1FS5A

A discovery of three alternate conformations in the active site of glucosamine-6-phosphate isomerase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-6-PHOSPHATE DEAMINASE
publication title Structural flexibility, an essential component of the allosteric activation in Escherichia coli glucosamine-6-phosphate deaminase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 92
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fs5A00
1UJ5A 3ENQA 2BKXA 2WU1A 4L4YA 3CH7A 2R5FA 1CD5A 3KWMA 1DEAA 4L51A 3BXGA 3E7FA 4TM8A 1HORA 4GMKA 3NZEA 4L4ZA 3U7JA 3BXHA 2W48A 2RI1A 3ICOA 1LK7A 3HHEA 1FS5A 4L5JA 3EFBA 4X84A 1LK5A 3KV1A 3ENVA 3BXEA 3LWDA 1UJ4A 1VL1A 4R9NA 2J0EA 2GNPA 1FQOA 5HJ5A 4R7TA 1Y89A 3NWPA 2BKVA 4IO1A 4M8LA 3L7OA 4GO1A 4OQQA 4L5IA 4OQPA 1LKZA 3E15A 3TX2A 1PBTA 1KS2A 2RI0A 1NE7A 3EB9A 3UW1A 4NMLA 3OC6A 2O0MA 3CSSA 1JT9A 1XTZA 3BXFA 3HN6A 4TM7A 2F8MA 4L50A 1FSFA 1O8BA 1HOTA 2OKGA 1M0SA 1FRZA 1UJ6A 3LHIA 3IXQA 1FS6A 3ENWA
chains in the Genus database with same CATH superfamily
1KSGA 3G7NA 1N2ZA 5EA2A 3VKFA 5IT0A 1KZ9A 3CY6A 2HLNA 5B4VA 2BRUA 4GMFA 4FE4A 2ZYTX 4CMJA 2IKQA 2W2KB 4XD7D 3EZGA 2UUPA 3Q0TA 3DWIA 4O2BB 3WRVA 3ZVKA 2WWYA 3ONFA 1GKUB 1J8MF 4KQGA 2Q5FA 3R75A 4DJAA 4ZANA 3BWXA 2C9DA 5F12A 2Z6UA 5IBRA 2OPHA 1G6HA 4TVOA 1XAHA 2CVPA 3BD8A 3ED5A 2FF5A 2CNBA 4O4HF 4YMWA 4F5WA 3W5SA 3O1IC 1GTRA 2PLNA 1XMIA 2AOVA 2QL5A 4CT4B 2ZYAA 3F73A 2J3IA 3RG2A 3N2ZB 4R31A 3ZCTA 2YZGA 5EUCA 3HJFA 4KFTA 4DA8A 4KE7A 4C06A 4ND8A 3BICA 4ND4A 5FIUA 1IN7A 3QF7A 2G6BA 3K5WA 1P73A 4FWBA 4R8SA 2ZU6A 1CQIA 3TH5A 5DN6D 4PLYA 3PUYA 4RDIA 4URYR 3LQ4A 3GP8A 4C4TA 5FFNA 4HLUC 3LO8A 3JPYA 3KQVA 2NX2A 3MTJA 4MEBA 4ZZ3A 3MJEA 2PZMA 4N1AA 3QG1A 1KDYA 1U81A 1RHRA 1GO2A 2QK4A 4KMSA 5HOQA 3ZLJA 3QFSA 5DP1A 4YWHA 1YVRA 3ZJ4A 1BRTA 2Z0MA 3EXIA 4JLVA 1U3FA 2LD4A 1EDZA 1NMYA 3K1YA 3AUYA 2FZ4A 3QNWA 4D9IA 1REQB 3IIMA 1AUPA 1CY7A 1J70A 4AY5A 2XCTB 1EEXB 2JW5A 5JPIA 3WMGA 4LHVA 4R2KA 2P4SA 2EX1A 2GJ9A 2PX2A 2Q5LA 2GNPA 3QF4A 3CJRA 3JD0A 4NDAA 1UFKA 1ZSYA 4GZLA 3URKA 1M9NA 2G67A 3EC2A 4PBRA 3NG1A 1E3WA 2VOEA 3IOMA 2XGSA 4JOBA 1T25A 2A7QA 2AE1A 1IEQA 3IODA 3QE9Y 3L6UA 4EL0A 2Z8YA 3C5VA 3IOEA 1FP2A 4TVBA 2HMVA 4UXIA 3KHUA 2W37A 1WZIA 4YB8A 3UM9A 4CMAA 4KE8A 1T35A 4FCWA 5ALMA 3L79A 5ADUS 4N48A 3IQHX 1SM4A 4PTLA 4LF6B 3B5EA 1FVHA 1D04A 2O8VA 3AT1A 1WKBA 1WLYA 2QQEA 1C4OA 3OC0A 4FQ5A 4H1TA 4QL3A 2C5HA 5LIRA 3THWA 3PLRA 4RZUA 3KC2A 1W0CA 4G1MB 4M1KA 3FZQA 4D97A 2E4UA 4KVFA 5CVCA 3P1JA 1DVRA 1BXRA 4TMWA 5F9MA 2VWPA 5LA6F 3MTIA 4EM6A 2Q8QA 1KFBB 3EYAA 5DCWA 4WINA 1TYDE 3QQ5A 1RPAA 4LRUA 1SVOA 3ZVMA 1V71A 1VLJA 3MMXA 1UT6A 3I9KA 1ENYA 2YJGA 1N1DA 1KI6B 3JQPA 5IAEA 3NRCA 3IVAA 1DEXA 1EVJA 3D8NA 3GEDA 3QMWA 2OZPA 3RK1A 3ZIAD 3B7PA 2WUFA 4N6GA 2B69A 2JJ1A 3CKMA 2O5VA 4WDRA 3FF4A 2E85A 1WE2A 1W2HA 3RUAA 4Q1AA 3NHLA 1GQYA 1JS1X 4X8OA 4AL4A 2WG2A 1ODLA 1JEDA 1YDEA 2QTVA 1OTXA 2FG5A 1L5OA 2A92A 1H3NA 5CLIA 3IAM6 3QYJA 3AVYA 4HK4A 3RU3A 2XA1A 3WK5A 1WD7A 2XMDA 3DC7A 4Q48A 3IERA 4ZOLF 5FEMA 1UODA 2HH9A 2PQ0A 4CU5A 1QHXA 1CB7A 1R6XA 4K5QA 3DS8A 1R66A 1HKHA 3CX6A 2I3AA 1Q21A 3JWPA 4KQIA 4OMUA 4BFVA 2BLNA 3DTNA 3SEQA 4RK1A 1DIGA 1E64A 2ZJOA 2JFXA 4MXDA 1Q22A 1U2GC 4IF6A 4ZO4A 1Q7EA 1R0BA 1W4LA 2ZJBA 4NCIA 3V7NA 1H2AS 4HDAA 3QVTA 3WBFA 3TSOA 3TZ6A 4JUBA 1WZCA 1RZVA 4UPDA 3ZE6A 2GBIA 1U04A 2XHEA 5HIKA 3VZRA 4X00A 5DHRA 4JJ7A 1QF7A 2CUKA 1JGTA 3LBYA 3RVRA 3V32A 2I6SA 3EXEB 5BT8A 2LW7A 3DZIA 3VGPA 1SAYA 1Q0QA 3SJCA 1ZBQA 3NHFA 3DGFC 3UIEA 4COKA 1VRWA 1I9GA 2FLWA 2Y0PA 4HDSB 5J9FA 3S40A 4DLLA 5GZ3A 3BDAA 1PFYA 1E61A 1WMAA 2FFJA 3I4FA 1GNTA 3MOSA 4BLQA 1SXJE 1RHKA 1Z4NA 3MRVA 4HYEA 4F3CA 2ZI6A 4EZIA 1EZ1A 2YN0A 5AJTA 4AURA 3A6KA 1NT2A 1NFQA 3N2GA 4WXRA 4D1YA 5C5IA 3EULA 5DXAA 3X43A 3FUUA 3JQBA 3QELA 4OHFA 4PPYA 5EY5B 5JS2A 1H1TA 1BMQA 2FHPA 2R6AA 3D0OA 4BB6A 5CFQA 1ZPDA 5EIBC 3LWDA 4X1YA 2GCEA 2KS6A 1BKDR 4HTAA 4Q93A 1JE0A 4FB5A 5BN5A 2DPMA 1A8PA 5C8YB 4IIJA 4II2A 1LPAB 1LQ2A 2O8EA 4NPAA 4XR4A 4U7HA 4RENA 3AIOA 2BGLA 1W6RA 2F59A 3TLAA 1EGHA 2C2MA 3BFKA 4F56A 2GXUA 2YOHA 1U4SA 3H5NA 5BVGA 3HYSA 3ROMA 3CX7A 3F9IA 1IATA 4GO1A 5FNZA 5TDHA 2VTBB 5BOSA 4RE5A 2WWHA 3BH0A 1V5WA 1ETHA 2AR7A 4EA6A 4YIKA 5DHUA 