1FS1A

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLIN A/CDK2-ASSOCIATED P19
publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 41
sequence length 41
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fs1A00
3V7DB 2P1QB 3OGKB 2E31A 3WSOA 5IBKB 3C6NB 3MKSB 2P1NB 2P1PB 3C6PB 3OGMB 2OVPB 2P1MB 1FS1A 3OGLB 1P22A 2P1OB 4I6JB 2OVRB 3C6OB 1NEXB 2E32A 1LDKE 2OVQB 3L2OB
chains in the Genus database with same CATH superfamily
1WAJA 5H37A 4AKGA 1FYZE 3SVIA 2DTUA 1FZ9E 4FK4A 3WSOA 5IBKB 4JS5A 4M3YA 4RNGA 4KHUA 3L8BA 3C6NB 4FJKA 3QEVA 3SUPA 3NCIA 4M3TA 3HGKE 3QNNA 4ADOA 3TL8B 3S9HA 3C6PB 3LD8A 4DTMA 4FJLA 1XU5E 3NAEA 1FZ5E 1FZ1E 2MMBA 2OVPB 4DTPA 1JW2A 4ICGC 2P5OA 3OGLB 1P22A 3L1NA 4FJ9A 2RKHA 2LF3A 4JRPA 4QNDA 3RMCA 4I6JB 2OVRB 2OYQA 4DTXA 1XVGE 4FK0A 3QEIA 3BVOA 2DEBA 4EYWA 3NGIA 1XU3E 2OVQB 2B8IA 3L2OB 3N1BA 1FXXA 2FW3A 4FVMA 4FJIA 4FJNA 3HP9A 4AKIA 4QNCA 1MTYG 3RMBA 3QERA 3N1EA 1FPOA 3LDBA 4FJ7A 3TAFA 3UO2A 4FJHA 2LF6A 3SI6A 4RL5A 4DU4A 4X5NA 3QESA 4AKHA 3K2OA 4FJ5A 3CFRA 3NE6A 2QXFA 3C94A 3HL8A 2JHCA 1FZ4E 1FZIE 3OGMB 5IZ7A 1MMOG 4KHQA 3SPYA 3SUQA 4J2DA 3TABA 1Q9YA 2OZSA 4M3UA 1FZ6E 3E4YA 4DU3A 3SCXA 4FJ8A 4FJMA 2P1OB 3KD1E 4B08A 1XVFE 4JS4A 1MHZG 4KHYA 3CFOA 4DTJA 1LDKE 4M3XA 3QEXA 4DTUA 3HGLA 3LZJA 4DTNA 3TAEA 3SQ4A 1MHYG 4M45A 3NHGA 3RMAA 1FZ8E 4FJXA 3QEPA 2JQTA 2YB5A 3CQ8A 3OGKB 3SUOA 3TAGA 2PFVA 2JPNA 3SJJA 1WAFA 2K5SA 3SUNA 4M3WA 3TJYA 1XL3C 3L0MA 3SQ2A 4GAMC 4EP9A 3SQ1A 2H4TA 3QETA 1FZ0E 2P1NB 3SQ0A 1XMFE 1XVCE 2P1PB 4E4BA 4HCBA 2DY4A 3J27A 4IT5A 4EPHA 3SNNA 4KI6A 4KI4A 3LZIA 2P1MB 1FS1A 1XVEE 2B7MA 3QEWA 4KHSA 2VJ5A 3UIQA 1FZ3E 2JH9A 4AI6A 3J2PA 2VIXA 4M42A 4X5MA 4ADNA 4M3ZA 1NEXB 3C95A 3UO3A 2E32A 4RG8A 4JRQA 4M41A 1XVDE 4FJJA 4DU1A 4I9LA 4E3SA 3V7DB 4J2EA 1N1CA 2P1QB 2P5GA 4I9QA 3RMDA 2MW2A 1IG9A 1XMHE 2E31A 2ATQA 1XMGE 2JH8A 2OZMA 4J2AA 2JHAA 2RCUA 2JHPA 2VJ4A 1FZ2E 2FYOA 4DTRA 4FJGA 5IREA 3MKSB 4DTOA 4KHWA 4J2BA 2HD0A 3KD5E 3QNOA 4HCCA 4KHNA 3SPZA 3NDKA 3E4WA 3CFPA 1FZHE 3LDSA 2MZWB 4FK2A 2B1EA 1Q9XA 3RWUA 1FZ7E 3C6OB 4DTSA 4M3RA 2PFTA 1IH7A 1CLQA 1XVBE
chains in the Genus database with same CATH topology
