1FS2A

Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
259
Chain Sequence
PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDEFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SKP2
publication title Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 96
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fs2A00
4ARNA 1OOKG 1W8AA 1M10B 3ULUA 1OZNA 2WFHA 3E6JA 3P72A 2RR6A 1XWDC 2XWTC 4TZHA 1DFJI 2Z63A 3UL7A 1O6TA 3WPEA 5B0NA 1GWBA 1XEUA 4BSRA 5LFNA 3FXIA 4ECNA 2RA8A 1H6TA 3W3LA 5HZLB 4Z94G 4QXEA 3WPGA 2Z7XA 1DS9A 3G3BA 5GMHA 3OGMB 4CILA 4ECOA 4Q3GA 4M7EC 4NKHA 3RW6A 3PMHG 4R5DA 5GS2B 2ELLA 2ASSB 1O6SA 2OMVA 1FS2A 4BV4R 5CMPA 3RGXA 1O6VA 1G9UA 2P1OB 4CC4C 3WPCA 1M9SA 2P1QB 4BSSA 3ZYNA 4I6JB 4Z64C 3RGZA 2FT3A 4C2AB 1A9NA 4WP6A 4MN8B 5FTTB 4CNCA 4FD0A 4RCAB 4QBZA 2Z65A 1M9LA 4CNMA 4FDWA 3WPIA 1IO0A 5B4PA 3ZYIA 5GS0A 2XOTA 4V2EA 4BSUA 4P91A 2JE0A 2OMYA 5IYXC 4J0MA 3UL8A 3RIZA 4LSCA 2WQXA 3JB9j 3WPHA 3ULAA 1FQVA 4G8AA 3CVRA 3RW7A 1OGQA 4L3AA 3DZEA 4Z8GA 4R09A 2WQUA 3WPFA 1YRGA 4OQTA 4J4LA 1H6UA 4XGOA 5IJBA 3RFJA 2OMUA 1P8VA 3KJ4A 4NKGA 3CIGA 4LSAA 2Z62A 2CA6A 2Z7XB 4LI2A 1PGVA 3WN4A 4XSQA 2Z64A 4H09A 3ULVA 4CP6A 4R07A 3TSRE 2Z82A 4R6AA 3O53A 3OJAA 2R9UA 1XECA 4U08A 3W3NA 4R0AA 4KNGA 1D0BA 4Z79A 1KOHA 3O6NA 3W3GA 2Z81A 2UZXA 4AW4A 4UFRA 2P1NB 3UL9A 1OTNA 4PERA 4LXRA 4EZGA 3W3KA 3C6PB 1JL5A 2WQWA 3VQ2A 4V2DA 4U09A 1P9AG 4U06A 4LSXC 2OMXA 4PKIG 2OMWA 4WYKA 1XKUA 5HDHA 3A79B 4IM6A 3CIYA 5GMGA 4R6FA 2ASTB 3RJ0A 2JQDA 4KXFB 4Q3IA 3G39A 5GQRK 1WWLA 4AY9X 5AWCA 2WQVA 3ZYJA 1ZIWA 1U0ND 4MQWX 4LI1A 4LSXA 3G06A 1K5GC 4GLPA 2O6RA 3W3JA 4Y61B 3G04C 2IFGA 4B8CD 1OTOA 2Y5QA 3BZ5A 1DCEA 2UZYA 5B0TA 1A4YA 4KT1A 3E4GA 5AZ5A 4RCWA 5IJCA 2P1MB 4GT6A 3OGLB 4XOSA 3C6NB 3GOZA 1KOOA 1Z7XW 4V2CA 4R08A 2Z66A 1P8TA 3OJAB 3M18A 3RFSA 2O6SA 4FS7A 4PEQB 4R6GA 2V9TB 2OMZA 5AWBA 5IJDA 1SQ0B 4C2BB 1OTMA 4QC0A 