1CEXA 3RDPA 1FTNA 4BATA 1RC8A 3AEKB 5A71A 5HA5A 4C2AA 3IGFA 3U6KA 2QI9C 4G4JA 1Q11A 3IIJA 3S7ZA 3IMCA 4R0VA 5A9SB 3R7WB 1L2TA 3IAM1 4YR7A 2X7XA 5CA0A 2WUDA 4Y2SA 1A2BA 2DKFA 1LJLA 1VE9A 5E0KB 4ES6A 1OZGA 1WPXA 2O8CA 4ABTA 2NMVA 2C7PA 4PX5A 4WGFA 1UAYA 3IESA 1YKGA 3DBRA 1QS0B 1NXOA 1AKTA 1FMJA 1G7TA 1QOQB 4HEA6 2XLBA 4NJEB 4BFLA 4UDXX 5BUCA 2Z1NA 2EDAA 3C8HA 1VMAA 2L82A 2GD1O 4X85A 4Z4HA 2JH3A 1QC5B 4PX2A 4R41A 3IKLA 2XR1A 3MGKA 4LZLA 4RK6A 4UQPA 1WWKA 1KBZA 1GKLA 4JBHA 5LXTA 3JAMA 2C7QA 4QOFA 4JVLA 1UPXA 4LC9A 3KLNA 2VEOA 3F6RA 4BNDA 3ZOZA 1AKQA 5DM0A 3FPBA 1FJGB 4PZ0A 3L4EA 1XK6A 2C5SA 2ZT8A 4LVNA 4NE2A 4QREA 3VV3A 4BZWA 1WZ2A 4QVKA 1GAQA 2WFLB 3EDRA 5DYNA 1UJMA 3VR6H 4H4DA 2C29D 1RSZA 4E5YA 4EPTA 1CLEA 2PGOA 2DUUA 4HTFA 1TZBA 2RG7A 2BZSA 1ZN8A 3G23A 2AMJA 3VFDA 4K9PA 3G9TA 1ZCFA 3HR4A 1TZKA 4G0QA 1BVRA 4RSRA 4DUGD 4CLRA 5LQCA 3WGZA 1R0ZA 4RHYA 3C70A 6AT1A 4OHXA 4AJIA 3NS7A 2HJWA 1NOIA 2I6XA 3W8RA 3ZJYA 3DP9A 4D8UA 3A06A 2NZWA 4IDBA 3VH3A 4FWIB 1T9GS 4G2NA 3OF2A 4UVHA 1Z07A 5LN1A 2O2DA 3H04A 2ORIA 3R5JA 1ZN2A 1LPBB 2MSWA 4TTSA 3HZHA 3U5TA 1HH4A 4QNNA 3IEXA 4H3SA 2B0CA 2QN1A 4UTXA 1KH1A 2KLBA 5FNVB 3WOVA 2YVQA 4FOSA 4C3VA 2IDKA 1EXWA 1RVV1 5ICEA 3HU1A 2WD7B 3IQWA 5LP1A 2JA1A 3UXYA 4B09A 1RRFA 3VKVA 1IWPB 5KWVA 3OCUA 2WC1A 3UUWA 3ZWQA 3S1SA 2KB0A 1N8SA 4EPYA 2E4WA 3JWEA 5K4AA 4YP7A 2PVPA 5AVWA 5I4CA 3DYIA 3EGXB 5DPMA 1QB8A 4M9UA 1L6RA 1ZL2A 1F2TB 2QMEA 1YOBA 3WIDA 4GKJB 1RAIA 3DLPX 3TBHA 1PYOA 2OM2A 3T5GA 1W75A 1YMUA 4TSFA 3ZQUA 4G8JA 1ZK4A 1B41A 3LYAA 2G63A 3ZXIA 1SVWA 3BILA 2WTAA 4DCSA 1OFTA 3UXHA 3W05A 2YIVX 4RMHA 4X84A 2V96A 1VCHA 4MPJA 2VJPA 4EUEA 1EUQA 2X8AA 3CXRA 4AO7A 1IVYA 1Y8RB 3OMXA 4L9RA 1DEOA 3QVSA 4OVKA 3VRHA 3TTSA 3ZTWA 2IIVA 3U40A 1SH7A 4N47A 3VR5H 1N3LA 5B57C 4HGOA 4B3TB 4XX0B 1O0CA 4ZRDA 5CLLA 5JROA 2RHMA 3NBFA 4ERNA 1IY9A 1SIUA 3T4UA 13PKA 4PHTA 2UYGA 1Z4IA 3G0OA 4JR2A 3PRYA 4N5HX 4S1NA 3ZDFA 4E0BA 1UJNA 3CMMA 2VP3A 1VRCA 1E1MA 3ND6A 1CERA 4R8LA 4DC1A 4EL5A 1WVIA 3OLCX 3LX5A 5LNK6 3WL6A 1IAVA 2UZIR 1QQTA 2AOWA 2V45A 2WZCA 4QOHA 5ULLA 1DZ3A 4WEQA 1Y6FA 2DERA 4OM8A 3R5HA 3OJLA 3B53X 3EQ9A 3TRKA 4WBNF 1E1NA 3V4OA 3M1AA 4BZZA 1B0AA 4QWWA 4C87A 1H85A 2AKAB 2CMDA 1YRLA 2QE7D 1L9XA 1Y8QA 1RQRA 2DTEA 2R751 4HXEB 4GM4A 2IUTA 3ZWDA 1ZKMA 2Y1GA 4DS3A 4KFSA 3G68A 3S1LA 4I9NA 3I73A 2RAVA 1PW5A 3FCCA 3R20A 3ZLTA 2MSCB 1I4LD 2RONA 3CLTC 5CNKA 5LP6B 3FLMA 4BKPA 2B5VA 5G4KB 3RVNA 1NXQA 4B34A 2DFTA 3I6YA 1AF4A 1MC1A 1IHUA 3PA8A 2R79A 1JQJC 2BDEA 3TB4A 3QHAA 3LF1A 4DV2B 2FPPA 4MUXA 1HQYE 1E5TA 2ECKA 2G0TA 4LZPA 3M9XA 5EPOA 1NVWQ 4QXOA 3SOPA 3WBJA 3ZN2A 3COPA 3U19A 4LFAB 4QZVA 4X7RA 5JHGB 4Y1RB 3TNYA 2EOAA 1ORRA 1KKUA 1JB1A 3LY7A 1H8EA 1JEQB 2YZKA 1GCUA 3R3YA 5I6DA 1OE0A 1YR7A 4UTPA 2H0QA 4ZO7A 4K9OA 1QLWA 2HU2A 2WF6A 5A3JA 2BC9A 1V6SA 3G82C 2GPSA 4LWQA 4UARA 4H3KB 1SOUA 1XNGA 2XT0A 3I5YA 1UR5A 4JLBA 5I7FA 4U3JA 3DW3X 1GL3A 3GGJA 1VBNA 1JQBA 3O91A 3DE3X 1E5VA 3KUXA 4L51A 1BYIA 1JBEA 3G9ZA 1E6WA 3MELA 4PICA 5EWMA 1AGNA 3KJQA 2J9GA 1SD5A 3GPCA 2SKEA 3WMRA 4UTRA 1SVMA 3N7TA 3ZUGA 3NXSA 4ONEA 4HVLA 5A4AA 2OBBA 1PR1A 1P7CA 4QG7A 4PIVA 4PS1A 5KWSA 3VR2D 1HYQA 4LXXA 2Q8NA 3UWPA 1E2FA 3UEOA 2DTXA 1F20A 1YR8A 3A1VA 3PBKA 4P93A 4ROSA 1YB5A 4NQZA 1EX1A 2QUAA 4R0MA 4HV4A 1J7JA 5CK5A 5LNK1 5AJVB 5E3IA 1PSZA 4TKMA 2REQB 1L1FA 4OJYA 2XUQA 4UC0A 2PUFA 5K0JA 3Q88A 4HLDA 4R8KA 2OVFA 2J5QA 3B20A 3HVUA 1MB0A 2YXNA 4OU5A 4B3SB 1KAHA 4CU2A 1WRBA 2CK3D 2IYSA 2EZ8A 3GQBA 4FDLA 4G5GA 1L1EA 4P3XA 5DX1A 3T5PA 3LYLA 2V7XA 2OE2A 4YDQA 2YZ2A 1P9WA 3S4YA 3OPQA 5LCXA 4MKGA 1T3GA 3VSDA 2G7MC 4MV8A 5A9TA 1BGWA 2WQZA 2HI0A 3OZSA 4IUCS 3VJMA 4X65B 4YJ3F 3LIIA 1DAPA 1V0JA 2ODEA 2QVZX 5EJIA 4IFBA 1OYOA 3ZZ1A 4FGJA 4C05A 5JMWA 1AGYA 4DG8A 2JD2A 4KAJA 4RPGA 4DJEC 2QKYA 3LQ2A 1EGMB 1JR6A 1QIDA 1YONA 4M88A 1AZLA 1C8LA 1R3DA 3AEUB 2C2XA 4FZJA 4G1BA 2OG2A 4HQFA 1V11A 2AOUA 2RHOA 1RXYA 4F72A 1H2HA 2HMYB 2G0NA 3ICCA 4MQMA 4PAOA 1IVNA 2D2VA 4IH9A 5TMEA 1N75A 1E77A 4C07A 3ZCSA 1QCDA 1PI3A 4HNTA 3U1BA 4R2XA 3WFZA 2CBZA 1GR0A 1WDLA 3G1UA 1X9HA 5M5BA 1RYEA 2J7KA 4ALNA 3EEOA 2O8DB 3ASZA 1TLTA 1MABB 3Q3IA 1K5DA 4C7MA 3DDWA 5KS2A 3KQLA 3O83A 3TLKA 4TM7A 2Q3LA 2ZJ4A 3UJ3X 4NYIR 4MUBA 3D0QA 2WB4A 