1FS1A

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
41
structure length
41
Chain Sequence
b'WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLIN A/CDK2-ASSOCIATED P19
publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 11
structure length 41
sequence length 41
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fs1A00
1LDKE 2OVPB 2P1QB 3OGKB 1FS1A 3OGMB 2E31A 2P1MB 1P22A 5IBKB 3OGLB 3MKSB 1NEXB 3C6PB 2P1PB 3WSOA 3C6NB 2P1NB 2E32A 4I6JB 3L2OB 2OVRB 2OVQB 2P1OB 3V7DB 3C6OB
chains in the Genus database with same CATH superfamily
1JW2A 1FYZE 3QEIA 3LDSA 2OVPB 2P1QB 1FS1A 4DU4A 4KI4A 2LF3A 2E31A 2B8IA 4I9LA 3S9HA 3CFOA 1FZ5E 3UIQA 2DY4A 3CFPA 3LZIA 3SQ1A 4FK4A 1FPOA 2JH9A 3HL8A 3SNNA 4M3YA 3QETA 3OGLB 4JS5A 3KD1E 2MW2A 3QNOA 3NDKA 3QERA 4DTPA 3RMBA 3MKSB 2OZSA 4QNDA 4KHQA 4HCCA 3BVOA 2JHCA 4EYWA 4AI6A 4FK2A 4RNGA 4FJHA 2P5GA 2P1NB 3SQ4A 3QNNA 4FJLA 4KHWA 1CLQA 4KI6A 3NAEA 4DTUA 1XMGE 4M3RA 2JH8A 3NGIA 3QEVA 4M3ZA 3C6OB 3SQ0A 1WAJA 4GAMC 2QXFA 4AKHA 3L1NA 4M3WA 2H4TA 3C94A 1P22A 3N1BA 1IG9A 2K5SA 4FJ7A 2FW3A 4M3XA 4KHSA 4J2DA 1XU5E 4EPHA 2B1EA 3SCXA 2LF6A 3J2PA 4KHNA 1XMHE 4FJXA 3CQ8A 5IREA 4FJMA 4E4BA 4JRPA 3K2OA 2P1PB 4J2BA 4DTJA 2JPNA 2MZWB 4M41A 4FJ8A 3C6NB 1MHZG 4FVMA 2E32A 4I6JB 4JS4A 1FZ6E 1XVDE 2JHAA 2PFVA 4RG8A 3SUOA 2ATQA 5H37A 3SI6A 4KHYA 2OVQB 3V7DB 4DU1A 4FJ5A 1XL3C 2HD0A 1LDKE 3N1EA 3SPZA 4J2EA 3SJJA 1FZ2E 2RKHA 3OGMB 1FZ7E 4J2AA 3HGKE 4FJ9A 4DTRA 2P1MB 3E4WA 1MMOG 4RL5A 3TL8B 4ADNA 3KD5E 1XMFE 5IBKB 3L8BA 3RWUA 3NCIA 3J27A 1MHYG 1FZ9E 3SQ2A 1FZ3E 4M45A 4I9QA 4M3TA 5IZ7A 3CFRA 3TABA 4M3UA 4QNCA 2OZMA 3QESA 4DTSA 1FZ0E 1WAFA 4DTNA 1XU3E 3C6PB 1XVFE 4FJNA 4ICGC 2VJ4A 1XVCE 2MMBA 3RMCA 3UO2A 3RMAA 4M42A 4AKGA 4FJJA 2OYQA 3TAEA 3L2OB 4DTMA 2VJ5A 4X5NA 4DU3A 1MTYG 4KHUA 2P1OB 4FJIA 3LDBA 3HGLA 3SVIA 3SUPA 3OGKB 3E4YA 3QEPA 3SPYA 2RCUA 4DTOA 1XVBE 3TJYA 3LZJA 4AKIA 2JQTA 4FJKA 1N1CA 3NE6A 4HCBA 2JHPA 3QEXA 4JRQA 1IH7A 3SUNA 1FZHE 2YB5A 1FZ8E 3TAFA 1FZ4E 1XVGE 2B7MA 3RMDA 1FXXA 3LD8A 3NHGA 1NEXB 3HP9A 3TAGA 3UO3A 1FZ1E 3C95A 4FJGA 3WSOA 1XVEE 1Q9XA 2FYOA 4E3SA 2DTUA 2P5OA 3QEWA 2VIXA 4IT5A 3SUQA 4ADOA 2OVRB 4B08A 4DTXA 3L0MA 4X5MA 2DEBA 1Q9YA 2PFTA 1FZIE 4FK0A 4EP9A
chains in the Genus database with same CATH topology