4R58A 3C6OB 4HQ1A 2O6QA 1FT8A 4LXSA 1K5DC 5CMNA 4PQ8A 2ID5A 3W3MA 4L3FA 3RFEA 4P8SA 4FMZA 1M0ZA 2V9SA 5GMFA 2OMTA 4Z61C 2JE1A 4ARRA 2P1PB 3E2JA 4U7LA 2Q4GW 3SB4A 2BNHA 5AWAA 3OGKB 4M7EA 5AWDA 3WPDA 2A0ZA 4RWTC 5A5CA 4FHOA 3G3AA 3WPBA 4FCGA 4YEBB 3ZYOA 1LTXA 4CC4A 1FO1A 4PSJA 3VQ1A 2V70A 1XCDA 3E3ZA 1QYYA 3M19A 5D3IA 3REZA 4R6JA 3UN9A 4Q62A 4K17A 2BEXA 4R5CA
chains in the Genus database with same CATH superfamily
4ARNA 1OOKG 1W8AA 1M10B 3ULUA 1OZNA 2WFHA 3E6JA 3P72A 2RR6A 1XWDC 2XWTC 4TZHA 1DFJI 2Z63A 3UL7A 1O6TA 3WPEA 5B0NA 1GWBA 1XEUA 4BSRA 5LFNA 3FXIA 4ECNA 2RA8A 1H6TA 3W3LA 5HZLB 4Z94G 4QXEA 3WPGA 2Z7XA 1DS9A 3G3BA 5GMHA 3OGMB 4CILA 4ECOA 4Q3GA 4M7EC 4NKHA 3RW6A 3PMHG 4R5DA 5GS2B 2ELLA 2ASSB 1O6SA 2OMVA 1FS2A 4BV4R 5CMPA 3RGXA 1O6VA 1G9UA 2P1OB 4CC4C 3WPCA 1M9SA 2P1QB 4BSSA 3ZYNA 4I6JB 4Z64C 3RGZA 2FT3A 4C2AB 1A9NA 4WP6A 4MN8B 5FTTB 4CNCA 4FD0A 4RCAB 4QBZA 2Z65A 1M9LA 4CNMA 4FDWA 3WPIA 1IO0A 5B4PA 3ZYIA 5GS0A 2XOTA 4V2EA 4BSUA 4P91A 2JE0A 2OMYA 5IYXC 4J0MA 3UL8A 3RIZA 4LSCA 2WQXA 3JB9j 3WPHA 3ULAA 1FQVA 4G8AA 3CVRA 3RW7A 1OGQA 4L3AA 3DZEA 4Z8GA 4R09A 2WQUA 3WPFA 1YRGA 4OQTA 4J4LA 1H6UA 4XGOA 5IJBA 3RFJA 2OMUA 1P8VA 3KJ4A 4NKGA 3CIGA 4LSAA 2Z62A 2CA6A 2Z7XB 4LI2A 1PGVA 3WN4A 4XSQA 2Z64A 4H09A 3ULVA 4CP6A 4R07A 3TSRE 2Z82A 4R6AA 3O53A 3OJAA 2R9UA 1XECA 4U08A 3W3NA 4R0AA 4KNGA 1D0BA 4Z79A 1KOHA 3O6NA 3W3GA 2Z81A 2UZXA 4AW4A 4UFRA 2P1NB 3UL9A 1OTNA 4PERA 4LXRA 4EZGA 3W3KA 3C6PB 4NZRM 1JL5A 2WQWA 3VQ2A 4V2DA 4U09A 1P9AG 4U06A 4LSXC 2OMXA 4PKIG 2OMWA 4WYKA 1XKUA 5HDHA 3A79B 4IM6A 3CIYA 5GMGA 4R6FA 2ASTB 3RJ0A 2JQDA 4KXFB 4Q3IA 3G39A 5GQRK 1WWLA 4AY9X 4NZTM 5AWCA 2WQVA 3ZYJA 1ZIWA 1U0ND 4MQWX 4LI1A 4LSXA 3G06A 1K5GC 4GLPA 2O6RA 3W3JA 4Y61B 3G04C 2IFGA 4B8CD 1OTOA 2Y5QA 3BZ5A 1DCEA 2UZYA 5B0TA 1A4YA 4KT1A 3E4GA 5AZ5A 4RCWA 5IJCA 2P1MB 4GT6A 3OGLB 4XOSA 3C6NB 3GOZA 1KOOA 1Z7XW 4V2CA 4R08A 2Z66A 