4IJQA 2Q5IA 2LRHA 2Q7XA 2AB0A 2R1VB 3CKKA 2DWQA 3QXXA 4INZA 3VPGA 1CV2A 1I3MA 4P33A 4US1R 4KLAA 1LFDB 1Z35A 2DFLA 1A4UA 5CLGA 3B8EA 1PL6A 5JVDA 1JMYA 2DWOA 4QULA 3TG8A 3W8NA 3QEMB 3R6GA 4D4JA 2GKSA 4PVDA 3Q9LA 1V7ZA 3DZCA 1TM4E 4RQTA 1V1JA 4MV0A 1FS6A 4CG2A 3SBOA 2EVWX 3L7CA 4ZVKA 1XLWA 2QMZA 3IO3A 1XTRA 3GNLA 3U7FB 2VT7A 3CMCO 3P94A 1B8PA 4RMGA 5JS6A 4PCVA 3IVCA 4QBKA 1HQCA 4J3FA 1MV8A 4KBFA 5BNFA 4PSDA 3RTEA 1RPNA 3ZIUA 1K7SN 1ST2A 5KJEA 4ITVA 3SC3A 3CURA 5ALEA 2FHSA 2ZJ2A 4E12A 2I4NA 2WZQA 3KBOA 1M6WA 3NCTA 1X1QA 1VIMA 1EHIA 1KEWA 2BBWA 5F76A 3V33A 1VBFA 5KVSA 1MAVA 1YJBA 5ITZA 5JDCA 1SJ9A 1JXOA 1PZEA 5CGZA 4XYBA 1ZVJA 2P9GA 5JDIC 3CVVA 3HLTA 3B6KA 2CZQA 4MKZA 1DTWA 1W88A 4QTUB 1NVMB 2PZFA 1ZNWA 4I1IA 4W9NC 3BYZA 2BFFA 1FFSA 4KH0A 4EUNA 1M6HA 4FFRA 4KJZA 4DIOA 2HQ1A 4HHEA 4DT1B 5BUZA 3D4OA 1NVKA 1NY6A 3AGQA 3BC1A 2Z43A 3KB8A 4LRYA 4QLAA 5FJIA 4C0LA 1ADFA 4G0PA 4JBYA 4E2YA 2QAGC 4LV6A 4IJ6A 1L7OA 1VL6A 5KOYA 4IKPA 4RX1A 1X8JA 1XF1A 5JCJD 1DBIA 4MYDA 4MGIR 5AXAA 2L0XA 1UBGA 1SKAA 2IUSA 5KTKA 2G1PA 1PK7A 1TQ8A 1WCWA 4G4IA 3ZCXA 2YHSA 1ISJA 2ZVDA 4UU1A 2PKWA 1TPZA 2ZB2A 3LC2O 2IP4A 4GMGA 4UEWA 1U1CA 5H83A 3UAZA 5C35A 3EZYA 4KAXA 2P3LA 4G1UC 2DEUA 3ZHSA 2VAXA 3ENKA 1SBTA 4PGHA 1GPAA 4RHXA 3DDCA 1F38A 2MMCA 5E1MA 1X1RA 1KIFA 1K7FB 2H1VA 1IY2A 1GZDA 2QF7A 4ODIA 5COAA 5AKXA 2JGLA 1KDRA 1WUHS 4P2GA 4O1MA 2JZOA 2NYVA 1E6CA 1KAEA 1XVIA 2HTFA 5ADHA 3TTYA 1BMFD 1L4MA 3W78A 4CEHB 1GGHA 2AEEA 2OYRA 4OYLA 4NAUA 4MRAA 2YN2A 3TLJA 1FQWA 4FBGA 2J85A 1T10A 1A9XA 2L18A 1II9A 5FUWA 7YASA 3MS7A 2PY6A 5CITA 1UEJA 4PG8A 1AVTA 4QWMA 2AJCA 1CIJA 3PNKA 3QVJA 1UMCB 4XDGA 1XVTA 1O96A 3RFUA 3C6KA 4JWKA 4Q24A 2I4TA 2B8NA 2MIIA 3DDNA 4BQOA 5EXDA 2VL7A 2ZE5A 1N78A 3B8HA 4AY3A 5HS4A 1QGED 1YB7A 4BEWA 4GXRA 4TUYB 4YO8A 4XLZA 2C61A 1CQWA 1KORA 3ILXA 1S8FA 3BQ9A 2ZJ5A 2CNNA 3MWLA 4CV2A 1RHJA 5CYGA 3WB9A 5IZ4A 4W82A 2Q49A 3DLBA 5B2EA 3AETA 3IDSA 2OKCA 2BGMA 2JEYA 1EQAA 6YASA 1FSFA 2AXNA 4LDQA 4RL6A 3JR3A 3T5CA 3L6CA 1L8XA 1N1MA 1T0UA 2OFOA 1ZH6A 2JLBA 2X6RA 1S9HA 1Z4KA 3ESXA 4MVJF 3PP8A 5FBQB 4BMSA 4DXAA 5DXFA 5B30A 1V43A 4W1QA 1G59A 4J2HA 5B6IA 2K5UA 2RHHA 4JROA 1NI5A 5I3CA 1Z4QA 1ZI8A 4XQCA 3CO5A 1FRFS 2LBPA 3UZUA 1GA4A 3QGMA 3QKSA 1Y6GA 2Q4DA 1G3UA 2Q0XA 2QNIA 4WK6A 3RF7A 4H7DA 3RLFA 3P0JA 4DA7A 1WMEA 4Y9TA 1QB7A 4YGYA 2ZAGA 5AXCA 2WAAA 4DLKA 1KEEA 2KI5A 5EJAA 5AKYA 2B4YA 2CT8A 4L0QA 5AM2A 1YR3A 1JXQA 2IQIA 2FV8A 1OHHD 4FLEA 2CGEA 4RU1A 1OYYA 1W9HA 4UBNA 4EG3A 1NP3A 1Y9AA 4K1LA 2NAPA 3C1AA 4CIWA 3RS5A 4OSEA 2RHJA 2PIAA 3KT8A 4UTZA 3TPFA 3H3XA 5ESDA 1Z25A 3D4NA 2G0AA 2PX3A 1SG0A 2XNKA 3OHPA 4U5QA 3VI4B 5L40A 1KRWA 4QGHA 3P4YA 4BC1A 4V3CA 4WBXC 4FOPA 1GQQA 4I1VA 2OGWA 2PT9A 2AFIA 2PO5A 2YBDA 2YJNA 4MQ4A 4OA5A 4YRLA 5EQJB 1X15A 4DMFA 3ZWVA 3EODA 3H2KA 5LBIA 2QXUA 1GL9B 3UMVA 1J0XO 1NNUA 2I34A 2VYND 4YREA 2NG1A 1KGSA 3ILVA 4UPEA 3VZQA 3H18A 4ZO9A 1GY8A 2ZB3A 1GOTA 4Y9SA 1X3SA 4L6AA 3H17A 1PX0A 3C24A 1VOTA 1Z17A 3BCRA 2YN4A 3EIOA 3JZAA 3OO1A 1Q1AA 4EHAA 5C1DA 4L4XA 3PDCA 2YWJA 2RH5A 3BTSA 3SXUB 1Y9DA 2Z58A 3JYNA 3LDGA 1XTSA 2C7OA 3I9MA 3CF2A 4P54A 1IM8A 3LA6A 1AKRA 1FLNA 1K89A 3OAAA 2OCKA 3U1TA 1S1CA 4NXMB 1M0EA 3TGWA 2NSYA 4FMCF 2I7VA 1U0BB 3MBIA 3Q7SA 3GEHA 2G40A 3JD2A 1OFHA 2X6QA 1GFSA 3RHFA 4XJSA 4UNRA 4M54A 3B36A 2XB8A 2GBCA 3P0EA 4XD2A 3TIXB 2IU0A 5FPSA 2FUG1 3SJAA 1EVLA 2ZPAA 3OQIA 4OCZA 3V2UA 1G8GA 4RE6A 4R51A 4EG7A 1XQ9A 4MVJH 5IWAB 1AQNA 3U7IA 3SC6A 1E1QD 3TW8A 3OFSA 4EW2A 1U94A 3SGLA 3EG9A 3RS0A 1IDOA 3EQ8A 1HY3A 2WF8A 4QJBA 3TTVA 4MRPA 5D84A 4BN4A 2V55B 5BMVB 3FJ1A 5M3BA 1E92A 3BA6A 1XCMA 1Q77A 3FCEA 4BIIA 1OT3A 2Y4NA 1G0OA 2D1TA 2ZS7A 1NFFA 2W4IA 2W6JA 1PEYA 2C5BA 3A9CA 3AY7A 5GONB 3RTGA 4ESOA 1M7BA 4P31A 1WHSB 2J0VA 3T99A 4GDMA 1V47A 1ESMA 2Q27A 2WTXA 4B2IA 4CUZA 3L05A 4CT5A 1VXRA 4MO2A 4E30A 2PLRA 2PRZA 4D4IA 3JX9A 5I8PA 1Q16A 3D6VA 4Q34A 3H2JA 2O8FA 1E63A 3WK8A 1PVOA 5TQ2A 4QPPA 4MVJP 5JAPA 1AK9A 3ACBA 4B6GA 2QZSA 4CRWB 3T95A 3H5TA 3PWKA 1HE4A 3QPAA 1AH2A 2EFGA 1Y3BE 2DLDA 5EN4A 2YW9A 1N5IA 1WMFA 1CUDA 4HLUA 4C0HA 1R1DA 2FZVA 1YK0A 1U8AA 3ENQA 3WLQA 3JYLA 2Z5LA 3FGNA 3SLKA 2Q1SA 1GT91 5IWCA 5DNYB 1JHXA 3DZKA 3SIPA 3UB3A 1CXZA 3GGCA 1C7IA 4N5LA 3CPSA 2Q3CA 