1FYZE 3QEIA 3LDSA 2OVPB 2P1QB 1FS1A 4DU4A 4KI4A 2LF3A 2E31A 2B8IA 4I9LA 3S9HA 3CFOA 1FZ5E 3UIQA 2DY4A 3CFPA 3LZIA 3SQ1A 4FK4A 2JH9A 3HL8A 3SNNA 4M3YA 3QETA 3OGLB 4JS5A 3KD1E 3QNOA 3NDKA 3QERA 4DTPA 3RMBA 3MKSB 2OZSA 4QNDA 4KHQA 4HCCA 2JHCA 4EYWA 4AI6A 4FK2A 4RNGA 4FJHA 2P5GA 2P1NB 3SQ4A 3QNNA 4FJLA 4KHWA 1CLQA 4KI6A 3NAEA 4DTUA 1XMGE 4M3RA 2JH8A 3NGIA 3QEVA 4M3ZA 3C6OB 3SQ0A 1WAJA 4GAMC 2QXFA 4AKHA 3L1NA 4M3WA 2H4TA 3C94A 1P22A 3N1BA 1IG9A 4FJ7A 4M3XA 2FW3A 4KHSA 4J2DA 1XU5E 4EPHA 2B1EA 3SCXA 2LF6A 3J2PA 4KHNA 1XMHE 4FJXA 3CQ8A 5IREA 4FJMA 4E4BA 4JRPA 3K2OA 2P1PB 4J2BA 4DTJA 2JPNA 2MZWB 4M41A 4FJ8A 3C6NB 1MHZG 4FVMA 2E32A 4I6JB 4JS4A 1FZ6E 1XVDE 2JHAA 2PFVA 4RG8A 3SUOA 2ATQA 5H37A 3SI6A 4KHYA 2OVQB 3V7DB 4DU1A 4FJ5A 1XL3C 2HD0A 1LDKE 3N1EA 3SPZA 4J2EA 3SJJA 1FZ2E 3OGMB 4J2AA 1FZ7E 3HGKE 4FJ9A 4DTRA 2P1MB 3E4WA 1MMOG 4RL5A 3TL8B 4ADNA 3KD5E 1XMFE 5IBKB 3L8BA 3RWUA 3NCIA 3J27A 1MHYG 1FZ9E 3SQ2A 1FZ3E 4M45A 4I9QA 4M3TA 5IZ7A 3CFRA 3TABA 4M3UA 4QNCA 2OZMA 3QESA 4DTSA 1FZ0E 1WAFA 4DTNA 1XU3E 3C6PB 1XVFE 4FJNA 2VJ4A 1XVCE 2MMBA 3RMCA 3RMAA 4M42A 4AKGA 4FJJA 2OYQA 3TAEA 3L2OB 4DTMA 2VJ5A 4X5NA 4DU3A 1MTYG 4KHUA 2P1OB 4FJIA 3LDBA 3HGLA 3SVIA 3SUPA 3OGKB 3E4YA 3QEPA 3SPYA 2RCUA 4DTOA 1XVBE 3TJYA 3LZJA 4AKIA 4FJKA 3NE6A 4HCBA 2JHPA 3QEXA 4JRQA 1IH7A 3SUNA 1FZHE 2YB5A 1FZ8E 3TAFA 1FZ4E 1XVGE 2B7MA 3RMDA 1FXXA 3LD8A 3NHGA 1NEXB 3HP9A 3TAGA 1FZ1E 3C95A 4FJGA 3WSOA 1XVEE 1Q9XA 2FYOA 4E3SA 2DTUA 2P5OA 3QEWA 2VIXA 3SUQA 4ADOA 2OVRB 4B08A 4DTXA 3L0MA 4X5MA 2DEBA 1Q9YA 2PFTA 1FZIE 4FK0A 4EP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LDK E;  2OVP B;  2P1Q B;  3OGK B;  1FS1 A;  3OGM B;  2E31 A;  2P1M B;  1P22 A;  5IBK B;  3OGL B;  3MKS B;  1NEX B;  3C6P B;  2P1P B;  3WSO A;  3C6N B;  2P1N B;  2E32 A;  4I6J B;  3L2O B;  2OVR B;  2OVQ B;  2P1O B;  3V7D B;  3C6O B; 
#chains in the Genus database with same CATH topology
 1JW2 A;  1FYZ E;  3QEI A;  3LDS A;  2OVP B;  2P1Q B;  1FS1 A;  4DU4 A;  4KI4 A;  2LF3 A;  2E31 A;  2B8I A;  4I9L A;  3S9H A;  3CFO A;  1FZ5 E;  3UIQ A;  2DY4 A;  3CFP A;  3LZI A;  3SQ1 A;  4FK4 A;  1FPO A;  2JH9 A;  3HL8 A;  3SNN A;  4M3Y A;  3QET A;  3OGL B;  4JS5 A;  3KD1 E;  2MW2 A;  3QNO A;  3NDK A;  3QER A;  4DTP A;  3RMB A;  3MKS B;  2OZS