A 4HDIA 3T65A 1IE5A 35C8L 5KS9A 3I50H 3OPZH 3QIWB 3W39A 2QQLL 4WTWA 4MB5A 4LEOB 3A6CL 1M6OB 1DBMH 2ZG1A 1FZJB 1FE8H 3PHQB 5EOCL 1PDKA 1KCRH 3SQOL 5I1JH 4MGXA 5HYSG 2VB5A 1YQVL 4GO6B 5CZXD 2OS7A 3OF6D 1ZA3B 5E5MA 2AXFB 4HKZA 1EHNA 2H26B 2CDEB 2OL3H 5DD3L 1JRHL 5IK3A 1ORQA 4DZ8A 1OAKH 3C60D 2K3TA 3ZYIA 1CFBA 1II4E 1RZIB 4GJTB 5F1IA 2VZTA 3C60A 4KVNH 4K23L 1PVHA 2E8YA 3SOBH 4P5KB 4WW2C 1WV7T 1CK0H 5C0FA 3P4NA 7CGTA 1PJ9A 1AI1H 1MFAL 1WFNA 3M8OH 4M1GH 1IC7L 2NXZD 3HC3L 5D1QB 2ARWA 4JLRA 2CMRH 5CWSB 4ETQA 1PSKH 2CO7B 1MY7A 3GJEA 4DTGH 4XP5L 5C07E 4V2BA 1RSFA 1QP1A 3U7YL 3O81A 1TETL 3BPLC 2ICWJ 1U0QA 1Q9OB 4XPFL 4QKXB 3Q1SL 5E6IB 1YMMB 1FNAA 4FQHB 5TQ2L 2MKWA 4PJ7F 3THMH 3BQUC 2V9TA 4EUPG 2W65A 5EB9A 4M1DH 5CD5D 2DLGA 4AIXA 4L3EA 1F8TL 1FN4A 4Y2DB 3RA7L 4AYFA 1U8KA 5EPMB 4OD2A 4NO2B 1BVKB 4EI5D 3VG0L 5ESVB 1MHEA 4NGHH 2WLYA 4FNLH 5JPMB 3HCVB 3V6OE 2ICWI 3QXDA 2FJHB 2R2BB 1F3RB 5GRJL 4M3KB 3NGBC 5EUOF 4GAYB 2WBJC 4OCSL 15C8L 3SCMD 3TFKC 3VXSE 3MQIA 1WGOA 1YEFL 3BVNB 5D7KE 3QDJB 1UH4A 3V95A 1S7XB 3PWJB 3OKKA 1E27A 1QNZL 2HFEA 4ZOCA 3FAWA 3LH2H 1NBQA 4XNYH 3G6AA 2F5BH 3G6JB 4LSUL 3BSZH 3JUYA 4MAYA 3TBYA 1WIPA 2I26N 3BP7B 4NCDA 4PTUA 5JORA 5D7JB 4RAVB 3DX8A 4CN6A 2Q6WA 1Y6KR 5CIPB 1RPQA 3BZFA 4WUUD 1UCTA 1WZLA 5JW4N 1UKQA 3N1MC 4FMKA 2YK1L 3U79A 3CVHA 4GRWB 4A2MA 2NY6B 1N8ZA 4YXKL 4CAGA 3RDTB 3J8F7 2GUOA 4PRPB 4NC2B 2E27L 3HNVL 4NIKB 3VXTA 5DJZA 3BPOB 4M6OL 5L2KB 3GNML 1I9JL 2FLBT 3R0NA 1E4JA 1B2WH 3ARFB 4X99A 3D3VB 1I1RA 3C9NB 5FYKE 4U6YA 5JHDE 1ZHLA 1F3DJ 1MF2L 5E7FA 5JXAL 5JTWA 3DHJA 4F8TA 2X40A 2GJ6A 1K5NB 3GSVB 5E4EB 4PJFB 1MCJA 4LARL 4DEPC 5TJWK 5H8DA 1G7PA 2EZ0D 2IF7A 2H9GA 5CUSL 4X4XB 2MOVA 4HUUA 1T04A 1SBSL 2YS4A 3MRIA 1G9EA 4F7EB 2OSLB 4L9DA 4YHMH 4OQTA 3IFOA 3SO3B 1U58A 3PWLB 2JCCB 4QRTA 4RFEA 4BFBD 3MRMB 4GG6B 4CU6A 3I6GB 5EOTA 4OUOA 5LQBH 1DZBA 5F1NB 4PJEA 2H6PB 5I9QC 4UDUA 2Y07L 4G8FA 2PW2A 4OFPA 3IRZA 1T83C 1I8LA 2VDKH 4H88L 3Q3GA 5IFHH 2FJFB 1NLDL 4PJBB 3X3FH 1L6ZA 1CI5A 2D0GA 4FQIH 3G5ZB 1O0VA 5JOFB 3UP1A 1D5MB 1N2RB 3KPTA 3U7YH 1J5OH 2NY1D 4JHWH 5GIRA 5TE6L 3VFUA 1QLRB 4F7TB 