1FS5A

A discovery of three alternate conformations in the active site of glucosamine-6-phosphate isomerase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
266
Chain Sequence
b'MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
publication title Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 92
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fs5A00
1FSFA 4L5JA 1CD5A 2O0MA 3ENVA 4L5IA 4IO1A 3E7FA 1UJ6A 1HOTA 3BXEA 1UJ4A 3IXQA 3NZEA 1O8BA 2RI0A 4R7TA 4L51A 4TM7A 2GNPA 3TX2A 3LWDA 4M8LA 1Y89A 1JT9A 3BXGA 1FS6A 1M0SA 4GMKA 3KV1A 4TM8A 1FQOA 1FS5A 2RI1A 2R5FA 3EB9A 1VL1A 4L4ZA 4X84A 2W48A 3CH7A 3ENQA 1PBTA 4R9NA 2BKVA 2WU1A 3CSSA 3BXHA 1DEAA 2J0EA 2F8MA 4GO1A 1LKZA 3ICOA 1XTZA 1KS2A 3EFBA 1HORA 3ENWA 3LHIA 4L4YA 3NWPA 5HJ5A 2BKXA 3E15A 1FRZA 3HHEA 1LK7A 3OC6A 2OKGA 4NMLA 4L50A 1UJ5A 3BXFA 1NE7A 3KWMA 4OQPA 1LK5A 4OQQA 3HN6A 3U7JA 3UW1A 3L7OA
chains in the Genus database with same CATH superfamily
1Z6YA 4ALKA 2YXBA 1UBLS 2IOHA 1Z6XA 4DW8A 2IF2A 4WOKA 2WB2A 3BMCA 3NI2A 5H9WA 3WSTA 4G65A 2XNCA 4HSGA 1NVVR 5KNBD 5FWNA 1H4TA 2FFRA 4YJHB 1J39A 4XTRA 4P3PA 4EGQA 3HCBA 1QG0A 3E82A 3R0IA 1BU8A 2R4UA 1B0UA 2IX3A 3KQWA 1VHWA 2R25B 3VYUB 3NP7A 4AIRA 5KTPA 2WF9A 5HFJA 1VBKA 2G07A 3RVSA 4R7TA 4TLLB 4KGXA 1GXSA 4PGHA 5CLIA 4DABA 1XZNA 1XQ9A 3X2SA 3BGSA 4BLSA 3QE0A 4XGNA 1MTZA 2W5UA 4CTNA 2BSXA 3PXAA 4WAUA 2ECKA 4GDMA 2OK7A 3JWEA 4XQEA 4QXAA 2A9QA 1LXCA 3IUYA 1S2MA 1XNQB 1DDIA 3M1YA 4RKRA 1SC4A 5DI3A 2EBFX 4KWCA 5G02A 3UAWA 3UICA 3W7BA 1VXRA 2ZJ2A 1XHFA 4W5RA 5JS1A 2O8CA 3HB9A 3F1KA 4U00A 4HAUA 1YOVA 4FU0A 1WVIA 1G5HA 1WP4A 2Z09A 3RHTA 2QR5A 2QN2A 4IIEA 1TA0A 1JFLA 1UBOS 3NVDA 1DS6A 2VHXA 5IDVA 2YJZA 1SOVA 2REQA 3JYLA 1Z8NA 4I5GA 2A9JA 3IAFA 4KX3A 3KKQA 1PEKE 3AUJB 3FWPA 4Q1AA 4KTVE 4Q37A 3RSQA 5EXSA 2IOQA 3T5GA 3C8ZA 1O9GA 4MYRA 1SXGA 2NYAA 1YL5A 5D3MB 2ZSDA 3LGAA 1JJIA 4QREA 1UBKS 2RB5A 1YKGA 1RRKA 2RJOA 5AVWA 4GOKA 1NN3A 3JAKB 1A5BB 1QRRA 2QHXA 3LC1O 3OZ7A 4M83A 3JYPA 3RUPA 2ZPTX 2RG1A 1M6EX 3FDZB 2VPPA 1DC8A 1JE0A 3PQ8A 4P98A 1K68A 2C1EA 4UBKA 1BMDA 2DM6A 1EYZA 3MF4A 4LKOA 4Y2XA 2AOTB 4MPJA 2Q2VA 2WZCA 1ECJA 2JAOA 5I01A 1JQBA 1AV6A 1MB2A 3WYFA 2YQ5A 3ITKA 3JD4A 3PWKA 2AG0A 5K0NA 1Z9BA 4JLBA 2FSFA 3MRXA 4UJ5A 5HBRA 5EJ7A 4BWGA 3KLNA 3PVSA 4IG4A 4IFTA 4OXIA 1UWVA 3FN4A 3SYTA 2K87A 1CUXA 3KR2A 1KHHA 4F5YA 2FKAA 3KKLA 2ZM5A 1B8OA 2AUMA 3ZDYB 1S3GA 1PR9A 1WD5A 4JGBA 1YK0A 3VR2A 3I0NA 4RL6A 1UEJA 4DQ0A 3CFYA 1K3FA 2JFOA 3B89A 2AF4C 2G70A 4P7GA 3WGOA 1HPLA 2VPYA 5FPTA 3GRPA 1NASA 2FMTA 2TRSB 5FUVA 3EH2A 4H6PA 1E1RA 2Q5OA 1UMBA 2X2PA 2AHOA 3WLJA 1EFCA 2QMOA 4PVDA 1YSCA 3VU0A 4LCJA 2YICA 1NNUA 1YV9A 1XKTA 5DHFA 5CK4A 3OIUA 2CFRA 4HY3A 3HV0A 1GPWB 3OIYA 1RDFA 5E7MA 4YRSA 1M5UA 1ND6A 4LX0A 3EOZA 3O47A 3O8QB 4JMLA 3RRNA 3KXKA 4UW9A 4AG5A 1LGYA 2VI5A 3LVBA 3RTEA 3TTYA 1L7PA 5FBLB 1E66A 3WYGA 3AVYA 3VJRA 2R1VA 1JDVA 3IIIA 1WEKA 3G85A 3KU1A 2XHEA 4HAWA 4RVFA 1GTRA 1VJGA 3M6XA 5BN3A 2QG4A 2UZIR 1KJ8A 1VIDA 5KYUA 4KUGA 1SZJG 5FIUA 3WAJA 4AP5A 3I2KA 2HEIA 5TEWA 1GD1O 1L5HB 2IITA 5K3BA 4KQFA 4CVNA 3KOUA 5DBFA 4B5KA 4RQBA 2EZ4A 4C7OA 2ZYWX 1Q7TA 3VBCA 4O4HA 1YDFA 3FNIA 2NAPA 3GUHA 3SK0A 1XSEA 3EGXA 3BMNB 1NW4A 4KQKA 4IICA 1DLJA 1Y89A 5ADVA 1U7TA 1KAQA 4ZV4A 1QYCA 1KPGA 2CJYA 2Q9CA 1X1BA 2QAGB 4A27A 5BMVF 4HUQB 421PA 3R09A 2PD4A 4HEA1 4QT0A 4QQFA 5AUNB 2EKPA 4IIUA 5JAQA 1KVRA 3CH4B 3CONA 2ZJBA 1DBSA 2YYYA 4G4IA 5F5NA 5JPCA 1PAUA 3PTZA 4UU0A 5C18A 1JQDA 2P2GA 1CVIA 3I5YA 2UZAA 3CXRA 3PYLA 1JDTA 3PQ2A 4AT1A 1N5JA 1GRNA 1JJFA 3CCFA 4B85A 1C7FA 5HPYB 4KXUA 5KO2A 4X60A 4GX0A 4A8JA 1ZCJA 4V38A 4IIHA 2FR8A 4WACA 4FYXA 4OBXA 3VO8A 4D9CA 1I24A 2X22A 5I5GA 4B3RB 4GSYA 1GGJA 3H5RA 5CGQB 1W59A 4YJ2A 2EFDB 2VHVA 1YDEA 2OY0A 4DDWA 3VC2A 3G8CA 4TX1A 3GLHB 4YP7A 1TLLA 2ZJZA 5KCMA 2ZJOA 3O2SB 3RJ5A 1A9SA 2PUGA 2XJ9A 3RF7A 4TYPA 5CCEA 4M1TA 5EUMA 3GZNB 4G1MB 4NZ9A 4ZVSA 3D02A 3NBXX 3PUWA 3THRA 3QE4A 4BFZA 4B0OA 3DEYX 3PGLA 4QRIA 4U9UA 5KOIA 1DV2A 3WISA 1Q20A 4KE9A 2VH1A 2Y67A 5FDFA 5ELMA 1W5BA 3EDYA 1Z88A 2ORVA 4G0ZA 5LZ9A 3MYYA 5IUJC 4Z51A 4LDQA 5AXAA 1QUEA 4EBBA 3A3KA 3G2MA 1KZ1A 3DDHA 3Q11A 4FYWA 1KO4A 3B1VA 3GD5A 4G41A 5ENDA 1MDBA 3B70A 3IDOA 3N2YA 1VL0A 1B16A 3OIDA 3NBMA 4NPHA 2Q7OE 3JPYA 4JP3A 2X1LA 4C7VA 2YJGA 2GCGA 2UVQA 2B7CA 1C7EA 2XD9A 3TVYA 2IOYA 2CLCX 1S2OA 3KWMA 5JALA 4ISCA 1QG4A 2ONZA 3KD3A 1VMDA 4LFAB 4BUCA 2I2DA 5HCUA 1QIDA 5A4AA 5IASA 2W6ZA 3H0EA 4K6HA 5C8XA 4I6EA 4KIUA 5K5EA 3DE1X 3I04A 4C20A 3THWA 2YV1A 3EULA 1A77A 4JVMA 5C7IO 2J48A 3RFTA 3LC2O 4L0QA 4A8PA 5NULA 4DZTA 5SYNA 4MZDA 1K5HA 5K0BA 3TTWA 1T8RA 2B69A 3KELA 2JBWA 3VKWA 5JI2E 3ZNPA 1Z0DA 4ZDIA 3L77A 4OYLA 4ZV9A 2G76A 1QHEA 2X0EA 5JRZA 3U44B 3U4CA 4HX2A 3G5LA 3KLPX 4P7JA 4ZVUA 1M34B 2A84A 3EAQA 3ZKWA 5G4LA 1ILEA 3C6ZA 1CRWG 4XUCA 1N1MA 3WGKA 5FO0A 4B8ZA 1TZJA 3O2JA 4QTUB 1DGQA 1JR6A 2ZVJA 1WCIB 2VN8A 2WWXA 5EUCA 5C31A 3E3NA 3LW8A 4N7BA 1K6MA 1OXMA 2ETXA 1SUIA 5D5QA 4CMHA 3GB9A 1V37A 4RGYA 5C35A 1U0BB 5E6RB 1WLYA 4CM6A 2CSXA 2EX1A 4PFSA 3ME5A 4B8WA 1FFXA 2FRDC 4Q02A 