A;  4QND A;  4KHQ A;  4HCC A;  3BVO A;  2JHC A;  4EYW A;  4AI6 A;  4FK2 A;  4RNG A;  4FJH A;  2P5G A;  2P1N B;  3SQ4 A;  3QNN A;  4FJL A;  4KHW A;  1CLQ A;  4KI6 A;  3NAE A;  4DTU A;  1XMG E;  4M3R A;  2JH8 A;  3NGI A;  3QEV A;  4M3Z A;  3C6O B;  3SQ0 A;  1WAJ A;  4GAM C;  2QXF A;  4AKH A;  3L1N A;  4M3W A;  2H4T A;  3C94 A;  1P22 A;  3N1B A;  1IG9 A;  2K5S A;  4FJ7 A;  2FW3 A;  4M3X A;  4KHS A;  4J2D A;  1XU5 E;  4EPH A;  2B1E A;  3SCX A;  2LF6 A;  3J2P A;  4KHN A;  1XMH E;  4FJX A;  3CQ8 A;  5IRE A;  4FJM A;  4E4B A;  4JRP A;  3K2O A;  2P1P B;  4J2B A;  4DTJ A;  2JPN A;  2MZW B;  4M41 A;  4FJ8 A;  3C6N B;  1MHZ G;  4FVM A;  2E32 A;  4I6J B;  4JS4 A;  1FZ6 E;  1XVD E;  2JHA A;  2PFV A;  4RG8 A;  3SUO A;  2ATQ A;  5H37 A;  3SI6 A;  4KHY A;  2OVQ B;  3V7D B;  4DU1 A;  4FJ5 A;  1XL3 C;  2HD0 A;  1LDK E;  3N1E A;  3SPZ A;  4J2E A;  3SJJ A;  1FZ2 E;  2RKH A;  3OGM B;  1FZ7 E;  4J2A A;  3HGK E;  4FJ9 A;  4DTR A;  2P1M B;  3E4W A;  1MMO G;  4RL5 A;  3TL8 B;  4ADN A;  3KD5 E;  1XMF E;  5IBK B;  3L8B A;  3RWU A;  3NCI A;  3J27 A;  1MHY G;  1FZ9 E;  3SQ2 A;  1FZ3 E;  4M45 A;  4I9Q A;  4M3T A;  5IZ7 A;  3CFR A;  3TAB A;  4M3U A;  4QNC A;  2OZM A;  3QES A;  4DTS A;  1FZ0 E;  1WAF A;  4DTN A;  1XU3 E;  3C6P B;  1XVF E;  4FJN A;  4ICG C;  2VJ4 A;  1XVC E;  2MMB A;  3RMC A;  3UO2 A;  3RMA A;  4M42 A;  4AKG A;  4FJJ A;  2OYQ A;  3TAE A;  3L2O B;  4DTM A;  2VJ5 A;  4X5N A;  4DU3 A;  1MTY G;  4KHU A;  2P1O B;  4FJI A;  3LDB A;  3HGL A;  3SVI A;  3SUP A;  3OGK B;  3E4Y A;  3QEP A;  3SPY A;  2RCU A;  4DTO A;  1XVB E;  3TJY A;  3LZJ A;  4AKI A;  2JQT A;  4FJK A;  1N1C A;  3NE6 A;  4HCB A;  2JHP A;  3QEX A;  4JRQ A;  1IH7 A;  3SUN A;  1FZH E;  2YB5 A;  1FZ8 E;  3TAF A;  1FZ4 E;  1XVG E;  2B7M A;  3RMD A;  1FXX A;  3LD8 A;  3NHG A;  1NEX B;  3HP9 A;  3TAG A;  3UO3 A;  1FZ1 E;  3C95 A;  4FJG A;  3WSO A;  1XVE E;  1Q9X A;  2FYO A;  4E3S A;  2DTU A;  2P5O A;  3QEW A;  2VIX A;  4IT5 A;  3SUQ A;  4ADO A;  2OVR B;  4B08 A;  4DTX A;  3L0M A;  4X5M A;  2DEB A;  1Q9Y A;  2PFT A;  1FZI E;  4FK0 A;  4EP9 A; 
#chains in the Genus database with same CATH homology