2C4MA 3DQQA 1EK2A 1WOYA 3KK0A 5FWXB 3V8MA 2VJMA 4XX1A 4TLLB 3LUDA 1GM5A 3N6RA 2VRBA 2YFQA 1MV5A 3KB2A 5KTTA 2UAGA 4RZHA 1I51A 1RBYA 2H2WA 1QP7A 3H5VA 3KKNA 3BK1A 1L5YA 4LECA 4ADSG 4NMWA 3JZDA 4Y0VA 3DZDA 2ANBA 4F2HA 1F4PA 1T2VA 1O6CA 2D7CA 3MUOA 3TOCA 4BX3A 2Z5FA 3Q6IA 4CCYB 5AD1A 2RMKA 1NUPA 1CP3A 2GEDA 1EBFA 3NOVA 4QJ5A 5JAHA 3MCAA 1W85B 1LVHA 1SVLA 4N5IX 1UKAA 3KVRA 5JJBA 1SXJB 2IBMA 3RTCA 1DJMA 1OH8A 4YMUA 1T26A 2XV1A 2G1JA 1LSOA 1UIRA 5DNDA 4QE3A 2X2OA 4D46A 1AQIA 2QM8A 4P4TA 4RF2A 2C3OA 5EJFA 1YRYE 3OZDA 4YYEA 2D1YA 2HK7A 4O4IF 1A50B 1RE0A 1GCAA 2K4MA 2R7KA 4R83A 3HHEA 1IZ7A 1QYVA 5KDLA 2E82A 4LQCA 3OJEA 3T0IA 3PDJA 3T94A 3EJWA 5EJMA 4EB8A 1T5OA 3ZHRA 4IJ5A 2GA8A 1D09A 5HJ7A 3GEIA 3JQAD 4RVCA 1CW2B 1RM3A 5CEEA 2PMWB 3BGWA 1CUJA 1U8XX 2ZR8A 3CN7A 5DHTA 5JAZA 1C0IA 4M7RA 4BV2A 4BVGA 4RS4A 1XU4A 3OIWA 5BQPA 1ZGBA 3TL6A 4BNTA 3JY6A 1EBUA 5BNIA 2PSEA 3C8DA 1B8VA 2JVIA 4XPZA 4EYSA 3GBSA 4JP5A 1VCMA 3ESBA 3E0QA 3GLFA 2NZ2A 4DE5A 1KPHA 1WETA 2OPBA 1LKZA 3PHBE 1DX9A 3R6WA 2ZG6A 4BQSA 2I71A 4P58A 1AS2A 1Q15A 4YCNA 5KYUB 2GCIA 2XB6A 1OFUA 3DEJA 2HHCA 3FH0A 3JQ8A 4CM8B 1TK2A 5FO0A 2GM9A 4RHEA 1T0PA 3CA8A 3GLUA 3QMMA 4ZD6A 3K0EA 1L7RA 1RKVA 1BCSA 5D5PA 1NJSA 3V34A 2EP7A 3GDFA 4BQEA 2O4UX 3RT9A 3PGJA 4OREX 4P0PB 2ATIA 2YR0A 1VGQA 3IV9A 3ZCPA 3HWWA 3M6VA 3EASA 4YJHA 5A5EA 4G1FA 1A97A 4AP6A 5L3VA 2OCYC 1THGA 1U2GA 4ZYYA 3U4AA 1Z5ZA 3EZ7A 4M38A 3CE9A 4M46A 4NH4A 3PQ8A 5DM1A 2CFRA 3U4CA 4EGJA 3GL9A 3HLKA 1II8B 3P20A 3U44A 1D6NA 2CVFA 2BFPA 4GICA 1SKQA 2GHIA 4NTZA 3DV2A 5L45A 4WDQA 1JTVA 3DFZA 4NCKA 5DXJA 1TZ2A 1QBGA 1I8TA 4N41A 4F8YA 1T5IA 4J0KA 3F1LA 4JHXA 5C1IA 3Q0EA 4B6FA 1D4AA 4AX4A 5K4HA 1UJ5A 3DMPA 2E87A 3K2QA 3UVEA 4CIDA 5AR1A 5HKKA 3JASB 1NW8A 1UKZA 3UO8B 3N39C 4MQFA 3ABIA 2ZBGA 4C5AA 2VT2A 4O08A 4ZHQA 4C3ZA 4JB0A 5TQJA 4AMVA 2EL7A 4KZPA 3JAKB 1EPUA 1YUMA 2Y6VA 3RVQA 2C98A 4J03A 1QHIA 3EDOA 3ONNA 3K1TA 4N12A 2X86A 2PSDA 5GPBA 5MN6A 2I8LA 4I3GA 3B70A 1N77A 4MWBA 1DWPA 1VP9A 2XH8A 1LNQA 2HF7A 4WCFB 4X8LA 1AKYA 1FF9A 5E95A 1N3BA 3ADCA 2ORVA 2XB4A 1FVOA 1KDTA 4KC0A 4BNNA 3BIJA 3M4YA 1P4JA 1VJ5A 5AKIA 3U7JA 2YDYA 2C0QA 2FPRA 2Q2QA 3L0OA 1BA2A 3Q3HA 3WYGA 5KOHA 3HPRA 1FZTA 2ZT5A 4P4SA 3M34A 5CH8A 5DT2A 4ZJYA 5CFOA 1USWA 3AVUA 3FRJA 1KBQA 3SX0A 3W4KA 2LKCA 2PUTA 4YJFA 1KE1A 4H1UA 1VECA 2GUGA 2VK1A 4I55B 3WYFA 2R2GA 1I6MA 4RADA 3E48A 2AJDA 5IM4F 2QL6A 2CNWD 1X87A 2C7VA 5TPWB 1BQ4A 1GIAA 2BFDA 3TINA 1KFEB 1QX3A 4Q3NA 4W7HA 3O74A 3QEJA 5ALOA 3EFBA 4MJXA 5TMPA 3MINA 4YCJA 2IVFA 1TO2E 1RTKA 3LUJA 2VTVA 1SB9A 3EW7A 1PG0A 4PXSA 1RWPA 4GKBA 4ZZIA 4J07A 3RIYA 2HDOA 2XYHA 2GPNA 3GVPA 5BSUA 5JFOA 4OYYA 1UM9A 2IBTA 2C7RA 1YI1A 2YV2A 3DUFB 1DJNA 2AZ4A 2IE0A 2VUHB 3PX7A 4QTTB 7MDHA 1PR6A 3INRA 1ZX1A 1H1DA 1RIIA 4HVTA 4AZ0B 4WK2B 5B7PA 1L6IA 3L7OA 1TJNA 3JYHA 1N7JA 3K0BA 4LHXA 5CIYA 3E1KA 3H6HA 4LYFA 1VIVA 4BHTA 1CWUA 1MEEA 3UYLA 1PJLA 1TIBA 2F7SA 2ZE6A 1AC5A 2BDUA 2WSSD 3HDGA 3VJKA 2Z6VA 3HE3A 1TYCA 4CKCA 2G9UA 3DEFA 1SHTX 3HRIA 3TLGB 3VDXA 4DDUA 3M9WA 4PFQA 3EB9A 2HA0A 4LOIA 1JWLA 1TAGA 3NKFA 2ICAA 3T7DA 2H11A 4FZ5A 4BKQA 4FIZA 5A4KA 3TLCA 1JL3A 5F2EA 1HRDA 3MOGA 1GDHA 3RT1A 4F4HA 1W581 4Q4HA 3T7RA 1W19A 4F93B 3DKKA 5KSPA 5EHQA 1YTLA 4ACAA 3CQ9A 4HDRB 3NYQA 4JX8A 5CVVA 4M0PA 3NANA 1EK0A 3ADBA 5CTJA 2QT0A 3CISA 1P1KA 4OIFA 3TLXA 1EQUA 3VO9A 3CF4G 3ZIDA 1OPXA 1H6BA 2HC9A 2EJUA 2BR5A 1NAHA 1RYNA 2O2ZA 1WUJS 1N0IA 1XQVA 4GBED 1I6LA 2QD5A 5EE0A 2I6QA 3V97A 4Z6KA 4KSCA 3GPIA 5EIXA 3NT4A 4TS3A 1JH9A 4O4HA 2DMRA 1NJ5A 2O0HA 2OSVA 4OX9B 4JBIA 1FYXA 1GA6A 1FP6A 2UV8A 3KQOA 4B35A 4BFYA 3VNBA 2P5TB 5TQ0B 1JJVA 2Q4RA 3VSBA 1CFZA 3UGQA 2CEAA 4ZOBA 1QFZA 3MA0A 4QHSA 3AB8A 1G66A 2UZ1B 5DK6A 3K96A 4FD3A 1SK9A 3NC4A 1K7EB 3OZBA 1RAEA 3AUTA 2IHTA 4CIBA 1L7EA 4M37A 3MB5A 3FWNA 1SCUB 4D9KA 1G63A 1FVFA 3G5LA 1IY1A 1F06A 2AKYA 2O2GA 3BKXA 4RY2A 5AHKA 5L3RA 3RS3A 2XTMA 4S2UA 4JCOA 4OFXA 3TKLA 2PWPA 1Q95A 4KPGA 5KHAA 3B2NA 1Z4OA 4JBGA 1E9AA 3D9QX 3RBAA 1XMJA 4PWYA 4YT4A 4J1NA 4KQ2A 3FYSA 1DHTA 1G98A 1QDEA 3JQ7A 1DCKA 3NETA 3T7KA 1DE0A 4ARAA 2ODQA 4YASA 4M7PA 4TMFA 1DAHA 1E5LA 3BDIA 5BSTA 1E2PA 1OFVA 1RRCA 1KEZA 1LNSA 1B16A 1I30A 2HCFA 4FONA 4HPWA 4YAFA 5JTUA 3VKWA 4ETMA 5I7SA 1T4BA 1BEZA 