4BKOA 2ZKIA 5F98A 1ZVKA 2VUUA 4MIEA 2R11A 5AKZA 1FZQA 3M8KA 4GMKA 4JFRA 5BPHA 2PQ6A 1T36B 2NUAB 4X7RA 3S2UA 5TXGA 3F6PA 5KNCH 1QV9A 5LPNA 1DXOA 4US0R 1Y4ZA 1U7XA 3G8AA 3AR7A 3H3XA 4JA0A 1JBQA 1QE0A 3QV1A 2Q3DA 4MVCA 1ZINA 3W5CA 2J9ZB 2YUIA 3GEPA 4QHYA 5AW9A 2GZAA 3VKFA 2QXYA 4NBWA 3NRCA 3QTTA 1KL7A 2QV7A 1UJ2A 2NSYA 3ET4A 4MWOA 5L3ZA 4JUAA 2QLLA 3K1ZA 3C1OA 2PH3A 4OLAA 2GXUA 1UP6A 1XTUA 3RU9A 4ALMA 5DHRA 1WMAA 3ROZA 4ML3A 3WXBA 1OY1A 2ALJA 4Y9UA 5BNZA 3C43A 1PQPA 2BEWA 2GUGA 2PBZA 5DTJA 5EXTA 4ZHQF 5AVZA 2H0RA 1QF6A 1TTPB 1EAYA 2BDTA 2ZBGA 3D81A 2QM0A 1JNXX 1Y9EA 5IZCC 5E4TA 2VJAA 3BA1A 3TUIC 1MAWA 3AUAA 3LHSA 4MQUA 4RTLA 1GO2A 1VE3A 4AECA 4D99A 2VPZA 1VE6A 4X24A 1DT5A 3MMZA 2AYZA 1OH8A 1F06A 2BGTA 3AIIA 2RGDA 1KMMA 4OGLA 5KVCA 4MVJE 4ERXA 2I03A 1H6BA 1JSXA 4CM4B 1PTJA 5FT9A 3VVLA 3QA9A 5JYDA 5MHTA 3SNHA 1V8DA 1YZHA 3EXHB 4X7BA 1EX7A 1F12A 1DJNA 2UV8A 2VCYA 3G2PA 5CVEA 1CJMA 3QTBA 5ITWA 5JSZB 1OJLA 3GJXC 2Q1YA 2VATA 4RO0A 1KAHA 3N0RA 2GX6A 4PW0A 5B1YA 3H11A 5AW6A 4JI6B 2I7TA 4O2BA 1J25A 3M9XA 1Z6ZA 4HGNA 1L8AA 1KFKB 1BDMA 1X8JA 1C3JA 2IKSA 1U0GA 3A4NA 5FPYA 4BLOA 5AW1A 3AR2A 2GN1A 4AQ7A 2X23A 2PUDA 2Q0SA 3K31A 4OB6A 1P80A 1NUQA 2HU8A 2C5AA 3A9SA 1I10A 4I4TF 3T12A 2PXCA 3C5CA 3HN6A 2A9OA 2IV7A 3U56A 1H22A 4K2AA 1MZPA 1L3BA 3L7DA 3MJSA 4MP8A 5T67A 2Y4NA 4Q4CA 4JI2B 4FN4A 4YX9A 4P4GA 2JFZA 4TUYA 1CQIA 3HDVA 3M83A 4KTTE 4NYMQ 2XZPA 1E2PA 3FPGA 4XCXA 2DAPA 1Z4IA 3CBQA 3NGXA 3K6RA 3A4VA 4JXXA 2OPHA 1GPKA 1YQGA 3LT2A 2KE5A 4S24A 1A9TA 4GP7A 1OFTA 3W4KA 2C4KA 4OP3A 2ISCA 1ZL0A 3SJBA 2H57A 3VAYA 5FCDA 4EHAA 1Q92A 3QKRA 4RW0A 1EXNA 3A6FA 1Y1SA 3EHDA 1U4SA 1J07A 3EQ7A 3ORQA 1U11A 1RI3A 4MCIA 2Q41A 1GV1A 2JI8A 3I0MA 1ZN2A 4PYRA 5F1KA 4P08A 4IX1A 3P4XA 4FEYA 2DLNA 1JPUA 4EPRA 1EFLA 1M7BA 5JATA 4DR1B 2IZ5A 1EFPA 1RRVA 2ERCA 2ZU6A 3U80A 4MGKR 2ASVA 2ORED 2C1ZA 1JDBB 2E4WA 3I5AA 1YBHA 2ZUDA 2HMVA 3OQPA 1A4UA 1X7GA 1QNFA 3DYIA 3IPCA 1R9JA 3L0IB 4NCIA 2X8JA 3UH0A 2JFXA 1G8SA 5EQDA 1PGOA 1FU8A 4I9GA 2QW8A 2NXJA 3QU9A 1N9ZA 2VDRB 4GOND 3K6JA 4YRMA 2YWJA 1TCVA 5D3QA 1OIXA 1IYZA 1RM3A 4UUQA 3UJ7A 3G8DA 3ZZTA 2UZ0A 2H2IA 2WDZA 1QYXA 1PKEA 4I4NA 1OFGA 3ETHA 5ITZA 4MKFA 1U65A 1AF4A 1ISHA 3ESYA 4B7UA 5BSTA 2G5CA 1EDEA 2H48A 1O0SA 2PH1A 3ONWA 1T9KA 1H2HA 1NL3A 1Q1BA 1WKVA 3IUQA 3DYBA 3N05A 1RWXA 1PJ3A 3N58A 4WZAB 3ZY5A 5LOVA 4A2CA 3TVTA 1LTHR 4E5UA 3IXMA 2IPLA 3DKPA 5B2EA 4U7TB 1U2DA 3OZRA 1AMOA 1QIKA 2J7KA 2NU6A 4IQGA 3JZMA 1O6FA 3E1GA 3RHZA 4CT4B 2QRQA 3V7WA 2C5FA 1K5PA 1CQXA 3D2AA 1XCLA 3M82A 3A8TA 2PGAA 1PU2A 4FW8A 1V7PC 4H77A 2JVKA 3JXEA 5ESWA 2CJXA 4G1EB 5EKDA 1HORA 3I9V1 4JZYA 3WNZA 3ZQUA 4C2UA 1LLUA 1O1YA 2XT6A 4FMDB 1CRLA 1WOMA 4NIMA 4RD1A 3RU2A 4RM3A 4FYJA 3K0HA 4XPZA 4A16A 4WSOA 4XYMA 2NSJA 4HQ6A 2PKYX 3IBSA 3EUWA 2Y6UA 4FOSA 2HU5A 1CYEA 1ND5A 2MSEB 1O8CA 2EKQA 4V2IA 4ACAA 3OG9A 1L4FA 1HT2E 2A0XA 4WEQA 2D2IA 2P5TB 2P69A 1VSUA 3MAGA 1K98A 3E2MA 1XVVA 3BVPA 3Q6IA 4CLRA 1NM5C 2YW9A 4J1QA 4D97A 3QP9A 1Y5LA 3UMYA 2REOA 4MYCA 4F4FA 4GRAA 4V39A 4EG4A 1J7JA 1GPUA 4G1UC 2HMWA 4KB5A 3AEQA 3D1VA 4OL0A 1AB5A 2A14A 2XCTB 4WZBB 3JQPA 2VSXA 5CK5A 1QVAA 3AFHA 2R8BA 3WA7A 5GGYA 5K0TA 3DB2A 2V6FA 1V25A 4GSLA 4U6NA 4DBZA 4M22A 1J1ZA 1CC1S 4I1SA 3MVEA 1G55A 1YRQA 4RORA 1F20A 4Y2SA 1RXVA 2IXFA 1H1LA 2XMSA 5EKSA 2WUWE 3B13B 1JHOA 2JAUA 2FRXA 1Y1KE 3I01A 5I9MA 2MJLA 3OCCA 1DTSA 2ZWIA 2EAUA 3BB3A 4Y2HA 1KK3A 1XQWA 5E0OA 2Z9DA 3OJWA 3WFZA 1H4SA 4D6XA 4DNPA 5K4HA 2J0UB 3I9LA 5DM70 5HF5A 4E03A 1ONNA 4RMHA 4CIVA 1P0PA 2YIDA 4YLEA 1ZK0A 3AUTA 4UM8B 3EFOB 7REQA 4R4JA 4C29A 2ZB3A 2G4CA 5AVRA 1XDDA 1WL8A 3SZRA 3OQ6A 5JCZA 3SXPA 4C4ZA 1BHQ1 4TTJA 1KWKA 4BVKA 1AKYA 1H2WA 4IX9A 2DYKA 4E07A 3H2GA 3DXFA 3PJFA 4XUDA 3UG6A 2A9FA 4ZYXA 3W2EA 1PJCA 3ESXA 1WMEA 5DHPA 1I4LD 1XLVA 4ZVNA 5FAKA 3SCZA 4L9AA 1D2HA 3VO1A 1IVNA 5KOJA 3ZHBA 2J45A 3ITNA 4G6ZA 1Z4JA 1CXZA 3L8HA 1GDHA 4YRIA 3H1FA 1V4BA 3L4BA 1TPZA 2FZKA 1HLFA 4BBJA 4RY0A 2HQSA 1EVKA 3ZN2A 4EA9A 1OBHA 1ZP6A 2E21A 3JQ8A 3OZBA 4MKIA 3SHQA 3T3PB 2C2WA 1SQGA 1NQTA 1RXUA 3PFKA 1Z4QA 2I62A 2CXOA 3OAAD 4Y18A 1O4WA 5BV7A 4BAGA 2G72A 4FLFA 4KFTA 2RD2A 1D6SA 3BBLA 3PX3A 4JYCA 1KZHA 3UJHA 4I2NA 1TL7C 5BMOA 3P20A 1HGXA 2B4TO 2O8NA 4BY9E 2I2BA 4KRXA 2PV7A 3F4KA 3I0ZA 2I4MA 1GUZA 2UYHA 4U7WA 1SBTA 2DBQA 4NMXB 1EDDA 5EIAA 1L1QA 1MRZA 2Z2JA 1P44A 1H2XA 2EFCB 4KDRA 4LISA 4UMFA 4WCFA 4ESVA 4LK2A 5EN4A 3U3XA 4FEGA 3AKZA 4M8NE 4KN6A 4LGMA 3HRKA 1FFWA 2ERXA 4WN9B 4LZJA 1MQ8B 1UPXA 2BFOA 3L18A 3W6PA 4B7AA 1U9IA 2IU6A 3DLPX 4TWIA 4B76A 1PVOA 3K9FC 1SG0A 2O2IA 3CWCA 1H5UA 1U5AA 1OX5A 2VBFA 3RC9A 4FFRA 3VZDA 4RULA 2GPSA 3CZ4A 5F21A 2ZRJA 2QQGA 3MCWA 3W5HA 3CF6R 4KWIA 4MCJA 4CDRA 1QRSA 3LOUA 3IUPA 3QVWA 1P2SA 1G5FA 2BMEA 4YT4A 3WDKA 2HL6A 3N75A 1UR5A 3Q8WA 1A04A 2NTJA 1IJKA 2NZVG 4HMOA 4DZZA 4Z3KA 3DWIA 4XYGA 2JH3A 1D7OA 3DMRA 6ABPA 1SVUA 3GRAA 4UNIA 5JS6A 1ZJZA 4A0RA 3HHPA 1D2EA 2FTKE 4KFSA 1NIJA 1WY5A 1KJYA 5AKKA 2E0IA 4CM8A 5LXTF 3HKEB 3MT9A 1R5OA 1W5TA 1WWKA 4DUYB 2ZKLA 3UUWA 1XU7A 3GT7A 3QXCA 4DLSA 4EMUA 1ZGCA 5F23A 4NHOA 2AB0A 