1P8TA 3OJAB 3M18A 3RFSA 2O6SA 4FS7A 4PEQB 4R6GA 2V9TB 2OMZA 5AWBA 5IJDA 1SQ0B 4C2BB 1OTMA 4QC0A 4R58A 3C6OB 4HQ1A 2O6QA 1FT8A 4LXSA 1K5DC 5CMNA 4PQ8A 2ID5A 3W3MA 4L3FA 3RFEA 4P8SA 4FMZA 1M0ZA 2V9SA 5GMFA 2OMTA 4Z61C 2JE1A 4ARRA 2P1PB 3E2JA 4U7LA 2Q4GW 3SB4A 2BNHA 5AWAA 3OGKB 4M7EA 5AWDA 3WPDA 2A0ZA 4RWTC 5A5CA 4FHOA 3G3AA 3WPBA 4FCGA 4YEBB 3ZYOA 1LTXA 4CC4A 1FO1A 4PSJA 3VQ1A 2V70A 1XCDA 3E3ZA 1QYYA 3M19A 5D3IA 3REZA 4R6JA 3UN9A 4Q62A 4K17A 2BEXA 4R5CA
chains in the Genus database with same CATH topology
4ARNA 1OOKG 1W8AA 1M10B 3ULUA 1OZNA 2WFHA 3E6JA 3P72A 2RR6A 1XWDC 2XWTC 4TZHA 1DFJI 2Z63A 3UL7A 1O6TA 3WPEA 5B0NA 1GWBA 1XEUA 4BSRA 5LFNA 3FXIA 4ECNA 2RA8A 1H6TA 3W3LA 5HZLB 4Z94G 4QXEA 3WPGA 2Z7XA 1DS9A 3G3BA 5GMHA 3OGMB 4CILA 4ECOA 4Q3GA 4M7EC 4NKHA 3RW6A 3PMHG 4R5DA 5GS2B 2ELLA 2ASSB 1O6SA 2OMVA 1FS2A 4BV4R 5CMPA 3RGXA 1O6VA 1G9UA 2P1OB 4CC4C 3WPCA 1M9SA 2P1QB 4BSSA 3ZYNA 4I6JB 4Z64C 3RGZA 2FT3A 4C2AB 1A9NA 4WP6A 4MN8B 5FTTB 4CNCA 4FD0A 4RCAB 4QBZA 2Z65A 1M9LA 4CNMA 4FDWA 3WPIA 1IO0A 5B4PA 3ZYIA 5GS0A 2XOTA 4V2EA 4BSUA 4P91A 2JE0A 2OMYA 5IYXC 4J0MA 3UL8A 3RIZA 4LSCA 2WQXA 3JB9j 3WPHA 3ULAA 1FQVA 4G8AA 3CVRA 3RW7A 1OGQA 4L3AA 3DZEA 4Z8GA 4R09A 2WQUA 3WPFA 1YRGA 4OQTA 4J4LA 1H6UA 4XGOA 5IJBA 3RFJA 2OMUA 1P8VA 3KJ4A 4NKGA 3CIGA 4LSAA 2Z62A 2CA6A 2Z7XB 4LI2A 1PGVA 3WN4A 4XSQA 2Z64A 4H09A 3ULVA 4CP6A 4R07A 3TSRE 2Z82A 4R6AA 3O53A 3OJAA 2R9UA 1XECA 4U08A 3W3NA 4R0AA 4KNGA 1D0BA 4Z79A 1KOHA 3O6NA 3W3GA 2Z81A 2UZXA 4AW4A 4UFRA 2P1NB 3UL9A 1OTNA 4PERA 4LXRA 4EZGA 3W3KA 3C6PB 1JL5A 2WQWA 3VQ2A 4V2DA 4U09A 1P9AG 4U06A 4LSXC 2OMXA 4PKIG 2OMWA 4WYKA 1XKUA 5HDHA 3A79B 4IM6A 3CIYA 5GMGA 4R6FA 2ASTB 3RJ0A 2JQDA 4KXFB 4Q3IA 3G39A 5GQRK 1WWLA 4AY9X 5AWCA 2WQVA 3ZYJA 1ZIWA 1U0ND 4MQWX 4LI1A 4LSXA 3G06A 1K5GC 4GLPA 2O6RA 3W3JA 4Y61B 3G04C 2IFGA 4B8CD 1OTOA 2Y5QA 3BZ5A 1DCEA 2UZYA 5B0TA 1A4YA 4KT1A 3E4GA 