3T52A 5I3ZA 3LOUA 4GOLD 4RZSA 2YWBA 1IQRA 2E55A 5I8WA 4BXOB 4MV7A 1PV4A 4G0WA 4IDFA 3ZUPA 4OTZA 3AR7A 3GP3A 2WSYB 2IYUA 2ZYUX 3N2EA 4OXQA 1QRUA 4GU5A 3LQYA 1Q92A 3Q3JB 1H2WA 2NQ2C 4TQUS 1NW7A 4XPIB 1Y1SA 4JSRA 1U3GA 1P0IA 4RK0A 4M6WB 3BJZA 1BU8A 1W2GA 2BGGA 4WLUA 4JLUA 1K06A 1E4YA 3TQFA 2HRRA 4TKUB 2I3DA 2EGGA 4C0JA 1FFEA 3FPKA 1UBFA 3PXGA 3E0XA 1I94B 2Q6OA 4G25A 5I7UA 4DTCA 3P45A 1FRVA 4JJ8A 3O9ZA 1I80A 4RTRA 3IUEA 3NTXA 4TV8A 5AKHA 5LA6A 1P77A 5BV7A 3WAGA 3WIUA 6ABPA 3FSGD 4L27A 1DBPA 2DUNA 1SUSA 2FDRA 4MW5A 4C2BA 4MARA 1WF6A 2XDQA 2ZCVA 3EZ9A 4WFJA 1X39A 1K8RA 1NXTA 1WXWA 2CBXA 3KPVA 1KSJA 4LXUA 4X7BA 4IW3B 1BX1A 4CKWB 1QE5A 2E0IA 3SZ3A 5DX8A 3V1LA 3WZLA 2ACWA 3RVPA 1RI3A 3Q11A 2IL1A 3KSBC 1DIOB 3QITA 1B43A 4OL9A 3L0CA 1L4HA 3G5TA 4L22A 5EWJB 1HT1E 5CEFA 3NDJA 3SJ7A 3CINA 1VB5A 3ACDA 3ZWAA 2NNLD 5BSMA 1POXA 1C2TA 1K6XA 1BD3A 3QLJA 4Y6RA 1U7XA 3K30A 3V6MA 1YDMA 1SQGA 4CL8A 1XKXA 1JKMA 2ZBUA 4C7OA 3O8CA 4EZBA 4KR9A 1OKKA 2RCNA 5KTPA 2XGJA 1YAHA 1SVSA 5CVDA 3EUEA 4LV5B 4R6XA 4RFSA 1P17A 5K3EA 1O94D 1U2RA 3GX1A 3UHFA 4YROA 2XUOA 4PO3X 4J1SA 3VR6A 2I7XA 4LYAA 5DCYA 4L28A 2EW8A 3SHVA 4ZI7B 2I55A 9ABPA 4N7MA 3AJAA 2I0FA 2R00C 3DAGA 4LC0A 2E3JA 1U7HA 1OGYA 2P9FA 4MDHA 3QFFA 1K2VN 5HIAA 4O02B 4CL3A 1YGPA 3AXTA 3R7AA 1YRBA 2JGNA 1ODTC 1JU3A 2C31A 3EA0A 4KHPB 3LKZA 3WK6A 3GFFA 2PJRA 1XX6A 2X9NA 4GWGA 4JR0A 5DYGA 4ATNA 4EI7A 5FEUA 5A1TA 4EFKA 1X0VA 1D9ZA 2CHVA 1FDRA 3K92A 5DW0A 5CNIA 2V9CA 2OMKA 3H9UA 4Q4DA 4Z0TA 4GQIA 4MX8A 1J97A 1KYQA 2C5GA 3HR8A 1QRRA 1G3MA 1OWOA 3CZ4A 3GMTA 3Q7QA 3FDJA 4OQ4A 4PLCA 4XUCA 3W90A 4DIBA 1YA6A 1WSAA 3G2QA 2QZ4A 3KUDA 2Q3FA 1J5EB 1S4MA 1MA3A 4LZJA 3UFBA 1AZSC 3W3AD 4R1MA 4TMYA 5FOXA 5FLXA 4BUZA 3NHSA 4DLYA 3DTVB 2CE7A 4PQFA 3VPFA 3NHUA 1JP7A 3J81k 4OAPA 4TL9A 1I7DA 1Z4MA 2XE7A 1XNRB 5DBOA 4FFWA 2Q3JA 1PE0A 1T24A 5A3QA 4KVZA 1E0DA 1PTKA 4JB3A 3GIWA 3L8ZA 4KN9S 4GRAA 4F5ZA 1HEIA 5ER9A 3QUCA 1TTQB 4FNOA 4P3KA 1PFVA 4ZVLA 4LXTA 3EBPA 3OEEA 2X2PA 4KEAA 3HUEA 4DABA 3EFOA 1LEHA 1CUFA 1F60A 3P9XA 5CTAA 5HFJA 3TSCA 2NXJA 1C7JA 3OZFA 2ZSFA 2QSUA 5FRDA 3WISA 1OU0A 1OREA 5CXSA 4ZCQA 1C1XB 4J75A 5CBPB 3ZY6A 3LRXA 1FCJA 3WICA 3VSCA 1R50A 3IE2A 3CVYA 4FYXA 1HNWB 2QORA 1G4UR 1M2KA 1VE1A 1XZKA 3AINA 3GJ6A 3H8VA 4Q1CA 2CJFA 1CJMA 1D0IA 1OFIA 4Z8YA 4CTKA 3ORRA 1MW9X 2QLMA 4HZIA 2XVYA 3IEPA 2BFBB 3RSCA 3GPLA 3A2MA 3D81A 1CQXA 4X61A 2QTFA 4X20A 4X63A 1XKQA 1QGUA 4JQSA 1BGXT 4R5HA 1M54A 4MJ7A 3TDKA 3FY4A 3IILA 4D8VA 1WV0A 1USIA 1NXVA 3A0UA 5DW3A 2OXIA 5KAPA 1I3OA 1LPPA 2ZRNA 1WSDA 1G2PA 3KTOA 3MWEA 4GI5A 1DIHA 2VH1A 4KBYA 4J7UA 3F4BA 4FGKA 2N42A 3UFXA 1FIUA 2VWGA 4LWZA 4EECA 2X5NA 1VSTA 4WXHA 5JPDA 3B85A 4RJ2A 2QP4A 3JARA 5JDIA 1N5RA 5I7AA 1N9GB 5HTKA 4W9NA 5J2TB 5ALRA 1RYZA 2X42A 4UNQA 5P8WA 4F4DA 2J32A 3NBYC 5L4LA 4H3HB 4U7WA 4TQAA 4U9IS 3LS2A 3CIFA 4RK4A 4HAVA 2IC5A 3OIVA 1NSTA 2YYAA 2FQWA 1C9NA 2QAGA 3MCUA 4OM7A 1QCZA 2FW0A 2PKQP 1Y63A 2V6IA 3PQ5A 4GLOA 4JYPA 5FWDA 3GUZA 4O2RA 4E14A 1Z0JA 4XVRA 2WQ7A 5DTMA 1L4YA 3GT7A 5GM2A 2PT5A 1XCGB 4P1ZA 4RZ2A 1Z5GA 2DB3A 1WL8A 4WNAA 5LMUB 1B0UA 3DE5X 2ERXA 2NTNA 4DRXA 2HJ9A 1E1YA 3ASVA 3QIAA 4DKJA 2PMEA 4CEJA 1JDNA 4R1TA 2O19A 1UPUA 1YQTA 3CLSD 1CD5A 2WYVA 3IE0A 4N3BA 3HDJA 2HEGA 5HUHA 1K75A 1LGYA 1RYMA 1B14A 3MK31 3PS9A 4L8VA 4YX9A 2Q9BA 3KSRA 3AUKA 5AW1A 5GIPE 1P7YA 1RP1A 1XMXA 2J5RA 3Q1KA 3R3XA 4PYRA 4BUCA 5JFTA 4BLVA 1SCQA 1ZGGA 2R6JA 4Y0AA 1TCCA 2C94A 3SBDA 3BL8A 3BSWA 5BXYA 5DOZA 3RRZA 4DV3B 2F9FA 5BSWA 3G2KA 1CQJA 4HB0A 4EJSC 1Q0SA 5KX5B 1CC1S 4DJ5X 3OU7A 2ZBRA 1P2FA 1ZICA 4DXDA 2WKRA 1CZNA 2CBGA 1MC8A 4GWLA 4PE5B 1O6ZA 4YDSA 4C4SA 2XHZA 1C80A 2XCLA 3GFBA 4UOQA 4FNGA 4YV7A 2H1FA 3WLOA 4I3FA 3P0RA 3ZV7A 2WA2A 5L51A 2ZR0A 3CEPB 4ZEOA 4D4LA 4AMZA 1ID1A 4DJJA 3JRWA 2VF2A 1B42A 1ZM9A 2R65A 4RGQA 2VDRB 1JALA 3AR4A 5AO9A 1QLHA 2D2EA 1J0CA 3CRNA 3HEMA 3OTQA 4HRAA 1P2UA 1S1MA 2WHXA 1E96A 1KO4A 1U65A 3H1GA 4RETA 3ASYA 5U4QA 4F38A 3DM9B 3RAGA 4GNKA 3G79A 2J08A 3BXXA 4L8WB 2V6BA 2VH5R 2FB9A 2IYWA 5ALGA 1GRNA 1UUFA 4WBNA 5IJ9B 4RJIA 1AXRA 2HU7A 2FEXA 3PDHA 4YT5A 1P3JA 1W6UA 3FKSD 1G55A 3Q8WA 3SY8A 1M5TA 2RHBA 4DDVA 2YFHA 5TMDA 4FEAA 5BQ5A 3RCBA 1KQNA 2QNBA 1JFLA 4LC1A 4LMRA 5DTIA 4AZWA 2GEJA 3ICVA 1OX5A 