2GKSA 2QENA 4N8SA 3GROA 3FZNA 1N2IA 3DULA 3KB8A 3VNSA 2Y93A 3QF4A 1JIKA 1G8GA 3IPYA 4ZZ0A 1K5GA 1VG1A 5U4XA 1Z07A 2QSZA 1PW7A 3MWEB 4QGAA 2G9VA 5G1OA 2NUTB 3FETA 1L4MA 2CKMA 1OBVA 2WWTA 3MWKA 4LV8B 4UBJA 1QPZA 4LBZA 3BMOA 3OCUA 4Y2UA 1CPYA 2W22A 3DE5X 3VPHA 3EZXA 1ZNXA 5B53A 3WR5A 3D4OA 1VLZA 3CR7A 1R15A 3G8BA 3IQZA 3OE7A 4Z9FA 4DG8A 3QLUA 1G4AE 3IEIA 1EP1B 3EDMA 4KMSA 4WXYB 1FX0B 1R4MB 4DCNA 1ZAKA 4IS3A 2I99A 1KZ4A 3A7DA 1N8SA 3PIDA 4HEHA 5DK4A 3W6NA 4ZT2A 1CE8A 4IXNA 1C8BA 3IIKA 1MORA 3VNVA 3FX2A 3EWSA 4QTZA 3RRBA 3HCRA 1IHPA 2VJCA 4J16A 4GLLA 5KIAA 2D54A 1BROA 1MA3A 1QH9A 2QPAA 2XGOA 3M9LA 3OE5A 2JBAB 1G38A 2V7GA 3EIOA 3ZWCA 5B5SA 3DR5A 3T3DA 3PQDA 4BNHA 3VAZA 1RMYA 1H23A 2EFJA 2BAGA 1E4OA 1L7QA 3E0XA 2A9RA 3ENNA 3SDZA 4CXMA 1PEDA 2GZ3A 4WLNA 5K6RA 3C3YA 3BEDA 3PB3A 4N6NA 2BRUC 3ZGXA 3PUVA 3ZCUA 2J3LA 5JD3A 1CR1A 2PLNA 3I30X 4OQ4A 4JLKA 4LQLA 1P0MA 3SG0A 4DM7A 5BSWA 5E0KB 1U9ZA 1IM2A 2EQ5A 1TIBA 3H04A 5BWCA 5BN5B 3JAMA 3RH0A 4OB8A 5SZHB 4R6XA 3DA8A 2OGWA 2P1DA 3IYLW 4Q9KA 5JDIA 3E0QA 2N1MA 1Z63A 3R3VA 1SU7A 3C6YA 4H7PA 4L76A 1NVAA 5DU2A 3SDBA 3R7AA 1COZA 1V45E 3ST7A 3IAS1 3C3MA 5TLSA 3R4VA 3PBKA 3T94A 2ZBQA 1NAIA 1FSSA 3RTDA 4AN4A 1BCSA 1U3UA 4XTCS 4MV6A 4INPA 3OZAA 3QVMA 2NUBA 2ZI7A 3R7WA 4MRSA 3WB0A 2DJIA 4DSAA 3DVAB 5HSGA 4WXEA 1MB0A 1R74A 2FDRA 3MINB 3NS7A 4MAMA 4ECEA 1BRMA 4P5EA 4EKYA 3FNHA 4FUQA 2DHCA 3EDOA 1L2TA 5HJ5A 4BNIA 3PNMA 4W82A 2BFPA 3QLVA 2O2YA 3H9UA 1GIAA 1QGED 1GPNA 1V3UA 2GZMA 5AXBA 4NU0A 3USES 5KNBH 1L9XA 4RFSB 2J9FA 1E99A 1I1QB 3GP5A 1INLA 1UJ5A 2ONCA 3CE9A 3NT5A 3QEMA 5JG7A 5KYNA 4YUVA 3WHKA 3RIGA 3KQOA 1KQPA 3W0LB 2XDQA 3BJMA 3JQAA 1R37A 3SZOA 1X9GA 3MD0A 4WV3A 5DO9A 2F9MA 2Q7DA 4DANA 4G4JA 1KVSA 2P9FA 1QHYA 2L17A 3T61A 2L69A 2XBMA 4TXLA 1PK8A 1WO8A 2KHZA 4GG1A 4ZMSA 1N78A 3SC6A 3JD2A 1AIPA 2Q3HA 4OJYA 1SPBS 4E11A 2MSDB 1KOFA 3D3WA 3DNFA 3HL4A 5IFLA 2IXAA 1X6VA 1G21B 2KQUA 2A2ZA 4IQ0A 5GY7A 1M8PA 4QWWA 5ALTA 2O8BB 1UFOA 4BO8A 4H2DA 4MRPA 1PL7A 1NATA 3GYGA 4FCTA 1PR6A 1RM0A 3DTYA 5F2OA 1COWA 4JJZA 4GC9A 4TSFA 2I1WA 2QS9A 3Q15C 5LVAA 3VOAA 5P21A 1KI1A 4DSZA 2VPTA 2Y4OA 3JTEA 4OLFA 2XOKD 3QNWA 4RTSA 4TN5A 1XKXA 3CRW1 2BMAA 5K6AC 3WQHA 1G3MA 3A2MA 1T10A 1GLVA 1KYZA 1YAHA 4Z8YA 3DMGA 3K70D 3JU3A 1NF8A 1ZG3A 2C07A 2EEZA 5GVRA 4C89A 1LW7A 3IVCA 2ZIVB 3L0PA 4BFYA 4X64B 2XRZA 3L0SA 2DUNA 3KUUA 5HQJA 5EERA 1YC2A 4C06A 3MERA 3U2QA 4JNCA 1DRJA 2Q0HA 1X7YB 3NJRA 4E1VA 2M1XA 4C3VA 4ZZIA 1UDXA 3UKDA 3LH5A 1THMA 5ALXA 5EXDA 4DBLC 2C4WA 3KB1A 2OHFA 3LW7A 1SCUB 2H0AA 1CF2O 2IPAB 1RMTA 1S1CA 1WHSA 1ZICA 1ZSYA 1ZM2A 2VH5R 2A92A 4WZAE 1VJTA 5DJ5A 2H59A 3RSOA 5HHTA 1T2CA 1ECPA 1YAJA 3TXAA 4K9OA 4JB0A 1B1CA 4MVJP 4ZI7B 1O77A 2RGUA 3TE7A 2XZTA 4Q4DA 3ZZ0A 2HLHA 2Q4EA 4JUBA 1GGEA 1WP9A 4J0HA 1JQLB 2HRDA 2MYNA 3UO8B 1JTEA 3ZE2B 5HNKA 3IB6A 2FN4A 1A76A 1T9GS 1N0HA 1Q6YA 4B6PA 5L51A 4TYWA 3BHIA 2YQZA 3NETA 1E2NA 4TUYF 4UUMA 2LBPA 1G20E 2AG6A 3KPYA 3OFVA 3ND9A 3GLIE 1WXFA 5CVUA 4ZQFA 1CY0A 2B30A 4WVLA 4F1WA 3I61A 4NCAA 1HT1E 4B6GA 1RCFA 3L06A 1DADA 2RHTA 4URFA 4WOJA 1HFKA 3W5JA 3ZEIA 4PPFA 1CVRA 5KTTA 3RC8A 4U2FA 4MWSA 3OQHA 4NJEA 1ZGHA 2XV1A 2JD0A 3PFHA 4M9ZA 2RONA 4U02A 5DB4A 2G9RA 4JLWA 1Q1EA 2GD6A 4LQCA 4OQZA 3VR1A 1VBMA 3E9DA 1RHUA 4D42A 2VF5X 1T8UA 4XSGA 1L5WA 4Q3AA 2VHZA 3NEYA 2VJOA 1KEVA 2VT3A 4PFQA 1WB4A 3FZQA 3QVSA 2QY9A 3F2VA 1YVUA 3R5HA 4M1MA 5A9RA 5L7WA 2ZM6B 3CV3A 3KBOA 1Z4MA 3HYLA 1DKNA 1D4AA 5J5VA 4TVSA 3VH4A 3BXFA 3OP4A 1N3YA 2PUJA 3CNHA 3NATA 4BYMA 4LJSA 3OKFA 3VQTA 1T6XA 4C76A 3OU7A 4KQWA 3T6KA 3ZYZA 2JVJA 3B53X 3BYZA 5JSUA 4F9EA 1RHRA 1XZCA 4OQPA 1ZM9A 3H5LA 4AY4A 4RANA 2IYAA 4RD2A 3GWGA 3ZWXA 1V7CA 4WE3A 4L8YA 4ZEOA 1L6IA 2VHWA 3PKZA 4CQLB 4Q4LA 3MD9A 3UCXA 3HFGA 1PO7A 2VP0A 4DLWA 3N9IA 1GTVA 2CLDX 4EX7A 1UK8A 2PX5A 2MSNA 5K45A 2QTMA 3AP3A 4YRZA 1K7CA 3AUSA 2SKEA 1CIJA 3KUDA 1NUUA 5ICFA 1MIOA 1TD9A 2EWMA 4D0RA 1UJ6A 4CKCB 3FYUA 3BGDA 5LOVF 2G82A 2ON6A 2AHRA 3GA0A 3W6ZA 4YUYA 3GCDA 4HYQA 4FGJA 5EI5A 5AW8A 3IUBA 1QTIA 2NO6A 2CV1A 1WTCA 1QFZA 2V9ZA 3V1MA 1Y4SA 4NEHB 1E6UA 4B09A 3NMUF 1ULHA 1ZN8A 1JQJC 3DKVA 2APJA 3PR3A 3BQ9A 2WJYA 1C3VA 3AEXA 1KI8A 3JQ7A 4JBHA 1H5QA 5FTLA 2QI9F 2DH5A 1RYHA 3AILA 4D45A 5ITVA 2RK6A 4IUBS 3QWFA 1E3MA 1K27A 1X87A 1U8EA 1C0EA 1V1RA 4J29A 4R2KA 2OENG 1VMAA 2WM3A 1RCUA 1T3HA 5IWAB 2QXUA 4QAJA 4RD4A 3DBRA 1VYTA 3F6SA 4DT1A 1EIZA 1K63A 4GP6A 4GWKA 4KIJA 4PLFA 4ZAFA 3KJGA 4UCFA 4HLUC 3IHTA 3RV4A 1GFWA 1J8VA 1FTSA 3KXIA 4JJ8A 1WOYA 2H4FA 3MWDB 4URZR 5EJ6A 2NU8B 2WHQA 2RC6A 2OO5C 3INRA 1JDSA 1OHHA 4Y0NA 1N2JA 2V5VA 4MVJA 3TIXB 3FBTA 3NBUA 5EEHA 4H6XA 3B2EA 4YQEA 4U39A 5J5AA 2FZ5A 1CX9B 4W5TA 3SNKA 3F6RA 4B0PA 5CIYA 1IXYA 4ZZ1A 1W44A 3QLTA 3IH5A 4DOMA 1CCWA 4QXQA 5GPBA 3Q2IA 4BVBA 4EG1A 3KZKA 3DCJA 2HREA 5EVJA 4BJHB 3AVOA 3CVVA 2GPBA 3LK6A 1V8OA 4NZPA 5F51A 2QR2A 2F8MA 4I14A 1ORTA 3B2NA 2ZYHA 4DY6A 5AKXA 1AQIA 4S1WA 1ARZA 1XXLA 3M33A 4EKNB 4ZJYA 5K6TA 3NC4A 1KA9H 2Q6IA 1KMCA 2B4RO 4XGRA 1VSQA 3L8MA 4YEDA 5DPMA 5JXHA 3D31A 3A4MA 4HNGA 4RCYA 3N2ZB 5JS8A 4NYIR 3CA8A 4YYZA 