5AZ5A 4RCWA 5IJCA 2P1MB 4GT6A 3OGLB 4XOSA 3C6NB 3GOZA 1KOOA 1Z7XW 4V2CA 4R08A 2Z66A 1P8TA 3OJAB 3M18A 3RFSA 2O6SA 4FS7A 4PEQB 4R6GA 2V9TB 2OMZA 5AWBA 5IJDA 1SQ0B 4C2BB 1OTMA 4QC0A 4R58A 3C6OB 4HQ1A 2O6QA 1FT8A 4LXSA 1K5DC 5CMNA 4PQ8A 2ID5A 3W3MA 4L3FA 3RFEA 4P8SA 4FMZA 1M0ZA 2V9SA 5GMFA 2OMTA 4Z61C 2JE1A 4ARRA 2P1PB 3E2JA 4U7LA 2Q4GW 3SB4A 2BNHA 5AWAA 3OGKB 4M7EA 5AWDA 3WPDA 2A0ZA 4RWTC 5A5CA 4FHOA 3G3AA 3WPBA 4FCGA 4YEBB 3ZYOA 1LTXA 4CC4A 1FO1A 4PSJA 3VQ1A 2V70A 1XCDA 3E3ZA 1QYYA 3M19A 5D3IA 3REZA 4R6JA 3UN9A 4Q62A 4K17A 2BEXA 4R5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ARN A;  1OOK G;  1W8A A;  1M10 B;  3ULU A;  1OZN A;  2WFH A;  3E6J A;  3P72 A;  2RR6 A;  1XWD C;  2XWT C;  4TZH A;  1DFJ I;  2Z63 A;  3UL7 A;  1O6T A;  3WPE A;  5B0N A;  1GWB A;  1XEU A;  4BSR A;  5LFN A;  3FXI A;  4ECN A;  2RA8 A;  1H6T A;  3W3L A;  5HZL B;  4Z94 G;  4QXE A;  3WPG A;  2Z7X A;  1DS9 A;  3G3B A;  5GMH A;  3OGM B;  4CIL A;  4ECO A;  4Q3G A;  4M7E C;  4NKH A;  3RW6 A;  3PMH G;  4R5D A;  5GS2 B;  2ELL A;  2ASS B;  1O6S A;  2OMV A;  1FS2 A;  4BV4 R;  5CMP A;  3RGX A;  1O6V A;  1G9U A;  2P1O B;  4CC4 C;  3WPC A;  1M9S A;  2P1Q B;  4BSS A;  3ZYN A;  4I6J B;  4Z64 C;  3RGZ A;  2FT3 A;  4C2A B;  1A9N A;  4WP6 A;  4MN8 B;  5FTT B;  4CNC A;  4FD0 A;  4RCA B;  4QBZ A;  2Z65 A;  1M9L A;  4CNM A;  4FDW A;  3WPI A;  1IO0 A;  5B4P A;  3ZYI A;  5GS0 A;  2XOT A;  4V2E A;  4BSU A;  4P91 A;  2JE0 A;  2OMY A;  5IYX C;  4J0M A;  3UL8 A;  3RIZ A;  4LSC A;  2WQX A;  3JB9 j;  3WPH A;  3ULA A;  1FQV A;  4G8A A;  3CVR A;  3RW7 A;  1OGQ A;  4L3A A;  3DZE A;  4Z8G A;  4R09 A;  2WQU A;  3WPF A;  1YRG A;  4OQT A;  4J4L A;  1H6U A;  4XGO A;  5IJB A;  3RFJ A;  2OMU A;  1P8V A;  3KJ4 A;  4NKG A;  3CIG A;  4LSA A;  2Z62 A;  2CA6 A;  2Z7X B;  4LI2 A;  1PGV A;  3WN4 A;  4XSQ A;  2Z64 A;  4H09 A;  3ULV A;  4CP6 A;  4R07 A;  