1FS1A

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords CYCLIN A/CDK2-ASSOCIATED P19
total genus 11
structure length 41
sequence length 41
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fs1A00
3L2OB 4I6JB 2OVQB 3C6OB 2P1MB 3OGKB 2OVRB 2P1NB 3C6NB 3OGMB 2E31A 2P1PB 3WSOA 1LDKE 2E32A 3C6PB 2P1OB 1FS1A 2P1QB 3OGLB 2OVPB 3V7DB 1NEXB 5IBKB 1P22A 3MKSB
chains in the Genus database with same CATH superfamily
1Q9YA 4IT5A 4X5MA 2H4TA 3KD5E 2B8IA 4KHNA 2JH8A 2DY4A 1FZ2E 2P1MB 2RKHA 3UO3A 3TABA 4M3UA 4DTMA 4JRPA 2P5OA 4E3SA 3SJJA 3HGLA 3SQ4A 1IG9A 3E4YA 4J2BA 3L8BA 3SPYA 1XVDE 5H37A 5IZ7A 2DTUA 3SQ1A 3NCIA 3NE6A 2E32A 4RNGA 3SUNA 3KD1E 4EPHA 4JS5A 4DTOA 1N1CA 4FJIA 1FZHE 1FZ3E 2QXFA 1FZIE 2HD0A 1MHZG 3SUPA 1FS1A 3SI6A 4FJGA 4RG8A 4AI6A 3RMAA 3SPZA 1FZ0E 2MZWB 3QEIA 2ATQA 4EYWA 1P22A 3SUQA 3HGKE 3MKSB 5IBKB 3L1NA 2MMBA 3SVIA 3RWUA 4I6JB 3BVOA 4DU3A 3CFPA 1XMGE 4QNDA 4JS4A 4M3XA 3CFRA 3TAGA 4FJJA 4M3WA 1XL3C 2PFVA 3OGMB 3TAEA 2E31A 4FJNA 4M3YA 3QESA 4DU4A 4AKIA 1MTYG 2FYOA 1XMFE 3QEPA 2P1PB 3NAEA 1XU5E 3CQ8A 3QNNA 4ADOA 1XU3E 4M41A 3NHGA 3S9HA 4FJ8A 3C95A 4J2DA 3C6PB 4EP9A 5IREA 2P1OB 1CLQA 2JHAA 3SQ2A 4QNCA 4KHWA 2P1QB 2K5SA 4J2EA 3RMCA 3N1EA 4HCCA 4HCBA 3RMDA 4FJ9A 4RL5A 4DTSA 3QNOA 3LDBA 4FJHA 2OVQB 4FJXA 3J2PA 3OGKB 1WAJA 1IH7A 2P1NB 4DTPA 4M3TA 3HP9A 4FJLA 4GAMC 1FZ9E 1WAFA 2FW3A 2LF6A 2VJ4A 4KHQA 4FJMA 2JHPA 3UIQA 1FYZE 3N1BA 4ICGC 4KHSA 3LZIA 3L0MA 2VJ5A 1LDKE 3QERA 3QEVA 1XMHE 3LD8A 4FJ7A 1FPOA 4FK2A 4X5NA 2RCUA 4DTJA 3SUOA 4J2AA 3TJYA 3QEXA 3SQ0A 4DTNA 1FZ7E 1FZ8E 2JQTA 1MHYG 3OGLB 2OVPB 4M45A 3UO2A 3V7DB 3LZJA 2DEBA 3RMBA 2YB5A 1XVBE 3C94A 4AKGA 4M3RA 1FZ5E 1NEXB 4DTXA 3TL8B 1MMOG 2OYQA 4DTRA 1FZ1E 4FJ5A 3L2OB 3QEWA 4KI6A 4I9LA 4JRQA 3TAFA 2JHCA 4DU1A 2OZSA 4KI4A 3C6OB 4M3ZA 2OVRB 2MW2A 4E4BA 3C6NB 1XVGE 4ADNA 2P5GA 3J27A 3NDKA 2B1EA 1FXXA 3CFOA 4B08A 3QETA 4KHUA 2JH9A 3K2OA 1XVFE 2JPNA 3WSOA 1XVCE 3SNNA 4FK0A 4AKHA 3NGIA 4KHYA 4FVMA 4FK4A 1XVEE 4I9QA 1FZ4E 1JW2A 3HL8A 2OZMA 4M42A 4DTUA 2B7MA 2PFTA 1FZ6E 4FJKA 3LDSA 2LF3A 3SCXA 2VIXA 3E4WA 1Q9XA
chains in the Genus database with same CATH topology