4JJZA 5KQRA 5CT5A 1J24A 3NPMA 4NRDA 3F7OA 3GJTA 3LBFA 4DPLA 2F3PA 3Q2KA 4S35A 1WY5A 1I2ZA 2AJBA 3HCAA 2F9MA 3G2IA 1M8KA 3GLFE 3IP1A 4UHKA 4G24A 4RMJA 3DKPA 4R1OA 3VAAA 5ARCA 1CZKA 1KI8A 1UMBB 3IJ5A 4NBLA 4PYMA 4UJ5A 5TNXA 3QOYA 1TTHA 4PANA 3LWBA 4Y18A 1JIJA 1JT9A 1XZLA 3ML1A 4IJUA 3ONVA 3EARA 4ESVA 2PQ2A 4IUYA 5ALXA 4ETNA 2BE9A 3ZNNA 1DKMA 5K3FB 4AKIA 2NP6A 2BGUA 3EVTA 4POAA 3ELBA 2BI7A 3IVRA 3TRHA 1ONPA 2BDTA 5IAGA 2G06A 5FDFA 3REOA 1LBEA 1W8DA 2Q3DA 2GUWA 4BZPA 4M8NE 5KI6A 4Y1FA 4WECA 3D3WA 3M6IA 5GADl 1JJ7A 1L3BA 4NNJA 2ONCA 5LJIA 3PEEA 5A0FA 3RJ5A 2J30A 5K3DA 2FP4A 3OM9A 2GTHA 3GDGA 3WMXA 1T5BA 1KHHA 2FR0A 2G9QA 2LNDA 3ESCA 2DRIA 1PG2A 4R6WA 3CEAA 4PYJA 3VNUA 4KUHA 1XL1A 2BKXA 1YI8A 2EFDB 2ZSJA 3DCJA 5L3ZA 4CLRB 4CLXA 1FPQA 5ALJA 3ZGVA 1SRRA 2DKNA 3G5AA 3ZE2B 2HT6A 1GKKA 1QYRA 1Z5UA 3ONDA 4BNGA 3E8XA 1UBEA 1BTOA 5HRCA 1XJWA 3KV3O 3MJFA 5ADVA 3I61A 1Y4AE 2ATCA 4WCDA 5I45A 1WB9A 1TE2A 2BFNA 3F6YA 3N0TA 3U62A 3WZ2A 4TM8A 3D6HA 4BJ1A 3K73O 2OHVA 3DMHA 1NZDA 4GYYA 4PHHA 4LKOA 3FRHA 1JHZA 1P60A 1JLMA 4KZKA 4W5QA 4LYDA 2II6A 3VQTA 4IG9A 5MDHA 2J9ZB 4UAVA 2FMUA 4L72A 1UAAA 5ICGA 1ZIYA 3PGKA 5IKXA 3ISTA 4LJKA 2WT4A 5KYWB 4HRXA 4Q7QA 3D4IA 4YJ3A 1A8HA 1W30A 2XYVA 4NU5A 3LUBA 3ZZUA 2HO5A 2UVPA 4Z86A 3PSAA 1HDEA 1UIMA 1CZLA 4IDNA 1QIKA 4DMCA 3EXFB 1XTIA 3OZEA 3DMTA 5HCNA 1WY7A 4FLFA 3IKMB 1P81A 2EFCB 3ZDRA 4AWXA 1Q7BA 2V0GA 1C1YA 2RAFA 2CVOA 2H57A 2PGJA 5B6PA 1QUFA 2GZ2A 5EKXA 1B6SA 3VHXB 3OCYA 1OLUA 5D51S 2HSJA 1O77A 2Y4OA 3SKVA 1JDUA 3TE6A 4RVUA 4QU8A 2Q6TA 1K5HA 2OB2A 4CG0A 3GDWA 2A5JA 2Z2KA 3BGVA 3AFIA 1GRQA 2I1LA 3BS4A 3GLHE 3P0FA 2DHRA 5ALSA 4ENPA 1HNXB 1I4TD 2A9KA 3EIHA 3NHRA 4X64B 3DVRX 1M8GA 3GRAA 5KTSA 3IRUA 1EFKA 4GEGA 3BERA 4GZ6A 2L69A 2RGAA 4J1TC 2QU8A 4HD8A 5AJZA 4IHQA 1GZ5A 1KMIY 2NSLA 2Z2JA 4JUAA 3VH2A 4QBFA 1CE8B 2BTOA 3NHZA 3LT4A 4CKEA 4AO8A 1P91A 2ZJ8A 2FI1A 3AP2A 5TT0A 3TD6A 4KNWA 1PJZA 5AW7A 5LQJA 5MHTA 3H5AA 3GJQA 2PBLA 2C8JA 4C2TA 4MDEA 1PGPA 4AWBA 2R6HA 2QVLA 3I72A 4IUBS 4QJIA 5CVEA 2ZWMA 1FU7A 4BFUA 5FFFA 1VTKA 3VYWA 2J3KA 3E7XA 4Z51A 4YRSA 4K9KA 1P74A 1ZESA 3HN6A 4KR0A 1E8NA 3T3PB 1OBFO 2JGMA 5KYNA 3AKCA 3FW1A 2FWRA 4ARSA 3TAUA 2Q07A 1IN4A 1J9ZA 1XZFA 4S1TA 3WJ2A 1A8SA 2X58A 2IYTA 2NLOA 4UTNA 1SIOA 2C99A 1TYZA 3H65A 3CGWA 4NAVA 3FCUB 5KNLA 3DXXA 4U9UA 1VGRA 1CJUC 1ZZEA 3B6IA 3P0IA 1GAEO 2OVBA 2XB9A 2EZTA 4GGPA 3H5LA 3T1NA 4GXTA 4A7PA 1Z26A 1GQSA 4RA6A 1PR3A 4DCUA 5BUQA 4I9GA 5C52B 4AY6A 4C2UA 1DQZA 1PVVA 1N5OX 2AFHE 1UBRS 2VTKA 3DMNA 3GRRA 5EZQA 4DF3A 1K7YA 1C9MA 2Z83A 5EJ6A 5CB0A 5A5FA 1KS9A 4MIYA 5C3UA 3U60B 6CHYA 1ZSNA 4C7JA 1S9DA 2C3YA 2VDOB 1D8AA 3KVVA 3GWGA 5JWHA 5TVKA 1KSFX 5C1BA 4S3MA 5EHXA 2Q0QA 2V5UA 3DAYA 3OE1A 1UWVA 4NBWA 2A0UA 5LB2A 1UPAA 3ACCA 4KMOA 2DQZA 1W35A 2XAAA 4PO8A 1YBHA 2DHEA 2PX4A 5JI2E 4O6VA 1ZFNA 2CXNA 4J43A 4MRRA 2SBTA 4BFCA 1JMVA 1E6MA 4FGSA 1TKRA 5HP4A 2BP7A 2F1KA 4MV5A 2NO0A 4I1SA 1Z75A 1TK9A 1EFLA 2EFJA 3N70A 4KXLA 4X97A 4FYIA 1HMYA 1A72A 1KNXA 2D8AA 3TLBA 2AQ8A 4TMTA 4Q12A 4I4TB 4EPVA 1D8TA 4FD2A 3SG0A 4E4TA 3PRJA 1ODIA 5HMMA 5E6UA 1EUCB 4EKIA 1TA4A 4EMUA 2GA9A 1YHYA 3G0CA 1M34A 5TEWA 1C5KA 1P2SA 1VYVA 2BY4A 2IYRA 1YVDA 4DIDA 1RKBA 4DWOA 1KZ1A 4FKMA 2EV9A 3CEJA 2QN6A 3C5WP 4M36A 5JQGF 2PUGA 4HG2A 2QLTA 3E2IA 2B25A 2ZYRA 4OHMA 1UXJA 2XX3A 4D43A 2QSJA 1Y8ZA 4EO7A 3KSUA 3BD9A 2QMQA 3EXG2 3IMFA 1JIIA 3V4LA 2VTEA 3ON5A 1G6OA 3PJDA 4HN2A 4ZU6X 2OFXA 3GCWA 1DWOA 3R1IA 3RLIA 4OHYA 2XUFA 3N8NA 3IAFA 4IDGA 4YRCA 2FPXA 3QBJA 1NVAA 1JYEA 3F46A 4JVSB 1M6VA 5REQB 2H8GA 3BD7A 4OFZA 4KBGA 1PCXA 1W47A 4QUJA 2JGJA 3OZVA 4II7A 5B1IA 5IJAA 2FPIB 4Q4AB 1PT6A 1FVXA 4XGIA 3V4ZA 4AJ2A 1U5CA 3KXDA 5JYDA 4RTKA 2AGVA 3SSOA 2G72A 3H9CA 1UCFA 4IDAA 4RY9A 1CDDA 1BW9B 4BASA 3TZQA 2BH9A 4QGFA 3O2JA 2W93A 2DBVO 2VF7A 2DWCA 4MIOA 1KBOA 4IDQA 2JCVA 1ISPA 1I13A 3ONEA 4MIKA 3OOEA 2WAOA 4MVJA 2ZRGA 4KIWA 3COWA 4FZ3A 3K72B 4D02A 2Z8ZA 1ECJA 2WMDA 4C0KA 4EI9A 2EFEB 1AIPA 4Y30A 2JATA 2CXTA 2ORWA 3RIGA 1NW6A 3ZYZA 5KTYA 3BXFA 1YDGA 4KQCA 4ZAFA 2B8JA 3MCZA 2CHEA 3MWDA 3EVDA 1P1HA 3GG9A 3ME5A 4C43A 1OYVA 2JI7A 3CKLA 3A10A 2YMMA 1M8JA 1KK3A 1QK4A 3FVRA 3OCZA 2BELA 5JAQA 1JQ3A 2H4XA 3AY3A 4MUYA 1HEUA 2XUJA 5FUXA 4F6RB 1F8UA 3HCOA 2H2FA 