3TSR E;  2Z82 A;  4R6A A;  3O53 A;  3OJA A;  2R9U A;  1XEC A;  4U08 A;  3W3N A;  4R0A A;  4KNG A;  1D0B A;  4Z79 A;  1KOH A;  3O6N A;  3W3G A;  2Z81 A;  2UZX A;  4AW4 A;  4UFR A;  2P1N B;  3UL9 A;  1OTN A;  4PER A;  4LXR A;  4EZG A;  3W3K A;  3C6P B;  1JL5 A;  2WQW A;  3VQ2 A;  4V2D A;  4U09 A;  1P9A G;  4U06 A;  4LSX C;  2OMX A;  4PKI G;  2OMW A;  4WYK A;  1XKU A;  5HDH A;  3A79 B;  4IM6 A;  3CIY A;  5GMG A;  4R6F A;  2AST B;  3RJ0 A;  2JQD A;  4KXF B;  4Q3I A;  3G39 A;  5GQR K;  1WWL A;  4AY9 X;  5AWC A;  2WQV A;  3ZYJ A;  1ZIW A;  1U0N D;  4MQW X;  4LI1 A;  4LSX A;  3G06 A;  1K5G C;  4GLP A;  2O6R A;  3W3J A;  4Y61 B;  3G04 C;  2IFG A;  4B8C D;  1OTO A;  2Y5Q A;  3BZ5 A;  1DCE A;  2UZY A;  5B0T A;  1A4Y A;  4KT1 A;  3E4G A;  5AZ5 A;  4RCW A;  5IJC A;  2P1M B;  4GT6 A;  3OGL B;  4XOS A;  3C6N B;  3GOZ A;  1KOO A;  1Z7X W;  4V2C A;  4R08 A;  2Z66 A;  1P8T A;  3OJA B;  3M18 A;  3RFS A;  2O6S A;  4FS7 A;  4PEQ B;  4R6G A;  2V9T B;  2OMZ A;  5AWB A;  5IJD A;  1SQ0 B;  4C2B B;  1OTM A;  4QC0 A;  4R58 A;  3C6O B;  4HQ1 A;  2O6Q A;  1FT8 A;  4LXS A;  1K5D C;  5CMN A;  4PQ8 A;  2ID5 A;  3W3M A;  4L3F A;  3RFE A;  4P8S A;  4FMZ A;  1M0Z A;  2V9S A;  5GMF A;  2OMT A;  4Z61 C;  2JE1 A;  4ARR A;  2P1P B;  3E2J A;  4U7L A;  2Q4G W;  3SB4 A;  2BNH A;  5AWA A;  3OGK B;  4M7E A;  5AWD A;  3WPD A;  2A0Z A;  4RWT C;  5A5C A;  4FHO A;  3G3A A;  3WPB A;  4FCG A;  4YEB B;  3ZYO A;  1LTX A;  4CC4 A;  1FO1 A;  4PSJ A;  3VQ1 A;  2V70 A;  1XCD A;  3E3Z A;  1QYY A;  3M19 A;  5D3I A;  3REZ A;  4R6J A;  3UN9 A;  4Q62 A;  4K17 A;  2BEX A;  4R5C A; 
#chains in the Genus database with same CATH topology