1XLTC 1DMSA 3EDRA 1B73A 2V0NA 2XXAB 2WTBA 3LXMA 1Y3IA 1WV0A 1P1JA 2F43A 2FOLA 1V41E 1E4EB 3A1DA 3UUEA 2J4DA 4UTNA 4ND2A 2EHJA 4KAAA 3SZGA 2H1OA 2H06A 2J07A 3HWSA 2WMNB 3E15A 4QUIA 3DTVB 4K2HA 4NZYA 1RXWA 5EP2A 3AHGA 2ZWAA 4GXRA 4JFAA 2XGGA 1AXGA 2ROQA 3W2HA 1HRKA 1ULUA 3HHEA 3OCJA 2O5CA 4N5LA 4PWYA 1S9HA 2WP8J 3IT2A 2BP7A 1ORHA 1XTBA 3Q98A 2JFPA 1MB4A 3KIPA 2CEAA 2PPVA 5A3VA 3EEOA 3LK7A 3EEYA 3AV3A 5KJFA 1B6GA 2PVCA 3K1JA 4NU5A 2R5WA 4BVLA 1E9AA 2Q5QA 3G8YA 3CQ9A 1FRQA 1W76A 2YZKA 4I0WB 5FLEX 4FFWA 5B58C 3K96A 4KQGA 1XC7A 3IQIX 2IXBA 1IIRA 2B8WA 1E6EA 1J0EA 3QJ5A 5FEMA 1KY3A 1W96A 2I6QA 3UC5A 2DF8A 1AN0A 3JAKA 3NBZC 2H4HA 4RTQA 5IM4F 2UUCB 2DY0A 3PDCA 1YZGA 3FDZA 2PMFA 4Q47A 4A23A 4W1QA 3DEHA 4CKBB 2HJ9A 1CRPA 4BFTA 5KHLB 3G2IA 5CFNA 3GN1A 4Q18A 2FN9A 3QU4A 1T4GA 3CRVA 1NX6A 3B20A 3PDWA 4WFIA 3DV2A 3W1VA 5AUOB 1PJ4A 2ID9A 3NHAA 3QPDA 5H83A 2XIQA 1QGZA 4HWOA 4R40A 1VIVA 3GUCA 3V46A 4NRDA 2BR4A 4IXMA 4UVIA 2F4VB 1H0KA 3BM5A 2FUG6 1RHJA 2VDLB 5E4FA 2ZS7A 3IBFA 5IK2A 1TVKA 5DISB 3B85A 3DE7X 5J4YA 3ZH2A 2HADA 1W6UA 2PYZA 4LE0A 1X74A 4PHCA 5B3AA 3N7UA 5AVUA 1N7IA 1NU8A 5FRDA 3S70A 4ZRDA 3VV2A 4DR7B 2H8GA 3MMNA 5FFNA 4G36A 3VI4B 3H8SA 1Y3CE 4O4IB 2AFIB 3M4XA 2VPXA 3OX1A 2BEKA 2FMFA 5JNTA 2CB9A 4RHCA 3U3KA 2HLDD 2LDXA 1Y98A 3EUFA 4E09A 2QRVB 4ZGWA 4EVRA 2JCXA 3O0DA 5F78A 2C9MA 4KQHA 1UC5B 2P9YA 1J8YF 3O8QA 3BTOA 4EMTA 3LBYA 1UC9A 4KQMA 1JZSA 2QAIA 4FFOA 2FWRA 2HBZA 1N25A 4KXVA 3FUUA 1EM8B 2G1UA 3HBFA 4L75A 5E1OA 2WU1A 2IEDA 1TMKA 3GMIA 1T9HA 2GK4A 2HBYA 4XDZA 1RWOA 4GECA 4JJFA 1YZUA 5CT4A 5GOZA 3TSOA 5J23A 3LBAA 2WHPA 3ZDXB 1D09A 3QH4A 3C6BA 4NLLA 1L5HA 1EFUA 1B4DA 3AVQA 3GJYA 4B4KA 1Z28A 3IMKA 5TJHA 4TS4A 3DDUA 4CR8A 2JK1A 1AQ6A 2C7GA 1MOQA 3RSZA 2W83A 3SIXA 3N86A 1KY2A 2JARA 4BLVA 3BMNA 2B21A 1MX1A 2Q4DA 3JASB 4Q4JA 4EG5A 4YR9A 5A06A 1TKAA 1IZZA 2ZS9A 1TB4A 3EMDA 2PT9A 4ZT5A 2GLUA 5JZMA 4E4RA 1ITZA 3GT4A 1G21E 2ZRBA 1KE2A 2MDTA 3NBKA 3CURA 3Q72A 3EEQA 4TZTA 2ZQZA 2P2DA 1FRVA 3W4JA 4MDEA 1GCAA 1XPRA 1W19A 8LDHA 4BHTA 1TXGA 1ZXBA 3KYBA 2Z6VA 2F3TA 5KSWB 3BJIC 2EBWA 1TF5A 3GPCA 5JVDB 3ADOA 1K5DA 1OAOC 4TT8A 1CRQA 4E13A 4IGEA 2PUBA 2EJTA 1V9LA 1G8YA 2R00A 4MH0R 1EUQA 2XMBA 5H16A 1BMFA 4AKSA 3BK2A 3DMDA 3IEKA 2R8OA 3RSLA 1D6JA 4PC2A 4ZO7A 3U7JA 2I6GA 1AZTA 3LYHA 3OJXA 4C78A 3KQYA 2ST1A 4INZA 2AFHE 2VTKA 4OHYA 3IILA 1FSPA 3OU6A 3JSAA 4K28A 4CE6A 1RQPA 1LS1A 2X13A 1XMXA 2UVPB 2C3OA 1SQFA 1FCJA 3W90A 2PX4A 2P3QA 4H1WA 3L7BA 5CFQA 1IM8A 2EBUA 1UK6A 2QNIA 2P7HA 4INJA 1NUPA 4AWXA 3PXEA 5AM0A 3ZCPA 2NZUG 2OC4A 1BX0A 2EBHX 3FTNA 3PJDA 4L5BA 4DA9A 2AKAB 3R9XA 1U2SA 1ZH4A 3OLVA 5CHEA 5EIWA 4L2IA 4XIJA 1YZ3A 2PLWA 3Q12A 4PZAA 4RV9A 3X1KA 4BQQA 1HURA 1VFNA 1PTKA 4KYTA 1XZBA 4IOMA 2G5PA 2C8KA 2D2FA 1FFCA 2GT1A 3Q3VA 3CSUA 4DRZA 2PBRA 1XRLA 2GQ0A 2XE7A 1R12A 2NU7A 4IXWA 1U2QA 1Q0TA 4N7RA 4P33A 3CX3A 1IVSA 4C4XA 4FFNA 1SULA 1ZONA 2QJFA 3P32A 3VZBA 3VZPA 4LDNA 2OAEA 4HVCA 2IT1A 1NI5A 2V58A 3NEJA 1FS5A 4H35A 1EH5A 1GYPA 1UK9A 1UXIA 1LZLA 1QIMA 4M86A 1R4ZA 1XZLA 3PLNA 4RHFA 5EYPB 2M6LA 3VMMA 4E1BA 1MV8A 1QHGA 2WT4A 3GV0A 5IKEA 5EZYB 3FWKA 4K6GA 5IN4A 2AQKA 4E7PA 2VHUA 2WSSA 3DZBA 4ILKA 2JIOA 3ANLA 1JN0A 4P4UA 1HRDA 1QH1B 3C74A 5FNVB 4HH0A 4KXNA 1CR2A 1A97A 2PUEA 2MYUA 2GM9A 4QXPA 1IY0A 3PFFA 3ERCA 3E4DA 3DEJA 4KIFA 3R23A 3V6LA 1PW5A 3BB4A 1KDYA 4DV3B 1O9HA 3VYSB 1RRFA 2CCKA 2PT6A 1MV5A 3WWYA 5DSTA 3CVJA 1GTSA 4LZPA 2YOGA 3ZLUA 2DTEA 2OBBA 2R6CA 1WCIA 4E3WA 3OD5A 3R8FA 3T9DA 4OFBA 1F4PA 4WT7A 2CXUA 1ISGA 3PQFA 4GPIB 2WPDA 1QH8A 1G5RA 3I32A 4R01A 3THSA 4WKBA 4JJ7A 3BE8A 4ZAXA 2NQTA 3HKCB 5E6RA 5TE9A 3QHAA 3DV0A 3HFRA 3RSGA 4IPTA 2XYPA 3TTTA 2ONJA 4HZUB 4OX9Y 2IEZA 1VZ2A 1MNAA 2F9FA 2GZHA 5DTEA 5CDFE 2JHAA 3RG8A 2HOQA 1L6RA 4HP8A 5EWMB 2BH2A 4TLBA 4URHA 3T06B 4EW2A 4LVCA 4OIFA 4Q1FA 1XBTA 2XRFA 1JJBA 3ZJVA 3IRVA 4AIIA 1Q50A 3KE9A 3WSWA 4FDMA 2AI2A 1UANA 4BV8A 3DNPA 1W88A 2ZSJA 3KV3O 2NM0A 4TV8A 3QBEA 2O0HA 4HAZA 4KACA 4D4LA 3F8TA 1ABBA 1ZI9A 3DEKA 1CUEA 2PSSA 3OO1A 3X44A 2RHBA 3DT6A 4LC0A 3NHBA 4IR7A 4KDFA 3WJAA 5F7OA 1E3IA 2ATVA 1P0CA 2QD1A 1KI7A 2A1UB 2P1ZA 4DNOA 3FGZA 2ATEA 3P27A 3LBFA 2EU8A 2GAOA 4BPRA 2JZOA 4JQSA 3TDKA 3L4JA 2FEAA 3FLAA 3ZZUA 4EEZA 4EFLA 1GGVA 3AW8A 1W4BA 4EHHA 5BOSB 2OEPA 3R41A 5FNZA 3A2KA 4M4SA 5BR4A 2QT9A 1PSDA 4GYJA 4C7MA 3GLQA 1R6TA 1UF9A 2GI4A 4AF6A 4DUZB 3FTQA 3KSDO 3SEFA 1MRSA 2BBWA 1WETA 1XQYA 2JFVA 1ENZA 3LY7A 1F3LA 4C1BA 4Z7QB 1FU4A 3CW2A 5A5EA 2FZGA 2HDHA 3T3MB 4QOSA 3T35A 2DQKA 2GARA 4J0QA 4GUDA 4OK5A 3HDYA 2QQFA 4UQOA 2ABWA 2VO1A 1E7QA 2I2FA 3K16A 4CM4A 4QOEA 5K0LA 4GBJA 2WAOA 4TTQA 4AMUA 3EXHA 2EL7A 3GRCA 1XQ1A 5E38A 5JD5A 2OE2A 4HI0E 2G04A 4MIYA 1M8KA 1YULA 8ABPA 4IIJB 4WK6A 4JENA 3AJ8A 2I6TA 4L15A 1YUNA 5J47A 1QQTA 2XCUA 2VRCA 3WI7A 1Y7IA 5C1DA 1USWA 1I3LA 3UOWA 3HJRA 4UPVA 4KBYA 3FZYA 4WGFA 5DBOA 5DX1A 2VKQA 2Z08A 5TQJA 4OUDA 5HRUA 1U6IA 3EZ9A 1NX9A 2RI1A 5JNRA 3M6IA 3Q6MA 1JNYA 2QSJA 3F7OA 1DQSA 4JSTA 3B12A 1U28C 1EGVB 2XB8A 3NBFA 4HLCA 4R8RA 4Q12A 3W8NA 4UVHA 4L9SA 1D4ZA 5D01A 1JHRA 1GGKA 1NKTA 