1WAJA 5H37A 4AKGA 1FYZE 3SVIA 2DTUA 1FZ9E 4FK4A 3WSOA 5IBKB 4JS5A 4M3YA 4RNGA 4KHUA 3L8BA 3C6NB 4FJKA 3QEVA 3SUPA 3NCIA 4M3TA 3HGKE 3QNNA 4ADOA 3TL8B 3S9HA 3C6PB 3LD8A 4DTMA 4FJLA 1XU5E 3NAEA 1FZ5E 1FZ1E 2MMBA 2OVPB 4DTPA 2P5OA 3OGLB 1P22A 3L1NA 4FJ9A 2LF3A 4JRPA 4QNDA 3RMCA 4I6JB 2OVRB 2OYQA 4DTXA 1XVGE 4FK0A 3QEIA 2DEBA 4EYWA 3NGIA 1XU3E 2OVQB 2B8IA 3L2OB 3N1BA 1FXXA 2FW3A 4FVMA 4FJIA 4FJNA 3HP9A 4AKIA 4QNCA 1MTYG 3RMBA 3QERA 3N1EA 3LDBA 4FJ7A 3TAFA 4FJHA 2LF6A 3SI6A 4RL5A 4DU4A 4X5NA 3QESA 4AKHA 3K2OA 4FJ5A 3CFRA 3NE6A 2QXFA 3C94A 3HL8A 2JHCA 1FZ4E 1FZIE 3OGMB 5IZ7A 1MMOG 4KHQA 3SPYA 3SUQA 4J2DA 3TABA 1Q9YA 2OZSA 4M3UA 1FZ6E 3E4YA 4DU3A 3SCXA 4FJ8A 4FJMA 2P1OB 3KD1E 4B08A 1XVFE 4JS4A 1MHZG 4KHYA 3CFOA 4DTJA 1LDKE 4M3XA 3QEXA 4DTUA 3HGLA 3LZJA 4DTNA 3TAEA 3SQ4A 1MHYG 4M45A 3NHGA 3RMAA 1FZ8E 4FJXA 3QEPA 3CQ8A 2YB5A 3OGKB 3SUOA 3TAGA 2PFVA 2JPNA 3SJJA 1WAFA 3SUNA 4M3WA 3TJYA 1XL3C 3L0MA 3SQ2A 4GAMC 4EP9A 3SQ1A 2H4TA 3QETA 1FZ0E 2P1NB 3SQ0A 1XMFE 1XVCE 2P1PB 4E4BA 4HCBA 2DY4A 3J27A 4EPHA 3SNNA 4KI6A 4KI4A 3LZIA 2P1MB 1FS1A 1XVEE 2B7MA 3QEWA 4KHSA 2VJ5A 3UIQA 1FZ3E 2JH9A 4AI6A 3J2PA 2VIXA 4M42A 4X5MA 4ADNA 4M3ZA 1NEXB 3C95A 2E32A 4RG8A 4JRQA 4M41A 1XVDE 4FJJA 4DU1A 4I9LA 4E3SA 3V7DB 4J2EA 2P1QB 2P5GA 4I9QA 3RMDA 1IG9A 1XMHE 2E31A 2ATQA 1XMGE 2JH8A 2OZMA 4J2AA 2JHAA 2RCUA 2JHPA 2VJ4A 1FZ2E 2FYOA 4DTRA 4FJGA 5IREA 3MKSB 4DTOA 4KHWA 4J2BA 2HD0A 3KD5E 3QNOA 4HCCA 4KHNA 3SPZA 3NDKA 3E4WA 3CFPA 1FZHE 3LDSA 2MZWB 4FK2A 2B1EA 1Q9XA 3RWUA 1FZ7E 3C6OB 4DTSA 4M3RA 2PFTA 1IH7A 1CLQA 1XVBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7D B;  2P1Q B;  3OGK B;  2E31 A;  3WSO A;  5IBK B;  3C6N B;  3MKS B;  2P1N B;  2P1P B;  3C6P B;  3OGM B;  2OVP B;  2P1M B;  1FS1 A;  3OGL B;  1P22 A;  2P1O B;  4I6J B;  2OVR B;  3C6O B;  1NEX B;  2E32 A;  1LDK E;  2OVQ B;  3L2O B; 
#chains in the Genus database with same CATH topology
 1WAJ A;  5H37 A;  4AKG A;  1FYZ E;  3SVI A;  2DTU A;  1FZ9 E;  4FK4 A;  3WSO A;  5IBK B;  4JS5 A;  4M3Y A;  4RNG A;  4KHU A;  3L8B A;  3C6N B;  4FJK A;  3QEV A;  3SUP A;  3NCI A;  4M3T A;  3HGK E;  3QNN A;  4ADO A;  3TL8 B;  3S9H A;  3C6P B;  3LD8 A;  4DTM A;  4FJL A;  1XU5 E;  3NAE A;  1FZ5 E;  1FZ1 E;  2MMB A;  2OVP B;  4DTP A;  1JW2 A;  4ICG C;  2P5O A;  3OGL B;  1P22 A;  3L1N A;  4FJ9 A;  2RKH A;  