 4ARN A;  1OOK G;  1W8A A;  1M10 B;  3ULU A;  1OZN A;  2WFH A;  3E6J A;  3P72 A;  2RR6 A;  1XWD C;  2XWT C;  4TZH A;  1DFJ I;  2Z63 A;  3UL7 A;  1O6T A;  3WPE A;  5B0N A;  1GWB A;  1XEU A;  4BSR A;  5LFN A;  3FXI A;  4ECN A;  2RA8 A;  1H6T A;  3W3L A;  5HZL B;  4Z94 G;  4QXE A;  3WPG A;  2Z7X A;  1DS9 A;  3G3B A;  5GMH A;  3OGM B;  4CIL A;  4ECO A;  4Q3G A;  4M7E C;  4NKH A;  3RW6 A;  3PMH G;  4R5D A;  5GS2 B;  2ELL A;  2ASS B;  1O6S A;  2OMV A;  1FS2 A;  4BV4 R;  5CMP A;  3RGX A;  1O6V A;  1G9U A;  2P1O B;  4CC4 C;  3WPC A;  1M9S A;  2P1Q B;  4BSS A;  3ZYN A;  4I6J B;  4Z64 C;  3RGZ A;  2FT3 A;  4C2A B;  1A9N A;  4WP6 A;  4MN8 B;  5FTT B;  4CNC A;  4FD0 A;  4RCA B;  4QBZ A;  2Z65 A;  1M9L A;  4CNM A;  4FDW A;  3WPI A;  1IO0 A;  5B4P A;  3ZYI A;  5GS0 A;  2XOT A;  4V2E A;  4BSU A;  4P91 A;  2JE0 A;  2OMY A;  5IYX C;  4J0M A;  3UL8 A;  3RIZ A;  4LSC A;  2WQX A;  3JB9 j;  3WPH A;  3ULA A;  1FQV A;  4G8A A;  3CVR A;  3RW7 A;  1OGQ A;  4L3A A;  3DZE A;  4Z8G A;  4R09 A;  2WQU A;  3WPF A;  1YRG A;  4OQT A;  4J4L A;  1H6U A;  4XGO A;  5IJB A;  3RFJ A;  2OMU A;  1P8V A;  3KJ4 A;  4NKG A;  3CIG A;  4LSA A;  2Z62 A;  2CA6 A;  2Z7X B;  4LI2 A;  1PGV A;  3WN4 A;  4XSQ A;  2Z64 A;  4H09 A;  3ULV A;  4CP6 A;  4R07 A;  3TSR E;  2Z82 A;  4R6A A;  3O53 A;  3OJA A;  2R9U A;  1XEC A;  4U08 A;  3W3N A;  4R0A A;  4KNG A;  1D0B A;  4Z79 A;  1KOH A;  3O6N A;  3W3G A;  2Z81 A;  2UZX A;  4AW4 A;  4UFR A;  2P1N B;  3UL9 A;  1OTN A;  4PER A;  4LXR A;  4EZG A;  3W3K A;  3C6P B;  4NZR M;  1JL5 A;  2WQW A;  3VQ2 A;  4V2D A;  4U09 A;  1P9A G;  4U06 A;  4LSX C;  2OMX A;  4PKI G;  2OMW A;  4WYK A;  1XKU A;  5HDH A;  3A79 B;  4IM6 A;  3CIY A;  5GMG A;  4R6F A;  2AST B;  3RJ0 A;  2JQD A;  4KXF B;  4Q3I A;  3G39 A;  5GQR K;  1WWL A;  4AY9 X;  4NZT M;  5AWC A;  2WQV A;  3ZYJ A;  1ZIW A;  1U0N D;  4MQW X;  4LI1 A;  4LSX A;  3G06 A;  1K5G C;  4GLP A;  2O6R A;  3W3J A;  4Y61 B;  3G04 C;  2IFG A;  4B8C D;  1OTO A;  2Y5Q A;  3BZ5 A;  1DCE A;  2UZY A;  5B0T A;  1A4Y A;  4KT1 A;  3E4G A;  5AZ5 A;  4RCW A;  5IJC A;  2P1M B;  4GT6 A;  3OGL B;  