1Q9YA 4X5MA 3KD5E 2H4TA 2B8IA 4KHNA 2JH8A 2DY4A 1FZ2E 2P1MB 3TABA 4M3UA 4DTMA 4JRPA 2P5OA 4E3SA 3SJJA 3HGLA 3SQ4A 1IG9A 3E4YA 4J2BA 3L8BA 3SPYA 1XVDE 5H37A 5IZ7A 2DTUA 3SQ1A 3NCIA 3NE6A 2E32A 4RNGA 3SUNA 3KD1E 4EPHA 4JS5A 4DTOA 4FJIA 1FZHE 1FZ3E 2QXFA 1FZIE 2HD0A 1MHZG 3SUPA 1FS1A 3SI6A 4FJGA 4RG8A 4AI6A 3RMAA 3SPZA 1FZ0E 2MZWB 3QEIA 2ATQA 4EYWA 1P22A 3SUQA 3HGKE 3MKSB 5IBKB 3L1NA 2MMBA 3SVIA 3RWUA 4I6JB 4DU3A 3CFPA 1XMGE 4QNDA 4JS4A 4M3XA 3CFRA 3TAGA 4FJJA 4M3WA 1XL3C 2PFVA 3OGMB 3TAEA 2E31A 4FJNA 4M3YA 3QESA 4DU4A 4AKIA 1MTYG 2FYOA 1XMFE 3QEPA 2P1PB 3NAEA 1XU5E 3CQ8A 3QNNA 4ADOA 1XU3E 4M41A 3NHGA 3S9HA 4FJ8A 3C95A 4J2DA 3C6PB 4EP9A 5IREA 2P1OB 1CLQA 2JHAA 3SQ2A 4QNCA 4KHWA 2P1QB 4J2EA 3RMCA 3N1EA 4HCCA 4HCBA 3RMDA 4FJ9A 4RL5A 4DTSA 3QNOA 3LDBA 4FJHA 2OVQB 4FJXA 3J2PA 3OGKB 1WAJA 1IH7A 2P1NB 4DTPA 4M3TA 3HP9A 4FJLA 4GAMC 1FZ9E 1WAFA 2FW3A 2LF6A 2VJ4A 4KHQA 4FJMA 2JHPA 3UIQA 1FYZE 3N1BA 4KHSA 3LZIA 3L0MA 2VJ5A 1LDKE 3QERA 3QEVA 1XMHE 3LD8A 4FJ7A 4FK2A 4X5NA 2RCUA 4DTJA 3SUOA 4J2AA 3TJYA 3QEXA 3SQ0A 4DTNA 1FZ7E 1FZ8E 1MHYG 3OGLB 2OVPB 4M45A 3V7DB 3LZJA 2DEBA 3RMBA 2YB5A 1XVBE 3C94A 4AKGA 4M3RA 1FZ5E 1NEXB 4DTXA 3TL8B 1MMOG 2OYQA 4DTRA 1FZ1E 4FJ5A 3L2OB 3QEWA 4KI6A 4I9LA 4JRQA 3TAFA 2JHCA 4DU1A 2OZSA 4KI4A 3C6OB 4M3ZA 2OVRB 4E4BA 3C6NB 1XVGE 4ADNA 2P5GA 3J27A 3NDKA 2B1EA 1FXXA 3CFOA 4B08A 3QETA 4KHUA 2JH9A 3K2OA 1XVFE 2JPNA 3WSOA 1XVCE 3SNNA 4FK0A 4AKHA 3NGIA 4KHYA 4FVMA 4FK4A 1XVEE 4I9QA 1FZ4E 3HL8A 2OZMA 4M42A 4DTUA 2B7MA 2PFTA 1FZ6E 4FJKA 3LDSA 2LF3A 3SCXA 2VIXA 3E4WA 1Q9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2O B;  4I6J B;  2OVQ B;  3C6O B;  2P1M B;  3OGK B;  2OVR B;  2P1N B;  3C6N B;  3OGM B;  2E31 A;  2P1P B;  3WSO A;  1LDK E;  2E32 A;  3C6P B;  2P1O B;  1FS1 A;  2P1Q B;  3OGL B;  2OVP B;  3V7D B;  1NEX B;  5IBK B;  1P22 A;  3MKS B; 
#chains in the Genus database with same CATH topology
 1Q9Y A;  4IT5 A;  4X5M A;  2H4T A;  3KD5 E;  2B8I A;  4KHN A;  2JH8 A;  2DY4 A;  1FZ2 E;  2P1M B;  2RKH A;  3UO3 A;  3TAB A;  4M3U A;  4DTM A;  4JRP A;  2P5O A;  4E3S A;  3SJJ A;  3HGL A;  3SQ4 A;  1IG9 A;  3E4Y A;  4J2B A;  3L8B A;  3SPY A;  1XVD E;  5H37 A;  5IZ7 A;  2DTU A;  3SQ1 A;  3NCI A;  3NE6 A;  2E32 A;  4RNG A;  3SUN A;  3KD1 E;  4EPH A;  4JS5 A;  4DTO A;  1N1C A;  4FJI A;  1FZH E;  1FZ3 E;  2QXF A;  