2LF3 A;  4JRP A;  4QND A;  3RMC A;  4I6J B;  2OVR B;  2OYQ A;  4DTX A;  1XVG E;  4FK0 A;  3QEI A;  3BVO A;  2DEB A;  4EYW A;  3NGI A;  1XU3 E;  2OVQ B;  2B8I A;  3L2O B;  3N1B A;  1FXX A;  2FW3 A;  4FVM A;  4FJI A;  4FJN A;  3HP9 A;  4AKI A;  4QNC A;  1MTY G;  3RMB A;  3QER A;  3N1E A;  1FPO A;  3LDB A;  4FJ7 A;  3TAF A;  3UO2 A;  4FJH A;  2LF6 A;  3SI6 A;  4RL5 A;  4DU4 A;  4X5N A;  3QES A;  4AKH A;  3K2O A;  4FJ5 A;  3CFR A;  3NE6 A;  2QXF A;  3C94 A;  3HL8 A;  2JHC A;  1FZ4 E;  1FZI E;  3OGM B;  5IZ7 A;  1MMO G;  4KHQ A;  3SPY A;  3SUQ A;  4J2D A;  3TAB A;  1Q9Y A;  2OZS A;  4M3U A;  1FZ6 E;  3E4Y A;  4DU3 A;  3SCX A;  4FJ8 A;  4FJM A;  2P1O B;  3KD1 E;  4B08 A;  1XVF E;  4JS4 A;  1MHZ G;  4KHY A;  3CFO A;  4DTJ A;  1LDK E;  4M3X A;  3QEX A;  4DTU A;  3HGL A;  3LZJ A;  4DTN A;  3TAE A;  3SQ4 A;  1MHY G;  4M45 A;  3NHG A;  3RMA A;  1FZ8 E;  4FJX A;  3QEP A;  2JQT A;  2YB5 A;  3CQ8 A;  3OGK B;  3SUO A;  3TAG A;  2PFV A;  2JPN A;  3SJJ A;  1WAF A;  2K5S A;  3SUN A;  4M3W A;  3TJY A;  1XL3 C;  3L0M A;  3SQ2 A;  4GAM C;  4EP9 A;  3SQ1 A;  2H4T A;  3QET A;  1FZ0 E;  2P1N B;  3SQ0 A;  1XMF E;  1XVC E;  2P1P B;  4E4B A;  4HCB A;  2DY4 A;  3J27 A;  4IT5 A;  4EPH A;  3SNN A;  4KI6 A;  4KI4 A;  3LZI A;  2P1M B;  1FS1 A;  1XVE E;  2B7M A;  3QEW A;  4KHS A;  2VJ5 A;  3UIQ A;  1FZ3 E;  2JH9 A;  4AI6 A;  3J2P A;  2VIX A;  4M42 A;  4X5M A;  4ADN A;  4M3Z A;  1NEX B;  3C95 A;  3UO3 A;  2E32 A;  4RG8 A;  4JRQ A;  4M41 A;  1XVD E;  4FJJ A;  4DU1 A;  4I9L A;  4E3S A;  3V7D B;  4J2E A;  1N1C A;  2P1Q B;  2P5G A;  4I9Q A;  3RMD A;  2MW2 A;  1IG9 A;  1XMH E;  2E31 A;  2ATQ A;  1XMG E;  2JH8 A;  2OZM A;  4J2A A;  2JHA A;  2RCU A;  2JHP A;  2VJ4 A;  1FZ2 E;  2FYO A;  4DTR A;  4FJG A;  5IRE A;  3MKS B;  4DTO A;  4KHW A;  4J2B A;  2HD0 A;  3KD5 E;  3QNO A;  4HCC A;  4KHN A;  3SPZ A;  3NDK A;  3E4W A;  3CFP A;  1FZH E;  3LDS A;  2MZW B;  4FK2 A;  2B1E A;  1Q9X A;  3RWU A;  1FZ7 E;  3C6O B;  4DTS A;  4M3R A;  2PFT A;  1IH7 A;  1CLQ A;  1XVB E; 
#chains in the Genus database with same CATH homology