4XOS A;  3C6N B;  3GOZ A;  1KOO A;  1Z7X W;  4V2C A;  4R08 A;  2Z66 A;  1P8T A;  3OJA B;  3M18 A;  3RFS A;  2O6S A;  4FS7 A;  4PEQ B;  4R6G A;  2V9T B;  2OMZ A;  5AWB A;  5IJD A;  1SQ0 B;  4C2B B;  1OTM A;  4QC0 A;  4R58 A;  3C6O B;  4HQ1 A;  2O6Q A;  1FT8 A;  4LXS A;  1K5D C;  5CMN A;  4PQ8 A;  2ID5 A;  3W3M A;  4L3F A;  3RFE A;  4P8S A;  4FMZ A;  1M0Z A;  2V9S A;  5GMF A;  2OMT A;  4Z61 C;  2JE1 A;  4ARR A;  2P1P B;  3E2J A;  4U7L A;  2Q4G W;  3SB4 A;  2BNH A;  5AWA A;  3OGK B;  4M7E A;  5AWD A;  3WPD A;  2A0Z A;  4RWT C;  5A5C A;  4FHO A;  3G3A A;  3WPB A;  4FCG A;  4YEB B;  3ZYO A;  1LTX A;  4CC4 A;  1FO1 A;  4PSJ A;  3VQ1 A;  2V70 A;  1XCD A;  3E3Z A;  1QYY A;  3M19 A;  5D3I A;  3REZ A;  4R6J A;  3UN9 A;  4Q62 A;  4K17 A;  2BEX A;  4R5C A; 
#chains in the Genus database with same CATH homology
 4ARN A;  1OOK G;  1W8A A;  1M10 B;  3ULU A;  1OZN A;  2WFH A;  3E6J A;  3P72 A;  2RR6 A;  1XWD C;  2XWT C;  4TZH A;  1DFJ I;  2Z63 A;  3UL7 A;  1O6T A;  3WPE A;  5B0N A;  1GWB A;  1XEU A;  4BSR A;  5LFN A;  3FXI A;  4ECN A;  2RA8 A;  1H6T A;  3W3L A;  5HZL B;  4Z94 G;  4QXE A;  3WPG A;  2Z7X A;  1DS9 A;  3G3B A;  5GMH A;  3OGM B;  4CIL A;  4ECO A;  4Q3G A;  4M7E C;  4NKH A;  3RW6 A;  3PMH G;  4R5D A;  5GS2 B;  2ELL A;  2ASS B;  1O6S A;  2OMV A;  1FS2 A;  4BV4 R;  5CMP A;  3RGX A;  1O6V A;  1G9U A;  2P1O B;  4CC4 C;  3WPC A;  1M9S A;  2P1Q B;  4BSS A;  3ZYN A;  4I6J B;  4Z64 C;  3RGZ A;  2FT3 A;  4C2A B;  1A9N A;  4WP6 A;  4MN8 B;  5FTT B;  4CNC A;  4FD0 A;  4RCA B;  4QBZ A;  2Z65 A;  1M9L A;  4CNM A;  4FDW A;  3WPI A;  1IO0 A;  5B4P A;  3ZYI A;  5GS0 A;  2XOT A;  4V2E A;  4BSU A;  4P91 A;  2JE0 A;  2OMY A;  5IYX C;  4J0M A;  3UL8 A;  3RIZ A;  4LSC A;  2WQX A;  3JB9 j;  3WPH A;  3ULA A;  1FQV A;  4G8A A;  3CVR A;  3RW7 A;  1OGQ A;  4L3A A;  3DZE A;  4Z8G A;  4R09 A;  2WQU A;  3WPF A;  1YRG