3SPVB 1P5VA 2LU3A 3ZE1F 5I1EH 3WO3B 2V5MA 4Y5YA 3RX7A 3IJYB 4LHUG 4LSQL 5EC2B 1FH5H 3I2CH 1KGCD 3MV8B 3AU1A 1XH3A 5L0QB 5MEQA 5J12B 4U6VL 2Z8SA 4JHZA 1QA9B 4GXVL 3BO8A 1FGNL 4GMTH 5DVNA 2ADGA 3VI4E 3QZWA 3WFEL 3WFHA 5I1CH 3CFJA 4Z5RA 4JKPL 2O5YL 2FIKA 2M1KA 5JW5A 1CG9B 1CL7I 4LSSL 3VW3L 4WW2A 2F8VA 3O3BB 5MP6L 5D5MB 2DLHA 1MFNA 5HI4D 1G7HA 1CICD 1A4JB 4NQVB 2MQ3A 4DN3L 1MJJA 3P4OA 5A2KH 4NO0D 2XOTA 4EIGB 3JV5A 2QQLH 1PLGH 3NABH 1HHJA 4JFPB 2HMIC 4FQLH 5GGTH 2HT2C 3ULSB 4LLQB 1HEZB 5FYLL 3GK8L 4OGYL 3SDDC 1FAIH 3IKKA 2AEQH 1UFUA 3NZHL 1BVLB 2HFFB 5H94B 4MNQE 3UTOA 3OG6B 3NA9L 1W72B 4J3WA 1U8JB 3LN5B 4HKBA 1XF5A 1U8HA 4P5KA 4ODSH 1OGAB 4PJCE 3V0AC 3KR3H 4Z6AT 3IU3B 3BFOA 1XF3A 1VERA 2GQHA 3NCFB 4JREB 4O9HH 1A1NB 2HAZA 3WFZA 5BZWA 4KRMB 5FYKH 4PJXE 3OHXB 1A2YB 3KG5A 3IFLH 4YO0B 3FO1B 6FABH 3CDGA 4X8JA 1KCSL 1N6QH 2ARJB 3C8DA 2F5AH 4IBLT 1MF2H 3P4MA 3QEQB 3EO9H 5I75C 1MJUL 4YDLB 2JELL 5E6IA 1MRFH 3I9GH 2YA0A 4ZFGL 4YAQB 4GXUM 1A02N 5MENB 2NY4B 3SCMC 3M8OL 2R69L 1Y6MR 3HN3A 1RZGB 5ELIA 3TT3H 4X5LA 4XXCA 2HT3D 3ZKXB 3MV7E 2YUXA 1QBMH 1MCLA 4HIEB 1Q1JH 5BQ7B 1ZT4A 3H7LA 1CIDA 3HE6A 1A6WL 2EH8L 3BWAB 4PJ7E 2ZKHL 2VLJE 2ICEA 4PR5A 4D0BB 3TESA 1YEJL 3HE6D 3NFPA 3H8NA 5EO1A 4X6EB 3QQ4B 4MVBC 4N0YH 1UEMA 4K3HA 2R2HB 1U8MA 4WHDA 3L3GB 4XCYB 4XVTH 3MRRA 1QLFA 1V3MA 5I66A 1VFUA 5E2JA 2HFGL 5IVZB 8CGTA 4U0QB 3QDMD 3DX7B 4PP2B 2BSSA 4U2YA 4Y19D 1IFHL 5HHQB 2PTTB 3PDOA 4Y89A 2Y06H 4BQCA 15C8H 1H3VA 2ZCLH 1UWXH 4K3JH 4C56D 5D5ME 4CNIB 1N4XH 4JJHA 5J11C 1ZMYA 5E99H 3NH7H 4O2CB 3QI9B 1QSEA 1YPZB 3BRFA 2QR0B 1WZ1H 3MJ9H 1OPGL 3B9AA 3RTQB 1C7SA 4MQXD 3SDCD 4DQOL 1QRNE 4QOKE 4EEEA 1UZ8A 5IJKC 4UNTA 3O4OC 4JFDE 4S2SB 2YRZA 4U1LA 3U6RA 3WNOA 3VH8B 4R96B 5HVHB 1LP9F 4NRYB 3OR6A 2P45B 3ARVA 4D9QE 4XAWH 4HWEH 1J18A 1K4CA 5J6HB 2UZYB 5L6YH 4LSPH 5GQBA 1KIRB 1BBJA 4FP8H 4WO4B 1FNEA 4JY4A 2VLJD 4ZUSB 1PEWA 2X4TA 4X8XA 3ZTJG 4Z95L 4EDXB 2JK5B 4WFFE 1YYLL 2VXVL 1HHKB 4OZHB 2CH8A 1IC4H 4PJEF 4HZAA 1B2WL 1Z5LA 2PXYD 2FH6A 1N64H 1F6AB 1TJHH 4RGMB 4KUZH 5C70A 1LILA 5IOPA 4QO1A 4GXUN 3HI6L 4FFWC 4G42A 1TQCB 4HS6B 4H0GA 