1FZI E;  2HD0 A;  1MHZ G;  3SUP A;  1FS1 A;  3SI6 A;  4FJG A;  4RG8 A;  4AI6 A;  3RMA A;  3SPZ A;  1FZ0 E;  2MZW B;  3QEI A;  2ATQ A;  4EYW A;  1P22 A;  3SUQ A;  3HGK E;  3MKS B;  5IBK B;  3L1N A;  2MMB A;  3SVI A;  3RWU A;  4I6J B;  3BVO A;  4DU3 A;  3CFP A;  1XMG E;  4QND A;  4JS4 A;  4M3X A;  3CFR A;  3TAG A;  4FJJ A;  4M3W A;  1XL3 C;  2PFV A;  3OGM B;  3TAE A;  2E31 A;  4FJN A;  4M3Y A;  3QES A;  4DU4 A;  4AKI A;  1MTY G;  2FYO A;  1XMF E;  3QEP A;  2P1P B;  3NAE A;  1XU5 E;  3CQ8 A;  3QNN A;  4ADO A;  1XU3 E;  4M41 A;  3NHG A;  3S9H A;  4FJ8 A;  3C95 A;  4J2D A;  3C6P B;  4EP9 A;  5IRE A;  2P1O B;  1CLQ A;  2JHA A;  3SQ2 A;  4QNC A;  4KHW A;  2P1Q B;  2K5S A;  4J2E A;  3RMC A;  3N1E A;  4HCC A;  4HCB A;  3RMD A;  4FJ9 A;  4RL5 A;  4DTS A;  3QNO A;  3LDB A;  4FJH A;  2OVQ B;  4FJX A;  3J2P A;  3OGK B;  1WAJ A;  1IH7 A;  2P1N B;  4DTP A;  4M3T A;  3HP9 A;  4FJL A;  4GAM C;  1FZ9 E;  1WAF A;  2FW3 A;  2LF6 A;  2VJ4 A;  4KHQ A;  4FJM A;  2JHP A;  3UIQ A;  1FYZ E;  3N1B A;  4ICG C;  4KHS A;  3LZI A;  3L0M A;  2VJ5 A;  1LDK E;  3QER A;  3QEV A;  1XMH E;  3LD8 A;  4FJ7 A;  1FPO A;  4FK2 A;  4X5N A;  2RCU A;  4DTJ A;  3SUO A;  4J2A A;  3TJY A;  3QEX A;  3SQ0 A;  4DTN A;  1FZ7 E;  1FZ8 E;  2JQT A;  1MHY G;  3OGL B;  2OVP B;  4M45 A;  3UO2 A;  3V7D B;  3LZJ A;  2DEB A;  3RMB A;  2YB5 A;  1XVB E;  3C94 A;  4AKG A;  4M3R A;  1FZ5 E;  1NEX B;  4DTX A;  3TL8 B;  1MMO G;  2OYQ A;  4DTR A;  1FZ1 E;  4FJ5 A;  3L2O B;  3QEW A;  4KI6 A;  4I9L A;  4JRQ A;  3TAF A;  2JHC A;  4DU1 A;  2OZS A;  4KI4 A;  3C6O B;  4M3Z A;  2OVR B;  2MW2 A;  4E4B A;  3C6N B;  1XVG E;  4ADN A;  2P5G A;  3J27 A;  3NDK A;  2B1E A;  1FXX A;  3CFO A;  4B08 A;  3QET A;  4KHU A;  2JH9 A;  3K2O A;  1XVF E;  2JPN A;  3WSO A;  1XVC E;  3SNN A;  4FK0 A;  4AKH A;  3NGI A;  4KHY A;  4FVM A;  4FK4 A;  1XVE E;  4I9Q A;  1FZ4 E;  1JW2 A;  3HL8 A;  2OZM A;  4M42 A;  4DTU A;  2B7M A;  2PFT A;  1FZ6 E;  4FJK A;  3LDS A;  2LF3 A;  3SCX A;  2VIX A;  3E4W A;  1Q9X A; 
#chains in the Genus database with same CATH homology