A;  4OQT A;  4J4L A;  1H6U A;  4XGO A;  5IJB A;  3RFJ A;  2OMU A;  1P8V A;  3KJ4 A;  4NKG A;  3CIG A;  4LSA A;  2Z62 A;  2CA6 A;  2Z7X B;  4LI2 A;  1PGV A;  3WN4 A;  4XSQ A;  2Z64 A;  4H09 A;  3ULV A;  4CP6 A;  4R07 A;  3TSR E;  2Z82 A;  4R6A A;  3O53 A;  3OJA A;  2R9U A;  1XEC A;  4U08 A;  3W3N A;  4R0A A;  4KNG A;  1D0B A;  4Z79 A;  1KOH A;  3O6N A;  3W3G A;  2Z81 A;  2UZX A;  4AW4 A;  4UFR A;  2P1N B;  3UL9 A;  1OTN A;  4PER A;  4LXR A;  4EZG A;  3W3K A;  3C6P B;  1JL5 A;  2WQW A;  3VQ2 A;  4V2D A;  4U09 A;  1P9A G;  4U06 A;  4LSX C;  2OMX A;  4PKI G;  2OMW A;  4WYK A;  1XKU A;  5HDH A;  3A79 B;  4IM6 A;  3CIY A;  5GMG A;  4R6F A;  2AST B;  3RJ0 A;  2JQD A;  4KXF B;  4Q3I A;  3G39 A;  5GQR K;  1WWL A;  4AY9 X;  5AWC A;  2WQV A;  3ZYJ A;  1ZIW A;  1U0N D;  4MQW X;  4LI1 A;  4LSX A;  3G06 A;  1K5G C;  4GLP A;  2O6R A;  3W3J A;  4Y61 B;  3G04 C;  2IFG A;  4B8C D;  1OTO A;  2Y5Q A;  3BZ5 A;  1DCE A;  2UZY A;  5B0T A;  1A4Y A;  4KT1 A;  3E4G A;  5AZ5 A;  4RCW A;  5IJC A;  2P1M B;  4GT6 A;  3OGL B;  4XOS A;  3C6N B;  3GOZ A;  1KOO A;  1Z7X W;  4V2C A;  4R08 A;  2Z66 A;  1P8T A;  3OJA B;  3M18 A;  3RFS A;  2O6S A;  4FS7 A;  4PEQ B;  4R6G A;  2V9T B;  2OMZ A;  5AWB A;  5IJD A;  1SQ0 B;  4C2B B;  1OTM A;  4QC0 A;  4R58 A;  3C6O B;  4HQ1 A;  2O6Q A;  1FT8 A;  4LXS A;  1K5D C;  5CMN A;  4PQ8 A;  2ID5 A;  3W3M A;  4L3F A;  3RFE A;  4P8S A;  4FMZ A;  1M0Z A;  2V9S A;  5GMF A;  2OMT A;  4Z61 C;  2JE1 A;  4ARR A;  2P1P B;  3E2J A;  4U7L A;  2Q4G W;  3SB4 A;  2BNH A;  5AWA A;  3OGK B;  4M7E A;  5AWD A;  3WPD A;  2A0Z A;  4RWT C;  5A5C A;  4FHO A;  3G3A A;  3WPB A;  4FCG A;  4YEB B;  3ZYO A;  1LTX A;  4CC4 A;  1FO1 A;  4PSJ A;  3VQ1 A;  2V70 A;  1XCD A;  3E3Z A;  1QYY A;  3M19 A;  5D3I A;  3REZ A;  4R6J A;  3UN9 A;  4Q62 A;  4K17 A;  2BEX A;  4R5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...