5C8YA 4ABTA 4AZ3B 1JILA 1IPHA 2FWNA 4GQIA 2XCRB 4W5WA 2WQ7A 2FN8A 3RS2A 4N48A 3HYRA 3HO8A 4AX8A 4Q24A 2VHCA 4EGCB 4FFBB 3AR3A 5FBKA 1F2VA 3L1JA 4I9HA 1QZ3A 1N7HA 3TZHA 2O8EA 1YZTA 2BVNA 2I3ZA 5EHZA 5FWYA 1GNSA 2I34A 2ILVA 4G0PA 1THZA 3AEUB 3Q8LA 3FVQA 5DYIA 5FP0A 1NLFA 1E59A 1RKVA 2CVOA 4Y6RA 5FPSA 4G0YA 4FILA 3F6CA 3EF3A 4OK6A 1L5NA 3MCUA 1FUUA 4M1KA 4BLRA 4LN1A 4C07A 1UJCA 5IVHA 4RM2A 5CJ2A 2R48A 3VH1A 1NXWA 2HSEA 1OXBB 5KSPA 1W4LA 3CUVA 3EIEA 5A4KA 4HNVA 5ARBA 5KYWA 3W5SA 2ZROA 1E0DA 3BZBA 4B9EA 3B9BA 3LY8A 2YUTA 3QOXA 2E5LB 2Z3WA 2J1LA 4ESHA 3EN0A 4W8GA 1JU3A 4RSHA 4KDCA 4EHDA 2QLFA 3KPJA 2V6IA 2J8ZA 1M0EA 1M2FA 1UFRA 2JD1A 1J0XO 1EK5A 3N28A 4R2JA 3EVGA 3QBJA 1SZCA 4G67A 4B3DA 3ZHQA 4YMGA 2FSSA 5EJ4A 5LP6F 5LR6A 3O9ZA 2G63A 5ICSA 4MVJF 4ZCMA 1HK7A 2ZW9A 2ZRQA 3V8QA 2JKYA 1VLQA 3NBAA 2C4HA 4M88A 1SGWA 1WW2A 3K0AB 1RQNA 3PUHA 5K0GA 4UFNA 3JQDA 1QYRA 2IVFA 3CYFA 5FOSA 4ECAA 4LY0A 4DPLA 1OBFO 1UJBA 2WTMA 3AI2A 3G0CA 4IVPA 4NC9A 3M89A 1F2TB 3HVHA 5DGXA 3Q1KA 1GUDA 1F8UA 1ZD1A 2OK8A 3CT6A 4GT1A 4HDOB 3INYA 5LBUA 3SBOA 3S0JA 4WZAA 3VR2D 3FM9A 2AFIE 1GT91 1VGQA 4O1MA 2QLBA 4YGXB 3SQMA 1IE3A 4W1SA 1W6RA 2IYNA 4J1TA 4NONA 3KWFA 2CF5A 4IDDA 3KU4A 2RI0A 3S1AB 3JYNA 2ZIUB 1A88A 5KHAA 3UAVA 1I1OA 1OFVA 3BIFA 1BXRB 1E1RD 4MS3A 4UHFA 5HIMA 3AL0C 1LX7A 1VGRA 3CJTA 3FPAA 1F8GA 1DXQA 3PC6A 4NCHA 4DR6B 3V2HA 3EGDA 2HSWA 5KB3A 1WCV1 1XPUA 3MLEA 1TKBA 2E4AA 2OSVA 3DPSA 1G20A 2XVXA 3NWJA 2A4KA 3OF5A 3Q8XB 5CFRA 4WNAB 3IX7A 4EEKA 5IH7A 3GLIA 2HFKA 2NTEA 3DBOB 2I6SA 2DWPA 3OEHD 1X1RA 3E3MA 3GEGA 1WVMA 2GZSA 3JAWB 3TAHA 2H9IA 2NZWA 3KPUA 2YNMD 3JVVA 2GJSA 2WSBA 2XDAA 2IF0A 4FFMA 4AXBA 2DHEA 4FN5A 2H11A 4NICA 1E32A 5HF6A 2C2YA 2O3SA 4K9QA 4ODIA 3K92A 10MHA 3UMJA 2JZNA 4NMWA 2IUSA 1UPFA 1ZGGA 4OV6B 1UWKA 4O3FA 4E6PA 4Y0AA 1SC1A 1XZDA 1U2TA 2C5GA 4LZOA 2XA1A 1VL1A 4YLGA 2V7QA 5LDDC 4V3CA 4UPEA 5C37A 1N7GA 2P9HA 4NXMB 1Z2EA 5BW8A 3EVCA 3HY4A 1F7UA 4LJ7A 4ARVA 4P1ZA 3ZS9A 2OFXA 1QIHA 2P2YA 4W9MC 5D5PA 4ZREA 1Z34A 1Z7EA 4BMZA 3UM9A 2J85A 4K26A 3UV3A 1C8LA 1FA9A 3DZGA 4TVOA 3PGVA 1JIQA 2AN5A 1IDOA 1DLIA 1PLJA 3HXKA 1T5TA 1M74A 2PA0A 2VA8A 2R7LA 2O23A 4BO2A 1DWOA 1SR8A 5DHQA 3KSAC 3DLBA 1H65A 1WX1A 4EECA 2YHBA 4QXRA 2DY1A 4XYEA 4LCEA 5HRCA 4MUJA 2KLBA 1TAHA 1EVZA 2JIZA 2V98A 5K3SA 4EHBA 4M37A 2H65A 2RAUA 2ZS8A 1GZ5A 4LRYA 1IEXA 2YHSA 4OFWA 1E6LA 2J0UA 1NYTA 2V7WA 4XLLA 4CF4A 3NPAA 2IEGA 2Z57A 4YAIA 3DUFA 3ORFA 1AMNA 1A9YA 1M1YB 3ENWA 4UC0A 3TNFA 4ZQGA 5MN6A 3G1TA 1XMQB 1CQZA 1YTUA 1WZCA 3EFOA 4P86A 2QZPA 1SXJD 4YCAA 1P4HA 5KOHB 3IALA 3KDPA 2X77A 4A26A 4G24A 2EWWA 1SCIA 2ZRDA 5TS3A 4KFRA 1FTGA 3J81k 1KMIY 2AI3A 2XLBA 3DHNA 4B7CA 2OYSA 2IYLD 1A2QA 4HO1X 2IOFK 5CW1A 4P54A 5HKBA 1PV4A 1ZM3A 2X7XA 2ZSKA 3TCXB 4RTKA 2WIBA 3FOWA 3I1YA 1MIHA 3ASZA 4YMLA 5T41A 3ND8A 1U3WA 2C5LA 1KKLA 5B2ZA 1LPOA 2IC5A 2PSEA 3GFTA 4B45A 4CQMA 1Q57A 3T4XA 4R7ZA 4IEIA 4BNDB 1KU0A 2B8TA 4OXNA 4NK4A 2WWVD 1M1NB 1PF7E 3RSCA 1A9XB 1L4YA 3LCMA 3OZWA 4C3UA 4D74A 2GYUA 1OTXA 1P81A 4NDNE 2WM9B 1E8NA 3B51X 2PH5A 3ZNQA 2FEWB 4EFNA 3WWEA 5FPQA 3LVQE 2D1YA 1J0AA 4G4SO 4EELA 2RHDA 1TM2A 3DLHA 3CMCO 4G0WA 2WJZB 3LQYA 1W48A 3R1IA 5TT0A 1A8QA 1IDN1 2HJHA 4W1PA 4WOCA 4IO0A 4IVRA 3SVZA 4R71A 5AVKA 4DC1A 3H99A 1ML3A 1GRQA 2W2PA 1G8AA 1DKQA 4U2BA 1B6SA 5EJMA 1CZUA 1KR2A 2ZB8A 4P8RA 4OKNA 4YYEA 2VWQA 3SYLA 3TAUA 5CDUA 1Q0ZA 3Q2KA 2W11A 3RFCA 1YZKA 4DIEA 1ZIDA 3PQ4A 1FS4A 1WBBA 1SC9A 1SBHA 1WF6A 2WU3A 1C1DB 2AW3A 3OLWA 1KAOA 1QWOA 5BUQA 1EESA 1R6UA 2I2XB 3GEDA 4H0CA 4GX5A 2IE0A 3EXEB 4DJAA 1LPNA 2J5QA 5C4GB 3RRFA 4JKYA 3KOZA 1E2LA 4I55B 1E1QD 4H1VA 5B3JC 1PWHA 3HXMA 1DFGA 1MZVA 2FSUA 1O5OA 4C0AC 4IG9A 1TKCA 1JAZA 4UUPA 5DWVA 1FTNA 2OXCA 3BWYA 3WOHA 3RUCA 9GPBA 1Z35A 4RE5A 4X63A 4PNEA 2JGKA 3NAZA 4MJXA 1FFDA 2COUA 5AOCA 3C3JA 4TLAA 4BQSA 4IH9A 1DBPA 4IUYA 4IUDS 3T7EA 1FLDA 1P2FA 5JMPA 2GBPA 2KSQA 2LKCA 5E3JA 3OH8A 4AS2A 3A6HA 2FQQA 3VSBA 3WBBA 2QT0A 2XUHA 3AFOA 4E5VA 4QKQA 1RI5A 2CLLB 3FCOA 1QO0D 2R68A 4Q4AB 1J06A 1O58A 3HKEA 5TQVA 3GA7A 621PA 1BFDA 1PFKA 1JZTA 2OCYC 1W4RA 2R5NA 3B6JA 4PGFA 2UZ4A 5F1YA 1YDMA 3AQ4A 3B6KA 3OKCA 1KY5A 4HD8A 3SE7A 1PQYA 3LPNA 1RPNA 3PXXA 4FSXA 3WIEA 5LM3A 3AVUA 4D9EA 2D0OB 1QQAA 1PJBA 2XBUA 4NJOA 2D06A 3AESA 1W8DA 3TB6A 2PX6A 3AL3A 3MWEA 3TVDA 2AUNA 4A5SA 1KO7A 1F1BA 1N6HA 5KQSA 2NADA 4K9LA 5AVSA 2JJ8A 1BYUA 2W9XA 3FPJA 1G6HA 1R6BX 3ETGA 5DIFA 3GYBA 3EASA 1YRHA 1S8NA 4GBED 4N5MA 2DWUA 1L4KA 4EVSA 3TUZC 3K20A 3GDFA 3E5NA 4BO5A 4OJMX 2VAWA 2P11A 2WG0A 3VR6H 1CERA 1V1JA 1TEZA 1FX0A 4A10A 1E2DA 4UEQA 1TTQB 2CC2A 3H1EA 2COEA 3DKKA 1E5DA 4IHAA 1BFUA 3BDAA 3FHOA 4MRAA 3Q0EA 4BFUA 6NULA 1R64A 3OKPA 2QGFA 2R6FA 1NF3A 1TYBE 5BSEA 5ED0A 2PGOA 1VI2A 1XWWA 1T0JB 1H9AA 2XMDA 4JL6A 1Q3KA 5M2QA 2AZTA 1R18A 2BV3A 5CJPA 1ZR2A 3DPIA 1E69A 2FPWA 2F4NA 1IQRA 1I0ZA 2FR0A 3MSXA 1JDZA 1BH6A 1T6YA 2NXCA 2WF7A 4PLZA 3ZBQA 1QLHA 4V0RA 1C14A 1ZI6A 2HX1A 5IXJA 3BJEA 2UXDB 1VXOA 4I36A 5HWSA 2Q3MA 1MEEA 1CW2B 3GDGA 2BGWA 2AE2A 1L0BA 2BL4A 4JT9A 4MYTA 4TSRA 3TOSA 3NYQA 3P0HA 3I1IA 4C0KA 