1FS1A

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords CYCLIN A/CDK2-ASSOCIATED P19
total genus 11
structure length 41
sequence length 41
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fs1A00
2P1QB 2OVRB 2E31A 5IBKB 1FS1A 3V7DB 3OGKB 2P1OB 2E32A 1LDKE 2P1MB 3MKSB 3C6OB 3C6PB 4I6JB 1P22A 1NEXB 2OVQB 2P1PB 3OGLB 2OVPB 3OGMB 3WSOA 3C6NB 2P1NB 3L2OB
chains in the Genus database with same CATH superfamily
2LF3A 3QEVA 4J2EA 3E4YA 4JS5A 2OZMA 2JHAA 1FZHE 4FK2A 3QESA 2B7MA 3UO3A 3NGIA 1MTYG 3K2OA 3L1NA 5IBKB 1FZIE 1N1CA 1XMFE 4RNGA 3TABA 3SQ0A 3HL8A 4J2AA 4FJ7A 1XVBE 2DEBA 3SUPA 3C94A 3QEIA 4KHNA 3L0MA 4DTRA 2LF6A 3RWUA 3N1EA 4E4BA 2P5OA 4DU1A 4JRQA 3LZJA 1XVEE 1NEXB 3HGKE 2OVQB 4AKIA 3TL8B 3LD8A 1MHZG 2VJ5A 3LDBA 4JS4A 2P1PB 1CLQA 2H4TA 3CFOA 2OZSA 4M3WA 3N1BA 3NHGA 2OVPB 4EPHA 4M3TA 3SPZA 4FK4A 4DTPA 2JQTA 3CQ8A 4FJIA 4J2BA 1FZ2E 2B8IA 3LDSA 2OVRB 2FW3A 2JHPA 2VIXA 2OYQA 2E31A 4E3SA 3SNNA 4EYWA 3SUQA 3V7DB 1FPOA 1WAFA 3HP9A 3RMBA 1MMOG 4AKHA 1XVGE 4QNDA 2QXFA 3QEXA 2HD0A 3C6OB 3MKSB 3J2PA 1FZ7E 4X5NA 4I6JB 1XL3C 4QNCA 4FJLA 2B1EA 3NCIA 3SQ2A 1P22A 4FJJA 5IREA 4J2DA 3QNOA 3HGLA 3OGLB 1MHYG 5IZ7A 3NAEA 3SQ1A 3UIQA 4AI6A 1IG9A 2VJ4A 3C6PB 3L2OB 4M3RA 3KD5E 4KHUA 1FZ8E 4M45A 1XMHE 2RKHA 4RG8A 3NE6A 4ICGC 3CFRA 1Q9XA 3OGKB 4DTXA 4FJNA 2PFVA 2P5GA 4KHYA 1XVDE 4DTMA 2MMBA 2P1OB 3SPYA 4FJ8A 2E32A 1XMGE 1JW2A 4AKGA 2DY4A 2MZWB 4HCCA 2JPNA 4DU3A 3SQ4A 4I9QA 4ADOA 4X5MA 3SVIA 4FJKA 4FJ9A 2JHCA 2JH8A 4DTSA 1XU3E 1XVCE 1XVFE 4M3XA 4DTUA 3BVOA 3TAGA 3C95A 3QERA 3UO2A 3NDKA 3RMAA 4DU4A 3OGMB 4KI6A 2JH9A 3RMCA 4FJMA 3WSOA 3C6NB 4IT5A 2RCUA 2P1QB 1FZ1E 1IH7A 2YB5A 4KI4A 4M3UA 4KHWA 1FZ3E 3TAEA 3KD1E 3J27A 1FZ9E 3S9HA 3TAFA 1FS1A 4M3YA 4HCBA 1XU5E 2K5SA 4DTOA 3SCXA 2DTUA 3LZIA 3TJYA 3CFPA 4I9LA 3RMDA 1WAJA 4M41A 4FJ5A 4M3ZA 4KHQA 1Q9YA 1LDKE 2P1MB 4DTJA 2ATQA 4FJGA 4FK0A 2PFTA 3QEPA 4FVMA 3QEWA 3SJJA 4B08A 4RL5A 1FZ4E 4KHSA 4ADNA 4GAMC 3SI6A 3QETA 1FZ6E 1FYZE 4EP9A 3E4WA 1FZ0E 5H37A 2FYOA 4FJXA 3QNNA 4FJHA 1FZ5E 2MW2A 3SUNA 4M42A 1FXXA 2P1NB 4DTNA 3L8BA 4JRPA 3SUOA
chains in the Genus database with same CATH topology