3PABB 1HILB 3K4ZA 2JB5L 4K07A 3PWPD 1I3RA 4KJYA 2VLKE 4U6VH 2CKNA 4KV5E 5EG6C 4RQQA 2ZUWA 3BUTA 3CPLA 12E8H 1S7QA 3R1GH 3G6DH 2BJMH 2IPKA 2FBJH 4QTIH 4Z7VB 1S7TB 4JRXD 5ETUB 3SDYL 1NCDL 4CVXA 1MCOL 4POYA 5E8OA 4NM8L 4RX4A 2XI9A 3RY4A 4K7PX 4XZUA 4XC3L 2V5RA 4W6WB 2F5AL 2UWEA 4QF1B 5F6IC 4RX4D 1FL5B 1ZWIA 2C26A 4NQCE 1IQWH 3UPRA 5LCVH 2VDPH 5DJDA 4GAGH 1RUML 4HULB 3D3VA 3QNYA 2ICWA 2CD0A 4P2RE 4FQQA 3R0MA 1H3PL 3EFDH 4R7DA 5IG7A 4K3DL 3PHSA 3RU8H 1BFOB 2FSEA 3QUXD 4GBXC 3Q3GB 2BSTA 1TVHA 3BH9A 3PV6B 3ARPA 2X9WA 4QY8A 4K7PH 2X4SA 3O8XC 4QHKI 3LKOB 4CVZB 1J05A 2DM4A 3RVVC 4KQ3H 3GJFB 1U58B 2WWKO 2J88H 4QHNA 5CSGA 1RUKL 1I7RB 4YE4H 5F71A 1DLHA 1KTDB 1FO0A 5HDQH 3HB3C 5FA4A 3SJVA 4XH2B 1DQMH 1J1XH 4GLRI 5DA4A 3F7YA 3M17B 4WU5A 1CGSH 1CU4L 1WWCA 1ZTXL 3QDJE 5AUMB 5AG9A 3ARSA 3SJVD 4UIKL 4BZ1H 3LN5A 1IT9L 3BKCH 2VXSL 1AR1C 2JJSC 2MCG1 4OUUB 2HYMA 2ZUQB 5HYJD 4JFFE 1A3LL 1UCBL 2ENSA 2LTQC 3QXWA 2A9MH 5CS7A 4TVPL 4BZ2H 5JZ7C 1DLFH 1VB9A 3ZE0F 5HVWA 1KEMH 3F62A 4JJ5B 4HMEA 5DXWA 3FO1A 5TQ0H 1J88A 2CK0L 4ONFL 4HK3J 2H2SD 3VFVB 3J7HA 4NRZA 1DDHA 4P2OC 3MREA 5FUOL 3MMEA 1ETZA 4LLVB 1W2KT 4I2XE 5LAXA 2HVJB 4YBQD 4I3RL 2LFGA 5H35B 4L8BA 4XMKL 3IAGC 3U9UA 3ZDYF 2AK1L 2Q8AH 4ZFFA 2R8SL 2BSRA 1CR9L 1RZGA 3IS1X 4UUJA 4HZLB 3UYPA 4EUPA 4GQ9H 1HQ4A 1NFIB 4MX7B 1FG9C 4PY8I 3QA3A 3IFLL 3MROB 2BNRA 2NY6C 3B9KD 5C0IB 2QKIA 3O41B 4ZFOB 3P4OB 4EBQL 1G7LB 3U0PB 4OGAD 2VIRB 2O93L 5E1HB 1UACL 3PL6B 3EOAB 4DCQB 2BHZA 4HWBH 3B3IA 3F8UB 4UILH 4Z78A 3OX8A 1CDUA 2R29L 1W72A 4WFEE 1P7KB 3VI4F 1J0YA 4JQVC 4DFIA 2FEDD 3QJHB 4DKEL 3QO1A 4JVPA 5E4EC 1X5GA 3STZB 2FIRT 4JANB 2OI9B 4QXUH 4LIQE 1T2QH 4K3GA 4XCEB 4G9DB 5FYJD 5F3HB 4Z77A 3KPNB 3QDGD 4PJHA 3TO4B 1LO4H 3H3BC 3OF6A 4KXZI 1CICC 4DGVL 4ORGA 1MLCB 3VE0B 2O5YH 3MOAL 3FCTB 3HA0A 5EZLA 3LRGA 3H9SE 4DN4L 3MV8E 4X83A 1CF8H 5IM7B 2CLVB 3REWB 3O6LL 1REIA 5KG9A 1KXVC 2QSTA 2AXFA 4HKZB 4U1GC 3WFHB 1NSNH 5I71C 4I9WD 5KVMC 5I8EA 1RUQH 4CDHA 2O26U 3G08B 1K3ZA 2WK2A 3WS6A 5C09B 3IB4A 1I7ZB 1YA5A 2Q76A 5TDNA 4QXGL 5I18H 1Q0YH 1PX3A 4KTEL 1MWAB 2XXMB 4NBZB 2ZCHL 4HF5L 5DSCA 4UTAL 1J9CT