5KC8A 1B74A 5DYNA 5I8WA 5DCUA 4LBYA 3DEAA 1J0BA 1L5RA 2DPGA 5K09A 5BN5A 3M3PA 3RS9A 2Y68A 2O3TA 3D8SA 4F4DA 4UFPA 5KYTA 2J3QA 2DUUA 3RF6A 2P9EA 3BAZA 3BPSA 1T3GA 4FTWA 5DEOA 3SSNA 4LF4B 5AWFC 1E9SA 4FLMA 1MVNA 3TG2A 3ILVA 2O5VA 3L46A 4TWRA 4X8MA 3W2TA 3HZOA 1DIGA 3C45A 1J7KA 5EMHA 3RDPA 3UJ3X 3R3WA 4L08A 3KD2A 5E6UB 4JR0A 1PUIA 1T8TA 2F00A 3A9RA 3KLMX 4OD0A 4EABA 5BSKA 3A1NA 3RREA 3AYXB 3E3AA 2YMQA 1KFEB 2RJ3A 3W5BA 3HG7A 4TTIA 3TL6A 4D4IA 2CNOA 4QG3A 1GQOA 5I4CA 4TMFA 1HSZA 1ZIPA 3OQBA 1QOZA 5IN5A 4BZQA 2C9ZA 3HUDA 3UJPA 3A27A 4H7DA 3OX3A 2ZK7A 5JRJA 4BE4A 3SMVA 1UJNA 5DXFA 4D0LB 1YH3A 3A9CA 1ST2A 2OXRA 3GC6A 4GMDA 3D6JA 1UAAA 2JJ1A 2HWKA 1QCCA 3LY9A 3HU2A 2VRBA 2WWIA 3A1SA 3AG6A 4RFSA 3ZK9A 3Q6NA 4ER6A 1KO1A 4CYMA 2TECE 2I54A 1RXYA 5DLYA 1WSBA 3T9BA 3SR4A 1KKUA 1P5RA 2CLOB 2W71A 2G6TA 4TV8F 5IXSA 4QXOA 3E9YA 3JALB 4OHMA 2BJHA 5I45A 1A9PA 4ZK2A 4NCJA 2P2NA 4OI0A 2HUPA 3LBIA 3VV3A 5HTOA 4IKPA 4LSWA 4HDSA 4S0ZA 4FINA 4A92A 1A96A 1GOTA 3OZSA 1FMTA 3QYPA 3VHLB 1G21A 4CM1A 1NR7A 4EKDA 5LSAA 4J1SA 2GAIA 2ORYA 2O8BA 2VR1A 2HGZA 1FP4A 3SC4A 4JI5B 4E31A 5CYPA 4NCXA 2POQX 4XVRA 5C7YA 2B83A 4E14A 4M53A 2X41A 1NBOA 3ZXXA 2KM1A 4PBSA 1TZ2A 1XAGA 1AGXA 2IGTA 3PHJA 3BSSA 2ZT7A 4K88A 4DCCA 4DKJA 5AIBA 1EFRD 1Z82A 2NSHA 3IAAA 3RRXA 4NPCA 1JHVA 2HY7A 2OVBA 2KW5A 2VYVD 1OLSA 4QBFA 4YP0A 4B84A 2WYWA 1AO3A 3PXCX 4PCAA 3EGWA 2FPSA 1L8QA 3WWPA 2X0IA 3HXOA 2JBHA 1NHWA 2XWQA 5BQ5A 2AFHA 1NU6A 3PHBE 3ACDA 3R5JA 3BKXA 4LV6A 5CB4B 1EFVA 3FTDA 3PCTA 4XJVA 2K5UA 3SSAA 1X7YA 2WQ6A 1JIVA 1QV6A 4DXAA 4M1ZA 4MYDA 5K3FA 1Q3HA 3LTNC 3Q1LA 3SJCA 3I9NA 3S5UA 4ED9A 1KSHA 1P19A 4FXOA 3W06A 5K03A 1XCBA 4HRAA 5M5BA 2G9UA 1QE3A 1MT3A 1V43A 2DGDA 5AKHA 3TSYA 3UYKA 4ZI7A 5ICEA 4ZKDA 1ZM4A 4B3JA 4EDFA 2YJ5A 1LK5A 3ZXSA 1KTVA 1PYOA 1RBYA 3SYRA 3UAOA 2WJHA 3L5KA 1UP4A 5E1MA 2F55A 1NULA 4NZMA 5HMLA 4XD7A 2CXSA 2Y1FA 3K0FB 1B6RA 1LLDA 4POAA 1KEZA 4ID9A 1JEAA 1PWZA 3SM9A 3I6BA 1EE9A 1R5BA 2X3YA 3KETA 2QN6A 4DCVA 1H3FA 4IAOA 2YXLA 1GPAA 4IM7A 1GILA 2HA3A 1O5IA 1QH0A 3OT1A 4XI9A 2EX0A 1OKKD 5HIAA 3GCZA 2LRHA 1XRPA 3PL1A 1GQQA 1KVUA 1IRXA 4C30A 4AJ9A 4E4YA 3PGMA 1KRXA 4UATA 3IMGA 3FB1A 5CIQA 2FX3A 3PWSA 4JBNA 4N0MA 3HJBA 1TF7A 3Q85A 5CDTA 5IBCA 1VYUA 2Q6TA 2LWIA 2IW3A 2O4CA 4AO8A 5KTOA 1JH8A 3GFPA 4GKAA 4YRTA 2FWJA 1M2VB 2H6EA 3M3HA 4ZALA 1RJDA 3FVWA 2OUIA 5THXA 3STTA 2IYXA 4JR1A 3TQFA 3CIFA 1KGDA 1C0KA 2YRWA 4J1NA 4KKXB 4PC6A 1T43A 1JTFA 4B5LA 3I53A 2OHIA 2G83A 2JHPA 1Y3BE 3BC1A 2OV8A 2QTVB 2XMQA 3E22A 5DLQC 5BWNA 4TTAA 4FWIB 4HWTA 1UBTS 1ZGJA 1OTHA 4Y9SA 3LO8A 3SEAA 4CUKA 4PGGA 2SBTA 4RNCA 3K9BA 4DJ5X 3GIDA 2Y1XA 3M6FA 4OF4A 1L1RA 5H80A 5C34B 3FWNA 3A1FA 1J22A 3OF3A 1OH6A 1TM7E 1NNSA 4F6RB 1Q7EA 2YIVX 4AJ1A 3O91A 2DUJA 2GF2A 2V7UA 4MGZR 5GJBA 5JCOA 4CDNA 3ITEA 3NGMA 1F2UB 4PG4A 1I6LA 4X54A 2OYRA 1CUWA 2SKDA 5CDFA 3QNUA 4EVQA 3MMPA 4D6YA 1EUYA 4KFUA 1EEHA 3CM0A 4A9AA 1UZMA 5A7HA 1EDBA 3RVBA 2VUHB 3BJZA 2J87A 4WX2B 5ED4A 5FUXA 4MULA 1O94A 2H92A 3NWBA 5AOBA 3LQRA 1KK1A 2EZTA 4KQEA 3HQ4O 4HNUA 2ZR0A 2AOXA 1P2VA 4G8CA 3HCDA 1C9JA 1NXVA 1LX6A 2CVZA 3N8IA 1JKIA 4PYOA 4ZVRA 2ZRHA 3LE8A 4OHRA 1GU7A 2Z1DA 3DOUA 1AMUA 1ZRMA 3IDSA 2QZSA 3ONVA 1ISSA 3LV8A 2BTQB 3ZW9A 5FBHA 3P1JA 1ZVMA 1WDWB 2XXBA 2YNMC 4K6MA 4Q15A 3QELA 5TF0A 1C8VB 4LJ9A 4MGIR 3PC8A 4RH0A 4EJSC 1FMFA 5C5DA 2ZUWA 1VPVA 3AERB 3FFBA 2IPOA 3OPMA 5GONB 4D9HA 3VPFA 4WN3A 5J3JA 2QM7A 2GS9A 1LK7A 3DO5A 3GBSA 4PZEA 5FR1A 3M3DA 3LWZA 3TLBA 3ZWAA 2OKGA 1U1CA 3K7EA 4NBUA 3AUFA 3KAKA 4REOA 5CNKA 5B1SA 4R41A 3WMFA 1F14A 3CG4A 5JWOA 4FWBA 1U2GA 2HTFA 3LDAA 2B1GA 2DKFA 4XVHA 3RKUA 4PHHA 4JOSA 2YZ2A 2NU8A 3WK4A 3UMSA 3F9IA 2PZKA 2YOHA 3FKJA 1KEEB 4BBPA 1P7YA 1Z08A 2HGSA 2NU9A 3AU9A 3G2NA 4UVDA 1M8JA 3QVJA 4J0DA 5BPFA 3H9JA 3NHJA 1Q83A 3V1NA 3VR5D 4L5YA 1QLWA 3GUVA 4P4SA 5CT8A 3FYTA 4GXQA 1QO9A 3KLOA 3UQZA 4IV8A 1YDGA 1I14A 3NHUA 5DLEA 1WXGA 4QGFA 2HF7A 5FL7A 3PZBA 3W7VA 4C14A 4FFLA 1X7XB 3ON5A 5KJ1A 3MFYA 1N2ZA 3RQSA 2YY6A 2F2TA 1M2HA 3VXKA 4RVOA 1W0JD 2B3DA 4L57A 1XAIA 4OHVA 2EVWX 4N41A 3GPDG 1MUUA 2F62A 3L7AA 3URMA 1KH3A 2PWAA 3CEHA 5EZ5A 2RI6A 1TF2A 2OFFA 1ZSVA 1HDXA 4HYYA 1DEXA 1SXJC 4NABA 1Z5VA 3MWJA 2ZJAA 3NGLA 4DY4A 5IU6A 3DAFA 2FE4A 3MBIA 1A0OA 3QSGA 5G1PA 2FR8C 2WVAA 4ZDKA 3I2YX 3IUMA 2CUZA 3JD3A 5FTNA 3V4ZA 3PQEA 4DV2B 1VPWA 4AURA 4F06A 2GPNA 2D5LA 2CYCA 5HCNA 1UPAA 5CVDA 5ALUA 4EARA 1PYDA 1QKKA 3GK3A 1C7RA 4UTOA 1V16B 3BFVA 2VXCA 1GSAA 1I0LA 2OG2A 3T7TA 3ELYA 4REMA 4NNPA 4ENVA 5LQKA 2R79A 1SD5A 4DCJA 5TGZA 2BFCB 3H75A 2WWRA 2FHPA 2HV8A 4FR0A 2UU9B 1TQ4A 3BFPA 3G0OA 2YV2A 3ACBA 3OM8A 4UMVA 4QJ3A 1LEHA 4P32A 5JXIA 1C2TA 2QMHA 1XJ5A 4IDGA 3GNQA 4HBZA 4XFDA 3AT1A 5JEDA 1W581 3CH7A 4IILA 2IH4A 3GJ6A 2B20A 1P4AA 2WC1A 4OLHA 1POXA 1H8EA 3LS2A 1PR4A 4LAFA 4LQ4A 5EHGA 1DVRA 1SQ6A 1MB9A 2YCLA 2HK7A 3BD6A 4M7PA 5D7NA 5K9ZA 5JS7A 1T26A 3JQBC 3OJ0A 2H7CA 2YJTD 3W4IA 3U6BA 2C5HA 4PIMA 3SQNA 1F5NA 1OZFA 1HETA 2Q27A 3OE7D 3UJAA 3QVGB 1U0JA 4B7XA 3UJCA 1OH5A 4FD3A 3T9AA 3QUSA 2P9QA 4MRMB 3WLHA 3RAFC 3SMQA 2YH2A 4KH1A 4MV5A 