2LF3A 3QEVA 4J2EA 3E4YA 4JS5A 2OZMA 2JHAA 1FZHE 4FK2A 3QESA 2B7MA 3NGIA 1MTYG 3K2OA 3L1NA 5IBKB 1FZIE 3TABA 1XMFE 4RNGA 3SQ0A 4J2AA 3HL8A 4FJ7A 1XVBE 2DEBA 3SUPA 3C94A 3QEIA 4KHNA 3L0MA 4DTRA 2LF6A 3RWUA 3N1EA 4E4BA 2P5OA 4DU1A 4JRQA 3LZJA 1XVEE 1NEXB 3HGKE 2OVQB 4AKIA 3TL8B 3LD8A 1MHZG 2VJ5A 3LDBA 4JS4A 2P1PB 1CLQA 2H4TA 3CFOA 2OZSA 4M3WA 3N1BA 3NHGA 2OVPB 4EPHA 4M3TA 3SPZA 4FK4A 4DTPA 4FJIA 3CQ8A 4J2BA 1FZ2E 2B8IA 3LDSA 2OVRB 2FW3A 2JHPA 2VIXA 2OYQA 2E31A 4E3SA 3SNNA 4EYWA 3SUQA 3V7DB 1WAFA 3HP9A 3RMBA 1MMOG 4AKHA 1XVGE 4QNDA 2QXFA 3QEXA 2HD0A 3C6OB 3MKSB 3J2PA 1FZ7E 4X5NA 4I6JB 1XL3C 4QNCA 4FJLA 2B1EA 3NCIA 3SQ2A 1P22A 4FJJA 5IREA 4J2DA 3QNOA 3HGLA 3OGLB 1MHYG 5IZ7A 3NAEA 3SQ1A 3UIQA 4AI6A 1IG9A 2VJ4A 3C6PB 3L2OB 4M3RA 3KD5E 4KHUA 1FZ8E 4M45A 1XMHE 4RG8A 3NE6A 3CFRA 1Q9XA 3OGKB 4DTXA 4FJNA 2PFVA 2P5GA 4KHYA 1XVDE 4DTMA 2MMBA 2P1OB 3SPYA 4FJ8A 2E32A 1XMGE 4AKGA 2DY4A 2MZWB 4HCCA 2JPNA 4DU3A 3SQ4A 4I9QA 4ADOA 4X5MA 3SVIA 4FJKA 4FJ9A 2JHCA 2JH8A 4DTSA 1XU3E 1XVCE 1XVFE 4M3XA 4DTUA 3TAGA 3C95A 3QERA 3NDKA 3RMAA 4DU4A 3OGMB 4KI6A 2JH9A 3RMCA 4FJMA 3WSOA 3C6NB 2RCUA 2P1QB 1FZ1E 1IH7A 2YB5A 4KI4A 4M3UA 4KHWA 1FZ3E 3TAEA 3KD1E 3J27A 1FZ9E 3S9HA 3TAFA 1FS1A 4M3YA 4HCBA 1XU5E 3SCXA 4DTOA 2DTUA 3LZIA 3TJYA 3CFPA 4I9LA 3RMDA 1WAJA 4M41A 4FJ5A 4M3ZA 4KHQA 1Q9YA 1LDKE 2P1MB 4DTJA 2ATQA 4FJGA 4FK0A 2PFTA 3QEPA 4FVMA 3QEWA 3SJJA 4B08A 4RL5A 1FZ4E 4KHSA 4ADNA 4GAMC 3SI6A 3QETA 1FZ6E 1FYZE 4EP9A 3E4WA 1FZ0E 5H37A 2FYOA 4FJXA 3QNNA 4FJHA 1FZ5E 3SUNA 4M42A 1FXXA 2P1NB 4DTNA 3L8BA 4JRPA 3SUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1Q B;  2OVR B;  2E31 A;  5IBK B;  1FS1 A;  3V7D B;  3OGK B;  2P1O B;  2E32 A;  1LDK E;  2P1M B;  3MKS B;  3C6O B;  3C6P B;  4I6J B;  1P22 A;  1NEX B;  2OVQ B;  2P1P B;  3OGL B;  2OVP B;  3OGM B;  3WSO A;  3C6N B;  2P1N B;  3L2O B; 
#chains in the Genus database with same CATH topology
 2LF3 A;  3QEV A;  4J2E A;  3E4Y A;  4JS5 A;  2OZM A;  2JHA A;  1FZH E;  4FK2 A;  3QES A;  2B7M A;  3UO3 A;  3NGI A;  1MTY G;  3K2O A;  3L1N A;  5IBK B;  1FZI E;  1N1C A;  1XMF E;  4RNG A;  3TAB A;  3SQ0 A;  3HL8 A;  4J2A A;  4FJ7 A;  1XVB E;  2DEB A;  3SUP A;  3C94 A;  3QEI A;  4KHN A;  3L0M A;  4DTR A;  2LF6 A;  3RWU A;  3N1E A;  4E4B A;  2P5O A;  4DU1 A;  4JRQ A;  3LZJ A;  1XVE E;  1NEX B;  3HGK E;  2OVQ B;  