3GIDA 1PJ2A 2JKZA 3ETJA 3I04M 3OZRA 2O0JA 3H83A 4NPCA 1Z2NX 3LHIA 1ZSVA 2PUDA 1OZ0A 2PUWA 1ZJ5A 2AYZA 4GLLA 2R60A 3T38A 3S2YA 3KFVA 1JAYA 4J0HA 3CPEA 1NM5C 4KDRA 3BH6A 3NIGB 4GLFA 3WQRA 2EQAA 5IARA 3N7UA 4DIMA 4LY6A 1K4KA 2E1PA 4N76A 3ZNPA 3M1IA 2QLBA 1JEYA 3HA2A 4L07A 1BKYA 1EU1A 1NVDA 2HA6A 2J5BA 1BYUA 1VHLA 5ICFA 5F1KA 1GFWA 1JPVA 2ZVQX 3KYCA 4G5OA 1RJGA 3FTNA 2XECA 4BQNA 4HNSA 4I6EA 3QE0A 4FGUA 3W5DA 4JGIA 1EXVA 1RLMA 4ZVUA 2VPQA 1M5RA 1DDGA 1T9GR 1W87A 4FYVA 4J7AA 4F96A 4JBWA 3L82B 4RFVA 3A6PC 2UUOA 2WJWA 1EAMA 4ZI5A 3TJMA 2ZUUA 5A7FA 5KB3A 4R2HA 1SOMA 2RHLA 4BNLA 2AG5A 2DQYA 3EX7C 1TEZA 3O8QB 4EK9A 4BNKA 3K32A 4L8YA 2IU6A 1Z8DA 4ZPXA 2H0RA 4Q9IA 1QTQA 4H6XA 2W5UA 4QUEA 2BMWA 1LJ8A 1H2FA 3U37A 2BYTA 1TIPA 4DMLA 1VKRA 4RZXA 2XNJA 3UAVA 4BRZA 3REQB 1U8FO 2DOKA 3GJ4A 3AVTA 5KJCA 2ZJFA 4RCYA 5FL7A 4N7JA 2GWRA 2QOEA 5ARBA 1TD1A 1SPBS 2XD9A 3JATB 4UTOA 3T5MA 1T9KA 2BI4A 4A16A 3BF7A 1HURA 1NX6A 2EZUA 3E3MA 4OBEA 5HHTA 1U9CA 3FM9A 4J6FA 1EKXA 3NFRA 3HYTA 5DFAA 1FRQA 4JC5A 4HH0A 4QRHA 1X1AA 4KO2S 5AIAA 3AVPA 2E2WA 2VHQA 1G7RA 4MUEA 4MHOA 4YJ2F 3OU6A 5JY1A 5JYBA 4IVRA 4M9CA 3TGLA 2DBQA 1GDDA 1Z5PA 2M6KA 3AZQA 1PX2A 1TK3A 3AZPA 5JBQA 2P4HX 1IB6A 5IAOA 1ECBA 4IO1A 4TV9F 2A9OA 2WICA 1TA0A 3B7WA 4PPNA 4D92A 1AZTA 4JL6A 1FU4A 5IFLA 2UXBB 1DKLA 3UAXA 4EF6A 4EJ6A 1L3IA 4X95A 5FKJA 4M1OA 2BFCA 1D1TA 4ESHA 2RC6A 1CQZA 4X3PA 1KK0A 3SK0A 4L6IA 3NRBA 1XR3A 5EUQB 1QOPB 1P6QA 1E3DA 1ZWKA 3X2EA 3DFUA 4ZV4A 5JECA 4X6XA 2OFWA 4B7XA 3CUWA 4CMHA 4ZN6A 5JCXA 2VBFA 1VCIA 1AQ6A 1XZGA 4MGEA 1OMOA 3VO2A 3G85A 1EFTA 3QUAA 3IIEA 3ZKWA 1GITA 4Z0HO 3OKPA 1OLXB 3U13A 5BSHA 1HYEA 3GMIA 1A0OA 4NEHB 4YMLA 1U0TA 2R9VA 4RVSA 1X6VA 1QYDA 1UK6A 2I2AA 3W8EA 2H0AA 2WJAA 4D4HA 2B1QA 2PUVA 5BSFA 4WFKA 5FBZA 5HF5A 1K7CA 5DHFA 2IQ5A 1M0SA 2J3QA 2O2CA 2ZVPX 4QDTA 4QHYA 4ZDIA 3UMGA 1L7QA 1GGVA 1Q0HA 3M8KA 4JI2B 1TJPB 1ZMBA 3EJ6A 5JS8A 2FUEA 1Z3CA 3GRFA 2Y9PB 4O5AA 5FR2A 5CG2A 5LP6F 1ILEA 1G3QA 5DN6A 1IONA 3I05A 3AL0C 4DIKA 2JJ1D 1N2CA 1GU0A 2EWVA 3CZPA 4WY8A 3BXPA 5FBKA 3DAOA 3SX4A 3HKDB 3C7DB 3C1OA 2VC2B 2NU8A 1BDHA 2Q21A 2X8JA 3ANXA 2UYOA 5JT1A 2UYCA 3IAS6 5ILGA 2RC5A 1KR5A 3OQBA 1DMRA 4LE1A 3DL2A 1C0LA 2P9TA 1ONSA 4JAVC 5CDYA 3WNVA 2LCFA 2BR4A 1DBQA 2B1RA 3FTDA 3E9EA 4AUNA 3A9TA 4JOSA 4MSUA 4O4IA 4OBBA 1SCBA 1R9GA 1RI2A 5LDDC 3WIEA 4M8IA 2GYWA 1AUQA 1QQBA 5ALZA 4D3XA 3VPHA 5HQTA 1JFVA 2VAPA 2B61A 3FPGA 1NATA 4KUEA 4TXNA 1ISMA 1EGQA 1JYSA 1Z0AA 1Y6ZA 4R05A 1K5GA 1VMKA 1HF3A 2EJVA 2ODBA 3KKZA 3UB4A 3HUDA 1NF3A 1QFXA 1ANKA 2APJA 2CJXA 3F5DA 3FSJX 4X1KB 1MT3A 4ZAWA 2PV0A 3DKVA 1KQFA 2CJWA 3OLYA 2OL4A 5CFMA 5ETJA 5CDFA 3YASA 3IMEA 4F2GA 1HXHA 1E79D 2C88A 4FN5A 3L77A 3K5PA 5ANRB 5CX1A 1UXHA 1R3UA 1M2GA 2ZJ1A 3KYIB 1JG3A 5JRJA 5E2AA 4Q4JB 4DMGA 2JFOA 4W5WA 5AW3A 4BNZA 4DB2A 1ZCAA 1Z0FA 5CFLA 2K2WA 1SCJA 1CJSA 1FSSA 1FQKA 3O82A 2Y66A 3G0GA 3TAXA 1KAQA 3A7DA 4KIFA 1DBSA 4GECA 1CY0A 4Q7EA 4QAQA 2FGKA 5FB3A 1ZA2A 5DNVA 3EVAA 1H2EA 2ZREA 3L0ZA 1NMEA 4RHCA 3MNFA 2VCEA 3HDVA 3NXKA 3T9FA 4RWEA 1X7ZA 4PYOA 3KQWA 3OM8A 4L5YA 1Z4LA 5LOVF 5ED0A 8ATCA 1A8IA 4ZYUA 2F55A 3EGOA 4X41A 1VXOA 3TZCA 1OWLA 2HGSA 4AO6A 3BBLA 3FUCA 2O4CA 4Z3DA 4EKGA 3LQ1A 3H19A 2WSMA 1B73A 1A5SB 3F74A 4PZ9A 1KQ3A 1Q57A 1WDKA 4QDXA 3KR0A 4MWDA 2J4DA 1MRZA 3TEMA 4YV0A 3A6LA 1SUAA 2BGWA 4XGKA 5BV0A 4GBGA 1ODFA 1XROA 1Q91A 1SKUA 4FX2A 1YHNA 2B30A 3H1FA 2H1OA 2ZIXB 1E6LA 4Y7CA 3GROA 4QIHA 3K31A 1EIZA 1ZGHA 1T43A 3IAS1 2YYYA 2Q8PA 1M8PA 5BRNA 3FOWA 3HB5X 4H17A 4CHTA 4Y6SA 4IMRA 2DXIA 1PL7A 3L2OB 1HOTA 1PS9A 4RA9B 2PLFA 3BQMB 3BSFA 4PTYA 3KTAB 4FC7A 3UJ7A 2OV4A 5E7QA 3WX0A 1GLGA 4E1VA 4JXKA 2O3JA 3IDOA 4N5MA 1JHAA 4Q01A 5EKSA 3PGMA 4B0OA 3CR8A 2ONKA 8ADHA 3WKEA 5CCDA 1X1SA 3QZUA 3S81A 5CBKA 4E03A 3K6SB 4H6WA 3ECSA 4YRKA 1VPWA 2HSWA 1R9JA 3OEYA 4UDNA 4PWZA 1J1IA 1E2UA 2GILA 3AR6A 3NB0A 1YR6A 3PZRA 2R5NA 2NVWA 4ARCA 1UOOA 4FHGA 3SEFA 1U7PA 1GPKA 3K35A 4HAUA 3T3EA 4IINA 2B4AA 4WQMA 1JDZA 1AQLA 1HK7A 2JHFA 1EWYA 2LGJA 4C89A 3H4MA 4Z9YA 1EX6A 1KA9H 1TT5B 2VJMB 3IC5A 4O1IA 3X2FA 3W6OA 4CZ2A 4L5AA 1LD3A 4M22A 4YFYA 1AS3A 1JG7A 3PX3A 4KE9A 5IM4A 1IFXA 3T7SA 1O3YA 1MO5A 1Z6XA 1ADCA 3OQ6A 1E62A 1E98A 2C4WA 3K9QO 5E6RA 3H8WA 3L18A 1U90A 2YVKA 