 1WAJ A;  5H37 A;  4AKG A;  1FYZ E;  3SVI A;  2DTU A;  1FZ9 E;  4FK4 A;  3WSO A;  5IBK B;  4JS5 A;  4M3Y A;  4RNG A;  4KHU A;  3L8B A;  3C6N B;  4FJK A;  3QEV A;  3SUP A;  3NCI A;  4M3T A;  3HGK E;  3QNN A;  4ADO A;  3TL8 B;  3S9H A;  3C6P B;  3LD8 A;  4DTM A;  4FJL A;  1XU5 E;  3NAE A;  1FZ5 E;  1FZ1 E;  2MMB A;  2OVP B;  4DTP A;  2P5O A;  3OGL B;  1P22 A;  3L1N A;  4FJ9 A;  2LF3 A;  4JRP A;  4QND A;  3RMC A;  4I6J B;  2OVR B;  2OYQ A;  4DTX A;  1XVG E;  4FK0 A;  3QEI A;  2DEB A;  4EYW A;  3NGI A;  1XU3 E;  2OVQ B;  2B8I A;  3L2O B;  3N1B A;  1FXX A;  2FW3 A;  4FVM A;  4FJI A;  4FJN A;  3HP9 A;  4AKI A;  4QNC A;  1MTY G;  3RMB A;  3QER A;  3N1E A;  3LDB A;  4FJ7 A;  3TAF A;  4FJH A;  2LF6 A;  3SI6 A;  4RL5 A;  4DU4 A;  4X5N A;  3QES A;  4AKH A;  3K2O A;  4FJ5 A;  3CFR A;  3NE6 A;  2QXF A;  3C94 A;  3HL8 A;  2JHC A;  1FZ4 E;  1FZI E;  3OGM B;  5IZ7 A;  1MMO G;  4KHQ A;  3SPY A;  3SUQ A;  4J2D A;  3TAB A;  1Q9Y A;  2OZS A;  4M3U A;  1FZ6 E;  3E4Y A;  4DU3 A;  3SCX A;  4FJ8 A;  4FJM A;  2P1O B;  3KD1 E;  4B08 A;  1XVF E;  4JS4 A;  1MHZ G;  4KHY A;  3CFO A;  4DTJ A;  1LDK E;  4M3X A;  3QEX A;  4DTU A;  3HGL A;  3LZJ A;  4DTN A;  3TAE A;  3SQ4 A;  1MHY G;  4M45 A;  3NHG A;  3RMA A;  1FZ8 E;  4FJX A;  3QEP A;  3CQ8 A;  2YB5 A;  3OGK B;  3SUO A;  3TAG A;  2PFV A;  2JPN A;  3SJJ A;  1WAF A;  3SUN A;  4M3W A;  3TJY A;  1XL3 C;  3L0M A;  3SQ2 A;  4GAM C;  4EP9 A;  3SQ1 A;  2H4T A;  3QET A;  1FZ0 E;  2P1N B;  3SQ0 A;  1XMF E;  1XVC E;  2P1P B;  4E4B A;  4HCB A;  2DY4 A;  3J27 A;  4EPH A;  3SNN A;  4KI6 A;  4KI4 A;  3LZI A;  2P1M B;  1FS1 A;  1XVE E;  2B7M A;  3QEW A;  4KHS A;  2VJ5 A;  3UIQ A;  1FZ3 E;  2JH9 A;  4AI6 A;  3J2P A;  2VIX A;  4M42 A;  4X5M A;  4ADN A;  4M3Z A;  1NEX B;  3C95 A;  2E32 A;  4RG8 A;  4JRQ A;  4M41 A;  1XVD E;  4FJJ A;  4DU1 A;  4I9L A;  4E3S A;  3V7D B;  4J2E A;  2P1Q B;  2P5G A;  4I9Q A;  3RMD A;  1IG9 A;  1XMH E;  2E31 A;  2ATQ A;  1XMG E;  2JH8 A;  2OZM A;  4J2A A;  2JHA A;  2RCU A;  2JHP A;  2VJ4 A;  1FZ2 E;  2FYO A;  4DTR A;  4FJG A;  5IRE A;  3MKS B;  4DTO A;  4KHW A;  4J2B A;  2HD0 A;  3KD5 E;  3QNO A;  4HCC A;  4KHN A;  3SPZ A;  3NDK A;  3E4W A;  3CFP A;  1FZH E;  3LDS A;  2MZW B;  4FK2 A;  2B1E A;  1Q9X A;  3RWU A;  1FZ7 E;  3C6O B;  4DTS A;  4M3R A;  2PFT A;  1IH7 A;  1CLQ A;  1XVB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...