4AKI A;  3TL8 B;  3LD8 A;  1MHZ G;  2VJ5 A;  3LDB A;  4JS4 A;  2P1P B;  1CLQ A;  2H4T A;  3CFO A;  2OZS A;  4M3W A;  3N1B A;  3NHG A;  2OVP B;  4EPH A;  4M3T A;  3SPZ A;  4FK4 A;  4DTP A;  2JQT A;  3CQ8 A;  4FJI A;  4J2B A;  1FZ2 E;  2B8I A;  3LDS A;  2OVR B;  2FW3 A;  2JHP A;  2VIX A;  2OYQ A;  2E31 A;  4E3S A;  3SNN A;  4EYW A;  3SUQ A;  3V7D B;  1FPO A;  1WAF A;  3HP9 A;  3RMB A;  1MMO G;  4AKH A;  1XVG E;  4QND A;  2QXF A;  3QEX A;  2HD0 A;  3C6O B;  3MKS B;  3J2P A;  1FZ7 E;  4X5N A;  4I6J B;  1XL3 C;  4QNC A;  4FJL A;  2B1E A;  3NCI A;  3SQ2 A;  1P22 A;  4FJJ A;  5IRE A;  4J2D A;  3QNO A;  3HGL A;  3OGL B;  1MHY G;  5IZ7 A;  3NAE A;  3SQ1 A;  3UIQ A;  4AI6 A;  1IG9 A;  2VJ4 A;  3C6P B;  3L2O B;  4M3R A;  3KD5 E;  4KHU A;  1FZ8 E;  4M45 A;  1XMH E;  2RKH A;  4RG8 A;  3NE6 A;  4ICG C;  3CFR A;  1Q9X A;  3OGK B;  4DTX A;  4FJN A;  2PFV A;  2P5G A;  4KHY A;  1XVD E;  4DTM A;  2MMB A;  2P1O B;  3SPY A;  4FJ8 A;  2E32 A;  1XMG E;  1JW2 A;  4AKG A;  2DY4 A;  2MZW B;  4HCC A;  2JPN A;  4DU3 A;  3SQ4 A;  4I9Q A;  4ADO A;  4X5M A;  3SVI A;  4FJK A;  4FJ9 A;  2JHC A;  2JH8 A;  4DTS A;  1XU3 E;  1XVC E;  1XVF E;  4M3X A;  4DTU A;  3BVO A;  3TAG A;  3C95 A;  3QER A;  3UO2 A;  3NDK A;  3RMA A;  4DU4 A;  3OGM B;  4KI6 A;  2JH9 A;  3RMC A;  4FJM A;  3WSO A;  3C6N B;  4IT5 A;  2RCU A;  2P1Q B;  1FZ1 E;  1IH7 A;  2YB5 A;  4KI4 A;  4M3U A;  4KHW A;  1FZ3 E;  3TAE A;  3KD1 E;  3J27 A;  1FZ9 E;  3S9H A;  3TAF A;  1FS1 A;  4M3Y A;  4HCB A;  1XU5 E;  2K5S A;  4DTO A;  3SCX A;  2DTU A;  3LZI A;  3TJY A;  3CFP A;  4I9L A;  3RMD A;  1WAJ A;  4M41 A;  4FJ5 A;  4M3Z A;  4KHQ A;  1Q9Y A;  1LDK E;  2P1M B;  4DTJ A;  2ATQ A;  4FJG A;  4FK0 A;  2PFT A;  3QEP A;  4FVM A;  3QEW A;  3SJJ A;  4B08 A;  4RL5 A;  1FZ4 E;  4KHS A;  4ADN A;  4GAM C;  3SI6 A;  3QET A;  1FZ6 E;  1FYZ E;  4EP9 A;  3E4W A;  1FZ0 E;  5H37 A;  2FYO A;  4FJX A;  3QNN A;  4FJH A;  1FZ5 E;  2MW2 A;  3SUN A;  4M42 A;  1FXX A;  2P1N B;  4DTN A;  3L8B A;  4JRP A;  3SUO A; 
#chains in the Genus database with same CATH homology