1G9SA 5KREA 3ZD7A 5EZSA 1I32A 4MPTA 4G5SA 1GNRA 2IYPA 4XDGA 2ZGVA 5EMJA 4NOMA 3TZCA 3BD8A 1NHGA 4PINA 3WB1A 1FUYB 4ADSG 4CR7A 5KVSA 3W78A 2HJRA 1JG7A 2HYDA 3I52A 4JYMA 4OP2A 2AS0A 1R4NB 4IF4A 3WNCA 4OO3A 3UEOA 4JUIA 3SQLA 2E7ZA 3BFJA 1NFRA 3ISVA 4KU4A 1U1EA 1VPDA 1KZYC 1YJ8A 3OUTA 3RS8A 4DA0A 2AFIA 3UC9A 4GZLA 5DHUA 2FZCA 3OC6A 1VG9B 3LRXA 2D4AA 4F7WA 1STOA 3P5SA 2BGNA 2ZSFA 1M67A 3EQ6A 1TGYA 3L1VA 1P6UA 1P0FA 4OXXA 3S68A 4PO8A 1UXOA 1C1YA 2QRVA 4QG7A 2W0MA 2IWRA 2OV3A 3LMKA 3WGTA 4WOPA 2Z83A 4NEGA 2WF5A 4A0FA 3G2LA 3U4GA 2EX4A 1LWOA 4YDSA 5AI0A 3GLVA 2P9BA 3D1JA 3QFRA 2PVSA 4PQEA 2NZ2A 4JI7B 4XOIA 1UDCA 2PZAA 3LT4A 4XOUA 4B17A 4KYVA 1R00A 2HF2A 1EM8A 5CDGA 1SCAA 2PLRA 2ZR9A 3BQNB 2NOAA 3MMSA 2PKWA 1NJ6A 3WIUA 2P5YA 1KKMA 2VG8A 3QJYA 3LCJA 5FOUA 1YIDA 5EGNA 1SOUA 3L7NA 1BRTA 3BXEA 1JKMA 4EUEA 1PFYA 3FAKA 1PX0A 4FGKA 1CY7A 2GERA 1OV4A 4QBHA 2FXVA 2EOAA 3QKWA 3TBFA 4G81A 3NHKA 4HH3C 4MWEA 4EOGA 5LYJF 1F51E 3PGXA 1H2BA 1EXVA 2MINA 4LZNA 4MQFA 5TEVA 3JASA 5BN4B 1FFAA 4KNVA 3L5OA 3TLXA 4YAEA 5C4IA 2YS7A 5IDQA 2ZTMA 3I2FA 5CA0F 1QU3A 2ZULA 3REQB 4ZJUA 3Q5EA 1AGYA 4PAGA 2PWYA 1XZMA 5LC1A 1UKAA 3M2TA 4G1CA 2A5DA 5SV2A 3CRQA 4J0JA 3FCCA 3C98A 3WFJA 3IP5A 5TGTA 2OQVA 3WHPA 2XBLA 4YCSA 2OECA 3GXOA 1WVGA 1PLKA 3FDIA 2IU0A 5JVDA 3FHTA 1J1UA 4V3BA 5KPJA 1FJXA 5NLLA 4Z4IA 3STWA 3RASA 4QM6A 1JVBA 2X5KO 3HPQA 5EESA 3TOVA 1KEKA 3AL2A 1YR6A 1IN1A 4QEDA 3T99A 3LPCA 1EP3B 1E7YA 1H42A 5JH7A 1P6QA 4FFPA 1XEXA 1GYQA 5TVKA 3P19A 5A6SB 5FOVA 5I7FA 3DMFA 1MAHA 3CZRA 4BRSA 1LDMA 4WLEA 3OEED 1IJBA 4QUKA 1ISIA 2PL1A 2FCAA 4CV3A 1PTJC 5FUBA 4IZHA 4LF9B 4R9NA 1WG8A 1ZIXA 1FMJA 2NAFA 2WW8A 4B75A 1NJSA 3G9UA 2UVPA 4L0MA 3WDLA 4LMRA 5BSVA 3L1UA 2ECFA 4FYHA 1A2BA 4O33A 3T5AA 4WJLA 3GLFB 2GN8A 4HN9A 5HE9A 1DJOA 3AG5A 4W5JA 4B33A 4BJ5A 4HFNA 1JKFA 3ICEA 2C0PA 1YKSA 2D3WA 1I8TA 1L3IA 1MMFB 3HXPA 3NW9A 3C7KA 1AB6A 2FOXA 1TO2E 1SKYE 1XU4A 2H51A 2J3EA 5AK0A 2H1HA 2NIPA 2MR5A 4GGMX 4II7A 4F97A 2R1TA 1MD9A 1LTQA 2D13A 1SAYA 2PGLA 1S7GA 3K0KA 3L1KA 1TPYA 3LM8A 3NBYC 1U98A 3PXBA 4PZ9A 5TNXA 2QRHA 3VR3A 5LQRA 5FA5A 2XF8A 4NQRA 2JAPA 3P26A 2BHSA 3IVMA 4DJFC 1QQ7A 3F4BA 5FFMA 1BAPA 1E2FA 1XXHE 2B8EA 2RHHA 3C85A 3O7MA 5FOWA 3ONEA 5LB2A 4AJ4A 5IF9A 3I2JA 4FHFA 4KXMA 3ECAA 4CMKA 5AHOA 4N39A 4QVIA 3Q8MA 5DGHA 2QV0A 4ZU3A 1Y8RA 3ZHCA 4FIDA 4UEJA 5IKXA 4MDFA 1TYCA 3ABQB 3ZD9A 1Z5OA 1PN3A 5EJ5A 1AHPA 4DMHA 1YE8A 4P92A 2IV2X 3WA6A 4BFVA 2RGRA 4X62B 1UBNA 1YUMA 3EGCA 3OJFA 1JI0A 3WB9A 3V4PB 1E1DA 2IY7A 2EEPA 5ER6A 5B7GA 2WBLC 2FYTA 1IG0A 4WZZA 3QFFA 1WDKA 2B25A 2FA9A 1H2EA 2EGUA 4R9VA 4MWDA 5FNVA 3TW4A 4DQKA 4BN4A 3ESCA 1M0TA 3V8EA 3UCFA 1XCMA 2KS6A 4LEIA 1NW3A 1RC0A 3TLJA 1PL0A 4M0KA 5ALHA 2FOIA 1GEGA 1KZGB 3I2GA 1N6LA 4ZAZA 4FEAA 1VI5A 5H9VA 3ZD6A 3IEVA 1ISRA 1O9BA 5EWLB 4H59A 1EWQA 4JVOA 5AFSA 1N2CB 3O8CA 1EX6A 2CMKA 3FNGA 1J90A 2GHRA 3CUTA 2KJQA 1EHIA 1JHMA 1A2KC 2ZUVA 1ZEJA 4JJKA 4F4CA 1RJ9A 3B2QA 2O0KA 3O3NB 2BHRA 3BWDD 1KP3A 3PGA1 3VA7A 4DB2A 1TCBA 3HKCA 4DVJA 4Z4GA 3GLUA 5JPDA 3NG1A 2XUPA 4C5BA 3AR6A 2PIAA 3OLXA 4TWAA 1Q7RA 4UD2A 1HNZB 4HZUA 4HDKA 2VDKB 1W5SA 2C58A 1SNYA 2DCUA 1DE0A 3G9XA 4HQ0A 4MQEB 4PANA 5IAGA 1N34B 1T5LA 3A0UA 3FPKA 1DXHA 4J07A 5EWMA 4YRBA 5TR9A 3ILSA 1W4AA 2LTAA 2XUJA 3Q3IA 2QLJA 4GOMD 4MP6A 3HZZA 2PX0A 4FZRA 4GKVA 1BH2A 3KFLA 1Y1RA 3QUTA 1FTYA 1R6VA 4RD3A 2ODNA 4F56A 2X8WA 4PCVA 1W36D 2BR5A 4HDQB 2NO1A 3VU9B 4Y1FA 3WGLA 4BGIA 3UJDA 2FSPA 3BE5A 4JT8A 1QG2A 3R0QA 2CBGA 2C82A 3L82B 2OZVA 3AOEA 3LUFA 2DLDA 4P82A 4N82A 3S55A 1NBME 4IIDA 3THXB 1FBTA 3EK2A 4TLEA 3TQIA 3L8FA 3U49A 3VYWA 1CNMA 1NAHA 4FQ8A 1FRNA 2C4VA 3DZKA 3T9CA 1JJ7A 1MT0A 3QZUA 3SYKA 2ZJ3A 5HQ3B 2Z5FA 1POWA 3EXAA 3OURA 1IJFA 1S3FA 3L6RA 3U48A 5AMXA 1B15A 1ADGA 1M2JA 4PFKA 5IWCA 1E9FA 3KKOA 3V1UA 5HJ7A 2L19A 2HRBA 3A58B 1Q0UA 2HBRA 1NY5A 2I7CA 4Q01A 5C1IA 4E21A 1VKZA 5KU1A 1OWPA 1G2OA 4OBWA 1MEJA 5DN6A 1GTL1 3KZVA 1CZLA 4KOAA 1ISPA 4IYJA 3CF2A 4BMCA 5GAJA 1GDTA 2I65A 4HWRA 2RBKA 5FOXA 3S2YA 2JGDA 3I23A 2Q3EA 3K0CA 2D1SA 3EFBA 2J3KA 3MJVA 1HDYA 4TMXA 3OCWA 3BIJA 4KE7A 4XQGA 1OHHD 1D3AA 4RKQA 5FKJA 1II8B 4H9GA 2IPMA 4IIJA 4PS1A 1ADFA 4XEHA 2BLNA 1W93A 3MFQA 4DMCA 1I13A 1Z6AA 1WY7A 5CBPB 5COAA 2D5CA 4YWJA 4HNTA 2XDWA 3VOSA 1JFFA 2AKEA 3HI4A 1TYAE 2AV6A 3EUEA 3BOSA 3D5QA 5JHGB 1DMRA 2GJAA 2ZSIA 5LBTA 5FUQA 4GXNA 4OGKA 4Q7MB 4YTEA 3WYDA 4K46A 3PHGA 1PGPA 4X3CA 5IEBA 4E2WA 4I08A 2YXNA 1VP9A 4J49A 1GZHB 4AZ3A 3P0IA 3GQVA 3NTVA 4CL3A 1MCZA 1O7JA 5KSZA 3E2PA 4EHLA 4L5JA 4AJ2A 4EJMA 4Q21A 3MTDA 2KBEA 1HWYA 3ENVA 4RIEA 3TLKA 2XD4A 4TTSA 3ZDZB 1LD3A 3TZ6A 4FONA 2UXBB 1M2GA 5TC4A 3GHYA 1YZQA 1BU5A 2BH9A 3AEUA 4Z7JA 2A33A 4H3HB 2ESRA 5BV1A 4M38A 3NFYA 2FF7A 3KEGA 1WV1A 3FPEA 3LPDA 4U6QA 4BKUA 5JU6A 2MSLA 4IEEA 1YNOA 5HFAA 2OPBA 3MS7A 3DDOA 3PQCA 4KRGA 1ES9A 1G66A 4RADA 4BO7A 2L18A 4QUJA 2GH1A 2IY9A 3MXTA 4K5QA 1ZOPA 2C20A 4RD6A 1R6DA 4V0SA 1WULS 2ZWVA 4BVJA 2B4KA 2CFTA 2GLXA 2HIGA 2JGAA 1XNHA 4IZOA 1PEAA 2MSWA 4DUGD 3CVYA 1WBDA 1B41A 2EW1A 2NO5A 2OR3A 2VXBA 1X1CA 4OY3A 1NRWA 4URWR 2H1VA 