 1Q9Y A;  4X5M A;  3KD5 E;  2H4T A;  2B8I A;  4KHN A;  2JH8 A;  2DY4 A;  1FZ2 E;  2P1M B;  3TAB A;  4M3U A;  4DTM A;  4JRP A;  2P5O A;  4E3S A;  3SJJ A;  3HGL A;  3SQ4 A;  1IG9 A;  3E4Y A;  4J2B A;  3L8B A;  3SPY A;  1XVD E;  5H37 A;  5IZ7 A;  2DTU A;  3SQ1 A;  3NCI A;  3NE6 A;  2E32 A;  4RNG A;  3SUN A;  3KD1 E;  4EPH A;  4JS5 A;  4DTO A;  4FJI A;  1FZH E;  1FZ3 E;  2QXF A;  1FZI E;  2HD0 A;  1MHZ G;  3SUP A;  1FS1 A;  3SI6 A;  4FJG A;  4RG8 A;  4AI6 A;  3RMA A;  3SPZ A;  1FZ0 E;  2MZW B;  3QEI A;  2ATQ A;  4EYW A;  1P22 A;  3SUQ A;  3HGK E;  3MKS B;  5IBK B;  3L1N A;  2MMB A;  3SVI A;  3RWU A;  4I6J B;  4DU3 A;  3CFP A;  1XMG E;  4QND A;  4JS4 A;  4M3X A;  3CFR A;  3TAG A;  4FJJ A;  4M3W A;  1XL3 C;  2PFV A;  3OGM B;  3TAE A;  2E31 A;  4FJN A;  4M3Y A;  3QES A;  4DU4 A;  4AKI A;  1MTY G;  2FYO A;  1XMF E;  3QEP A;  2P1P B;  3NAE A;  1XU5 E;  3CQ8 A;  3QNN A;  4ADO A;  1XU3 E;  4M41 A;  3NHG A;  3S9H A;  4FJ8 A;  3C95 A;  4J2D A;  3C6P B;  4EP9 A;  5IRE A;  2P1O B;  1CLQ A;  2JHA A;  3SQ2 A;  4QNC A;  4KHW A;  2P1Q B;  4J2E A;  3RMC A;  3N1E A;  4HCC A;  4HCB A;  3RMD A;  4FJ9 A;  4RL5 A;  4DTS A;  3QNO A;  3LDB A;  4FJH A;  2OVQ B;  4FJX A;  3J2P A;  3OGK B;  1WAJ A;  1IH7 A;  2P1N B;  4DTP A;  4M3T A;  3HP9 A;  4FJL A;  4GAM C;  1FZ9 E;  1WAF A;  2FW3 A;  2LF6 A;  2VJ4 A;  4KHQ A;  4FJM A;  2JHP A;  3UIQ A;  1FYZ E;  3N1B A;  4KHS A;  3LZI A;  3L0M A;  2VJ5 A;  1LDK E;  3QER A;  3QEV A;  1XMH E;  3LD8 A;  4FJ7 A;  4FK2 A;  4X5N A;  2RCU A;  4DTJ A;  3SUO A;  4J2A A;  3TJY A;  3QEX A;  3SQ0 A;  4DTN A;  1FZ7 E;  1FZ8 E;  1MHY G;  3OGL B;  2OVP B;  4M45 A;  3V7D B;  3LZJ A;  2DEB A;  3RMB A;  2YB5 A;  1XVB E;  3C94 A;  4AKG A;  4M3R A;  1FZ5 E;  1NEX B;  4DTX A;  3TL8 B;  1MMO G;  2OYQ A;  4DTR A;  1FZ1 E;  4FJ5 A;  3L2O B;  3QEW A;  4KI6 A;  4I9L A;  4JRQ A;  3TAF A;  2JHC A;  4DU1 A;  2OZS A;  4KI4 A;  3C6O B;  4M3Z A;  2OVR B;  4E4B A;  3C6N B;  1XVG E;  4ADN A;  2P5G A;  3J27 A;  3NDK A;  2B1E A;  1FXX A;  3CFO A;  4B08 A;  3QET A;  4KHU A;  2JH9 A;  3K2O A;  1XVF E;  2JPN A;  3WSO A;  1XVC E;  3SNN A;  4FK0 A;  4AKH A;  3NGI A;  4KHY A;  4FVM A;  4FK4 A;  1XVE E;  4I9Q A;  1FZ4 E;  3HL8 A;  2OZM A;  4M42 A;  4DTU A;  2B7M A;  2PFT A;  1FZ6 E;  4FJK A;  3LDS A;  2LF3 A;  3SCX A;  2VIX A;  3E4W A;  1Q9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...