 2LF3 A;  3QEV A;  4J2E A;  3E4Y A;  4JS5 A;  2OZM A;  2JHA A;  1FZH E;  4FK2 A;  3QES A;  2B7M A;  3NGI A;  1MTY G;  3K2O A;  3L1N A;  5IBK B;  1FZI E;  3TAB A;  1XMF E;  4RNG A;  3SQ0 A;  4J2A A;  3HL8 A;  4FJ7 A;  1XVB E;  2DEB A;  3SUP A;  3C94 A;  3QEI A;  4KHN A;  3L0M A;  4DTR A;  2LF6 A;  3RWU A;  3N1E A;  4E4B A;  2P5O A;  4DU1 A;  4JRQ A;  3LZJ A;  1XVE E;  1NEX B;  3HGK E;  2OVQ B;  4AKI A;  3TL8 B;  3LD8 A;  1MHZ G;  2VJ5 A;  3LDB A;  4JS4 A;  2P1P B;  1CLQ A;  2H4T A;  3CFO A;  2OZS A;  4M3W A;  3N1B A;  3NHG A;  2OVP B;  4EPH A;  4M3T A;  3SPZ A;  4FK4 A;  4DTP A;  4FJI A;  3CQ8 A;  4J2B A;  1FZ2 E;  2B8I A;  3LDS A;  2OVR B;  2FW3 A;  2JHP A;  2VIX A;  2OYQ A;  2E31 A;  4E3S A;  3SNN A;  4EYW A;  3SUQ A;  3V7D B;  1WAF A;  3HP9 A;  3RMB A;  1MMO G;  4AKH A;  1XVG E;  4QND A;  2QXF A;  3QEX A;  2HD0 A;  3C6O B;  3MKS B;  3J2P A;  1FZ7 E;  4X5N A;  4I6J B;  1XL3 C;  4QNC A;  4FJL A;  2B1E A;  3NCI A;  3SQ2 A;  1P22 A;  4FJJ A;  5IRE A;  4J2D A;  3QNO A;  3HGL A;  3OGL B;  1MHY G;  5IZ7 A;  3NAE A;  3SQ1 A;  3UIQ A;  4AI6 A;  1IG9 A;  2VJ4 A;  3C6P B;  3L2O B;  4M3R A;  3KD5 E;  4KHU A;  1FZ8 E;  4M45 A;  1XMH E;  4RG8 A;  3NE6 A;  3CFR A;  1Q9X A;  3OGK B;  4DTX A;  4FJN A;  2PFV A;  2P5G A;  4KHY A;  1XVD E;  4DTM A;  2MMB A;  2P1O B;  3SPY A;  4FJ8 A;  2E32 A;  1XMG E;  4AKG A;  2DY4 A;  2MZW B;  4HCC A;  2JPN A;  4DU3 A;  3SQ4 A;  4I9Q A;  4ADO A;  4X5M A;  3SVI A;  4FJK A;  4FJ9 A;  2JHC A;  2JH8 A;  4DTS A;  1XU3 E;  1XVC E;  1XVF E;  4M3X A;  4DTU A;  3TAG A;  3C95 A;  3QER A;  3NDK A;  3RMA A;  4DU4 A;  3OGM B;  4KI6 A;  2JH9 A;  3RMC A;  4FJM A;  3WSO A;  3C6N B;  2RCU A;  2P1Q B;  1FZ1 E;  1IH7 A;  2YB5 A;  4KI4 A;  4M3U A;  4KHW A;  1FZ3 E;  3TAE A;  3KD1 E;  3J27 A;  1FZ9 E;  3S9H A;  3TAF A;  1FS1 A;  4M3Y A;  4HCB A;  1XU5 E;  3SCX A;  4DTO A;  2DTU A;  3LZI A;  3TJY A;  3CFP A;  4I9L A;  3RMD A;  1WAJ A;  4M41 A;  4FJ5 A;  4M3Z A;  4KHQ A;  1Q9Y A;  1LDK E;  2P1M B;  4DTJ A;  2ATQ A;  4FJG A;  4FK0 A;  2PFT A;  3QEP A;  4FVM A;  3QEW A;  3SJJ A;  4B08 A;  4RL5 A;  1FZ4 E;  4KHS A;  4ADN A;  4GAM C;  3SI6 A;  3QET A;  1FZ6 E;  1FYZ E;  4EP9 A;  3E4W A;  1FZ0 E;  5H37 A;  2FYO A;  4FJX A;  3QNN A;  4FJH A;  1FZ5 E;  3SUN A;  4M42 A;  1FXX A;  2P1N B;  4DTN A;  3L8B A;  4JRP A;  3SUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...