3QMMA 1KXJA 4JN6B 5B7QA 5KHOC 1NWHA 3O92A 5TS2A 3SBEA 1VDMA 2ODTX 4PX2A 1SVNA 4B35A 3V48A 4L1KA 2V4UA 4ZHQB 2W00A 2GNOA 2WMYA 4L4UA 3TLGA 2QJOA 3RJMA 1KBZA 2V6BA 2YY7A 3GDOA 1LFDB 3FROA 3JVEA 5GM1A 2I66A 1Z2NX 1BD4A 1YCDA 2IP2A 5EIBD 3HZHA 4CHGA 3KL4A 2HU7A 5CUQA 4W9NA 3FOZA 4WXHA 3RTBA 2C98A 1ISMA 1THTA 4N18A 4DIUA 5KYYB 3V4SA 2OUKA 4YASA 4U5QA 4WCFC 3KYCB 2PUWA 2QG9A 1O6CA 3W3AD 5CCDA 3DQPA 3KQVA 3TLZA 4AUMA 1H94A 4CV1A 1TQHA 3FMGA 1U9IC 1RTKA 1MOPA 2KB0A 3F4LA 4JP1A 1F2TA 3C16C 4MLZA 4W6QA 1P75A 2Y0CA 4Q9DA 3R76A 1GNTA 3PUYA 1XRJA 4N4AA 2VJLA 1X2EA 2BDUA 1DP4A 3SDSA 1JHDA 1OLOA 5FYQA 2C31A 5F7ZA 2CNDA 2OORC 1CVLA 3E9MA 3ZWPA 4RXTA 3SE0A 5CXSA 1APBA 3ISJA 3AKDA 4GGOA 1Y1TA 5DP2A 4RTNA 1BXRA 1XWFA 3EPPA 3KZOA 3N2NA 2WHRA 1VJRA 2J6CA 4JL8A 4W6ZA 4EYKA 4UOZA 4XWOA 4I4TB 3ZHXA 1C4OA 1R66A 4UHJA 4KCGA 3KDAA 1GITA 1LUAA 4ZYTA 3A2NA 4NR0A 2YWHA 5IVKA 4WNAA 3NJ8A 2WZQA 3AZQA 2E2WA 1PT7A 1GGMA 1A50B 4MPRA 3ASYA 4H60A 1ODFA 3JAWA 4H6WA 3OFSA 5F5XA 5IF3A 3FG9A 4KODA 4TZKA 1LNQA 4DDKA 1RQGA 4Y1EA 1C0LA 3JZAA 4A6XA 4G2TA 2DQSA 3R5KA 3NAGA 1DAHA 5A2GA 2FPGA 2HCRA 3ZQ4A 3CZ5A 4F4IA 1ATZA 1JHXA 1QF7A 1BNCA 4QOHA 1FLAA 1VKRA 2GXQA 5EJAA 1IHYA 2QTZA 2XCIA 3AKEA 1U0TA 3MTJA 5LNK6 4WNIA 3GWZA 2CDNA 2C2BA 4NJMB 1JG4A 5LQNA 2QL7A 3GI1A 3L40A 1RNLA 5F7JA 5JCJA 3HA7A 4Q3OA 4B6SA 3BMQA 1QC5A 4MUKA 5KWSA 2GJKA 5EQFA 1V39A 3Q9LA 2ZQYA 1L5GB 2PZEA 1Y7LA 2JAHA 5IFKA 3ZGYA 4YI5A 3ZWYA 1P45A 1XE3A 3BL5A 4LXTA 4JODA 5KI6A 4KPUB 3SYMA 2XA2A 3HA3A 3KL2A 1DZ3A 3R3XA 3NVMB 4EK9A 2BHLA 2FMKA 3LF1A 4CUZA 5IJZA 3MWGA 3TX6A 1AS0A 3VSDA 4O8ZA 1JW9B 1I6WA 1RLJA 1YI0A 4HGYA 3JS5A 2GRUA 2WNHA 4J16C 4LVOA 1FL9A 4DVGA 2UUBB 2D7JA 1GQYA 2GVDC 5TQ0B 3P9RA 3DC2A 1U8UA 1YR7A 3B5IA 4LRUA 4G3XA 2PE5A 1RWQA 4M89A 1IN6A 1SKQA 2A0KA 4YCBA 3KSBC 1MW9X 3I28A 1T3ZA 1TQ8A 3ELBA 1M1YA 5A5VA 1N5RA 1JTVA 1DELA 1Y81A 3A6DA 3X1ZA 5CIWA 1I2DA 1YS4A 3PNPA 4BRUA 1AKTA 3BMCB 2Q3FA 3LPAA 5JSQA 1N0IA 4OQXA 4PU0A 3B1JA 4P53A 4F71A 1A4IA 1T29A 2D5AA 5JNLA 4PHGA 1ADBA 1DUIA 3C0KA 5JDIC 2X6RA 3CX8A 4D8YA 3DXXA 1HL3A 4G9GA 1MH1A 1NRIA 5ES4B 1UWLA 2XF2A 3CPHA 3KUKA 3IAM1 3HYCA 1VE5A 1WSAA 2DERA 1V7QA 4GLFA 4RK5A 1GXSB 4E2YA 2QUIA 2G5GX 4FBMA 2NG1A 4WESA 1MQAA 5ALLA 4H4EA 1NNI1 3CTPA 3FCSB 4UTVA 2C7BA 4CF7A 2JFBA 3WMWA 2NTYC 2DKNA 2Z5LA 3FE2A 1M1NA 1UKVY 2PSJA 3EXIA 2ZIXA 2XOXA 1EVEA 2PH7A 2QVLA 5F64A 4TQGA 3K94A 2O8CB 3TQTA 3L1IA 1H0SA 2W2QA 2C3MA 3CHYA 3NNSA 3N2IA 4CL8A 4YCCA 1YOVB 4YMUA 5L9AA 4HF7A 4TKVA 1C3XA 3DZJA 4JXJA 1VYHA 3NIGB 3MPOA 4CMEC 4V0OA 4D0SA 4B79A 1IBRA 1W25A 2REQB 5HRAA 1FJGB 4BL5A 1QXSA 1QGAA 3ZCRA 5ICCA 4QUEA 4WUVA 5BR1A 3II6X 5EHNA 2HFJA 2UZ1B 1SU8A 3JRNA 3ZWOA 1YONA 1A8PA 2OB1A 1LPSA 1C1DA 1ZZGA 2C3PA 1AKNA 3F3MA 3MCZA 4HCJA 3NHYA 3FUTA 1S2LA 4BO1A 2MSKA 3OHSX 1PUJA 2WFAA 4JLJA 2WSSD 3IKTA 1PNVA 4A7PA 3MTQA 2AMVA 1DBIA 1SKMA 3PRYA 5UKDA 4DCUA 4BMYA 4ARAA 3IERA 3OBIA 3CX6A 2H3EA 4G85A 1WUYA 4NG4A 1Q0LA 2R65A 1IVYA 1F6BA 1PD1A 4L8VA 3K1TA 1VHLA 4ZYVA 4MV8A 4ENQA 1BCRB 1FTWA 1NLMA 4L27A 5CCBA 2QLMA 5CDSA 4R1LA 3BRWA 1A8HA 4Z9BA 5JH7F 1HNWB 2VTVA 1RLUA 2JDID 2OCAA 4Q7JB 3DFIA 1S89A 1FVXA 3IUNA 4M0CA 1T6NA 5CM2Z 4NARA 2G71A 4DLVA 3I8OA 3MHTA 2XKAA 2ZUTA 2P0YA 1X1SA 1E3EA 2GFIA 1CQJB 3PCXA 4G5XA 1I2CA 1CUGA 2YWDA 3E9NA 4ISBA 2OAP1 1M73E 4PYKA 4RJJA 1Y42X 1N36B 1FUEA 1G0NA 8AT1A 3FLMA 2XCQA 3IOCA 3CT4A 3INTA 5D84A 5BURA 2XUAA 3ZLTA 3ZE1B 1AQUA 4PAOA 4ZOQI 1U3DA 1UMBB 5HXAA 1I80A 4BWFB 1FW8A 2JD2A 2XYVA 3LJKA 1IK4A 5CAEA 1ECFA 1HF3A 3TZQA 1BKYA 5E7QA 4C21A 2HHAA 3HUUA 1P3JA 3PD1A 1CG6A 3EG5A 3DOOA 2OBNA 2NXWA 1J5PA 2QZ9A 5BT9A 3T9FA 1SWWA 4PPGA 3TX2A 1YL6A 3MILA 3PUIA 4RNDB 1XHLA 4A6EA 4CG1A 1IZYA 5IHXA 4GLJA 2H07A 3ZX4A 1K7XB 1JT9A 1G8HA 1NSFA 1TNDA 2D1RA 3L0OA 3O4RA 4IEFB 4MGYR 4F3RA 4AKIA 4TMVA 1K0UA 3GJ7A 3E7WA 4D41A 3K5PA 1ZITA 1ZO8A 4GFDA 2Y1GA 3PE4A 4RTOA 3G2QA 3NTXA 1BS2A 4HQNA 5AJXA 2E37A 5B55A 5KYUB 3H05A 4G89A 4Q7KA 4KP7A 1CHDA 4RMJA 3IBGA 4P81A 1TVCA 4R8KA 1ENOA 3GL9A 4DIFA 2YCBA 3OTQA 4X6XA 1PYGA 4O4JF 4ZI2A 4QQKA 3WK6A 3EWAA 1XDZA 1ECGA 1XZ8A 2HIAA 1DEKA 2YOFA 4RLQA 3BRCA 3W77A 4C01A 4C7OB 1N5IA 1L4EA 1RJEA 2A4MA 4PZLA 3CUUA 4RDIA 5IC6A 2QP9X 1FIUA 2PRZA 1FFSA 2YS6A 3EGXB 5JR3A 5JJBA 3MS4A 3GR6A 4EKEA 3ZE6A 2AQIA 1ZC3A 2F1HA 4CCYB 3OJOA 4FDLA 3LKDA 1QS0A 1VL2A 2LV8A 4BMOB 2JI6A 3QOYA 2BMVA 5C51B 5AM4A 1E3DA 4YXWA 1HM5A 3AXSA 1X3LA 3VO9A 4I1PA 1QQBA 4JKOA 1UFQA 3NM6B 5KTKA 2A3NA 3IMCA 3UT6A 1DWQA 4TWZA 5E2AA 4JJGA 2IYQA 3K71B 3RV3A 4K9KA 1SG9A 4TROA 1XALA 3KDSE 4YCLA 3QKUA 3NKVA 1LJUA 4LWOA 1TJ3A 4QIHA 5EXXA 1E3WA 5AK3A 1X0XA 2HKIA 3BWEA 3X2FA 3MEQA 4A8JB 1DQPA 2V1UA 3WADA 5L4NA 5DTMA 4ZAYA 4M0DA 4U6SA 4ZD6A 1S7CA 1E1CA 2O8DA 2JFFA 4N40A 2OBYA 3HYTA 4PIPA 2HF8A 3AINA 4YJ2B 5LXTB 1W36C 4PR3A 3QFSA 2LCFA 2M6RA 4BQIA 2D59A 3G5MA 16PKA 1EDZA 1X8XA 2C2OA 1YDWA 3NIWA 4QNRA 1AZSC 1BWRA 1RAHA 4IHJA 2DWQA 4JEIA 3GFVA 1YR1A 4B3FX 2GBFA 3T7AA 4CTMA 1IY9A 4UQPA 1R8XA 3WP0A 3AM4A 4RE6A 3PPVA 1LF5A 2WYIA 1XZKA 1JU4A 1N75A 3DFKA 1LBIA 3WV4A 1P62B 3HN2A 3C3WA 4DCSA