 1FYZ E;  3QEI A;  3LDS A;  2OVP B;  2P1Q B;  1FS1 A;  4DU4 A;  4KI4 A;  2LF3 A;  2E31 A;  2B8I A;  4I9L A;  3S9H A;  3CFO A;  1FZ5 E;  3UIQ A;  2DY4 A;  3CFP A;  3LZI A;  3SQ1 A;  4FK4 A;  2JH9 A;  3HL8 A;  3SNN A;  4M3Y A;  3QET A;  3OGL B;  4JS5 A;  3KD1 E;  3QNO A;  3NDK A;  3QER A;  4DTP A;  3RMB A;  3MKS B;  2OZS A;  4QND A;  4KHQ A;  4HCC A;  2JHC A;  4EYW A;  4AI6 A;  4FK2 A;  4RNG A;  4FJH A;  2P5G A;  2P1N B;  3SQ4 A;  3QNN A;  4FJL A;  4KHW A;  1CLQ A;  4KI6 A;  3NAE A;  4DTU A;  1XMG E;  4M3R A;  2JH8 A;  3NGI A;  3QEV A;  4M3Z A;  3C6O B;  3SQ0 A;  1WAJ A;  4GAM C;  2QXF A;  4AKH A;  3L1N A;  4M3W A;  2H4T A;  3C94 A;  1P22 A;  3N1B A;  1IG9 A;  4FJ7 A;  4M3X A;  2FW3 A;  4KHS A;  4J2D A;  1XU5 E;  4EPH A;  2B1E A;  3SCX A;  2LF6 A;  3J2P A;  4KHN A;  1XMH E;  4FJX A;  3CQ8 A;  5IRE A;  4FJM A;  4E4B A;  4JRP A;  3K2O A;  2P1P B;  4J2B A;  4DTJ A;  2JPN A;  2MZW B;  4M41 A;  4FJ8 A;  3C6N B;  1MHZ G;  4FVM A;  2E32 A;  4I6J B;  4JS4 A;  1FZ6 E;  1XVD E;  2JHA A;  2PFV A;  4RG8 A;  3SUO A;  2ATQ A;  5H37 A;  3SI6 A;  4KHY A;  2OVQ B;  3V7D B;  4DU1 A;  4FJ5 A;  1XL3 C;  2HD0 A;  1LDK E;  3N1E A;  3SPZ A;  4J2E A;  3SJJ A;  1FZ2 E;  3OGM B;  4J2A A;  1FZ7 E;  3HGK E;  4FJ9 A;  4DTR A;  2P1M B;  3E4W A;  1MMO G;  4RL5 A;  3TL8 B;  4ADN A;  3KD5 E;  1XMF E;  5IBK B;  3L8B A;  3RWU A;  3NCI A;  3J27 A;  1MHY G;  1FZ9 E;  3SQ2 A;  1FZ3 E;  4M45 A;  4I9Q A;  4M3T A;  5IZ7 A;  3CFR A;  3TAB A;  4M3U A;  4QNC A;  2OZM A;  3QES A;  4DTS A;  1FZ0 E;  1WAF A;  4DTN A;  1XU3 E;  3C6P B;  1XVF E;  4FJN A;  2VJ4 A;  1XVC E;  2MMB A;  3RMC A;  3RMA A;  4M42 A;  4AKG A;  4FJJ A;  2OYQ A;  3TAE A;  3L2O B;  4DTM A;  2VJ5 A;  4X5N A;  4DU3 A;  1MTY G;  4KHU A;  2P1O B;  4FJI A;  3LDB A;  3HGL A;  3SVI A;  3SUP A;  3OGK B;  3E4Y A;  3QEP A;  3SPY A;  2RCU A;  4DTO A;  1XVB E;  3TJY A;  3LZJ A;  4AKI A;  4FJK A;  3NE6 A;  4HCB A;  2JHP A;  3QEX A;  4JRQ A;  1IH7 A;  3SUN A;  1FZH E;  2YB5 A;  1FZ8 E;  3TAF A;  1FZ4 E;  1XVG E;  2B7M A;  3RMD A;  1FXX A;  3LD8 A;  3NHG A;  1NEX B;  3HP9 A;  3TAG A;  1FZ1 E;  3C95 A;  4FJG A;  3WSO A;  1XVE E;  1Q9X A;  2FYO A;  4E3S A;  2DTU A;  2P5O A;  3QEW A;  2VIX A;  3SUQ A;  4ADO A;  2OVR B;  4B08 A;  4DTX A;  3L0M A;  4X5M A;  2DEB A;  1Q9Y A;  2PFT A;  1FZI E;  4FK0 A;  4EP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...