3GQVA 4FDTA 4AXBA 2B6HA 1KOLA 4JEIA 3E4DA 4D74A 4DDMA 4ZCSA 2Y1WA 1U2PA 1KKLA 2AZDA 1ZHHA 1IY8A 1SUFA 4ESEA 3ITDA 1AKUA 4ZAVA 2X2FA 2DWUA 1RC1A 4WNYA 4M53A 5E3HA 1Z22A 2XKJE 2J9FA 3TQIA 1B8OA 3O8RA 2CXOA 4F3RA 3VU9B 5GVRA 4P7KA 3PWZA 1ISSA 2Q7OE 3MF4A 1A4IA 1MIOA 2FYTA 4B74A 1NBME 4UULA 3IAAA 5EZYF 1WBBA 3VHRA 2OO5C 4ZCIA 2VNHA 1IN6A 1FP7A 1ZIDA 2PMBA 3A1SA 3WP1B 4RDXA 3KQMA 2G88A 3V80A 3G8YA 5I4IA 4ITRC 3D02A 3K9LA 1XV5A 3U2QA 2JGEA 2FSGA 2ID7A 3UICA 3WV5A 4H7HA 1C9YA 3MJSA 4NCNA 2HMTA 3MGAA 5E38A 5EVCA 3EK2A 3OFVA 1T6BY 1Z2CA 2ZRKA 1X9GA 3E5MA 4MTLA 1XAGA 3F6PA 1GV0A 1Y3AA 2GVNA 5DT9A 4RS3A 3P9PA 3WIBA 4TZ0A 1JR2A 4PRLA 1U0SY 5SYAA 2IV3A 1UBKS 3ICQB 3WSVA 1O54A 1TU0A 2OB1A 2AR0A 3CUEF 3ZEIA 3HJTA 1YJXA 1NVTA 3RAFC 4U2KA 4DDHA 1NIPA 2GR9A 3PPVA 1KS2A 4R40A 3VV2A 5IVHA 2ZEJA 3V4VB 4BFXA 4QG3A 1CU1A 4RLQA 1X8LA 2W00A 1R6UA 1EFVA 3O73A 4B75A 4KDCA 1OLOA 2GX6A 4DUGA 1BXGA 4RV9A 1IRXA 4ROTA 4NFHA 3FCYA 4QRIA 4E2WA 2XZOA 3DOFA 3LFTA 3D6AA 1UWCA 3AEZA 5EFZA 5JCPA 2JH9A 2YVLA 3JD4A 3OLVA 2D5IA 1UXKA 1LLDA 5L3QA 1JZSA 2GJSA 4WLFA 5HRAA 1VG9B 1U3UA 2A2ZA 2H54A 2XVMA 4Z5XA 3IV7A 1WO8A 1BJTA 4GC5A 1P7VA 1A69A 1IM5A 1FTQA 5DSTA 2QT9A 3W3AH 2GHQA 4UUMA 4QQFA 1LX6A 4QDZA 1YA8A 4HFMA 4MS1B 4YAWA 3QTTA 3RVDA 3VPBA 1QH1A 3U44B 2R4TA 4EJSA 1GILA 3DXYA 1PLJA 5C5EA 3MGBA 1DRJA 2F43B 1LSUA 4PLHA 3DMGA 3HH8A 2AMFA 2ISSD 4PXAA 4XUEA 3SI7A 4LF8B 3H9BA 3N74A 3C8UA 3FTEA 1F17A 3WYNA 5CDGA 4P5DA 2DF8A 1E4EB 3RSZA 4RH0A 4IRXA 1AURA 5IMSA 2F3UA 1WX1A 1DL5A 2O7QA 2ORYA 3FJYA 4CQMB 2G7ZA 4KSBA 4X93A 4BECA 4EZEA 3L1KA 4MYUA 1FNNA 1ABBA 1W0KD 2C5FA 3IP8A 4P4GA 1QGZA 1X94A 1XN1A 2UUBB 2UXDB 4F3KA 4OLFA 4G6ZA 1ESZA 3RAPR 5AJXA 3CW2A 2F3SA 3O1HB 2B83A 4PS0A 4AF8A 2ZRFA 3L06A 1RJ9B 4K8RB 1B3BA 2VHCA 3BVPA 1CT9A 2VDNB 3CKYA 1FNMA 3CTPA 3MTBA 3HA3A 4GPBA 4KB5A 3AU8A 5IF9A 3U7GA 4YP5A 1A95A 5F21A 3FGZA 3W6NA 3T5TA 1QOZA 2DETA 1YZYA 4IIXA 5EYPB 3HY3A 1JQEA 3PEUA 5DVZA 1JFRA 1RYBA 2AVDA 5K5EA 3U4HA 5T4FA 4IPTA 5EGSA 1ECGA 1EZZA 1XTJA 2HY7A 1ECLA 2I65A 3GJ0A 3RWBA 1J42A 3CVUA 3IKVA 1ZM7A 1YB2A 3UMBA 1W5AA 1O6BA 4HNAA 5AK6A 4TLDA 3VUEA 4KREA 2BIFA 2IYQA 1HSZA 1LK7A 4U2EA 3DB1A 5BT9A 2XCSB 4MPPA 1NY5A 1TOAA 2BM1A 2DPXA 4MR7A 3L46A 3TN7A 1QMGA 1CY6A 3EIUA 4HZGA 5CLFA 1FBTA 5AK0A 2VPXA 2QE7A 4R1UA 2I9KA 1HEYA 1CRQA 3LDAA 3MJTA 2X76A 4CLEA 1HQKA 1LK5A 3U17A 2ZSIA 3VI3B 1HA3A 1KAMA 3GLHB 2A1UA 2VDLB 1DBWA 1XDUA 1XIVA 5HJ2A 4F46A 5HKBA 5JH7F 5JOQA 1JJAA 1AHHA 4H08A 1SC1A 1I3NA 2KPOA 2YUIA 1WEKA 1D4FA 3D2AA 1XJ0A 4H16A 4BVKA 2LPMA 2BGRA 5LM3A 1IOZA 1U9IC 2GI4A 4DDWA 4GI2A 1KO7A 2ZIFA 5I01A 5FUVA 3B1VA 2VZ8A 4GF5A 5JNUA 2IXTA 4I1OA 4WKNA 1HYGA 1D5WA 1V3VA 2EC5A 3HDYA 4Q3DA 4UFNA 3SKYA 3GA5A 1BN6A 3QBVA 4AD8A 2VVTA 3EQ7A 4J4TA 2HHHB 4CFZA 3PDWA 2H1LA 5CM8B 3GZJA 4NOLA 1L7BA 2J0UA 1GG5A 1I32A 3AF5A 1AN0A 4FINA 3SXPA 4HNVA 4LRTB 2BGNA 1ND5A 1QXSA 1T2CA 4INOA 2RK6A 4LIPD 3RG8A 3TZEA 3WQSB 4CLOB 4YRFA 2IPOA 4MVJE 2QQ0A 3M6UA 4C4PA 3KDSE 4D0LB 4Q4HB 1OTHA 1ZOLA 2EKBA 4K88A 2ALJA 2GGSA 3LX4A 4RGBA 3W8FA 5ABPA 3QPCA 1SFRA 4W5JA 2TYSB 3OQJA 5ES3A 2DPYA 5FI5A 3KD2A 3KTFA 1DMSA 4J0QA 3OTWA 2ZJ0A 3IQDB 1IXKA 4E6EA 4WMLA 4I19A 2E21A 3A6EA 1C7QA 5F4BA 2F4NA 4CM6A 5IJ0B 1P8AA 3MBOA 3CNNA 2X4LA 2D0IA 2AFHB 1IL0A 1MA0A 2XE8A 5CX4A 3R9KA 3VR2A 2HRQA 2ID4A 3SF8B 1NN1A 3DL4A 1P2GA 3QEKA 5KNCA 4AKGA 4Y6LA 4B3IA 3QEBZ 4JLNA 1O94C 2VK8A 3PC8C 2PKQO 1ZOOA 4NESA 3KJZA 3W34A 4QJ3A 1I24A 2WE8A 4DV4B 1IOLA 1F2VA 3FUWA 5AKJA 4XWAA 3OURA 2D5CA 5BNTA 3SHOA 1D3AA 2QJWA 1HL7A 2W83A 4U2GA 1J8YF 5CUQA 5C37A 4ZVNA 3WL4A 1AB6A 1CNEA 3FGPA 1YVUA 3AW8A 4XM2A 1W5BA 3STUA 3AF6A 1J39A 4CMEC 6ADHA 2PD6A 3ZW9A 2QMUA 4DKXA 2IYVA 2CF5A 2EGUA 4GM0A 4Q37A 3KD3A 2MTBA 2O5RA 1I6KA 1PF7E 4QGBA 3GAAA 5IBPA 1YJQA 1JQAA 3DOOA 2G82A 4W63A 4EA7A 3G7UA 3M83A 4K3UA 1RMTA 2QXYA 4C7XA 5JW6A 5DGXA 1AKVA 1IEWA 3OY7A 2O52A 3H11B 4WN9B 2ERYA 1IBLB 2R2AA 4RVOA 3P8ZA 2GAOA 3QLEA 4J1TA 1RHQA 2AX3A 2VT6A 2VHXA 1KI1A 2PA3A 1TU3A 3WLPA 2OWEA 4YYZA 2VYVD 4D4GA 4Z2YA 3SBEA 3Q72A 3EMDA 5ALIA 2C2WA 3VX4A 3GI1A 1BS1A 2QTMA 3HKCA 2PH1A 2OOSA 4OP1A 3HJUA 1PT8A 1XRLA 3F3KA 2BBTA 4INPA 4YRBA 3M5CA 2DBYA 3IEVA 4Q9LA 1XRMA 3REGA 4O1HA 1KU6A 3ZD8A 3W77A 5EC8A 4UUNA 5KVVA 2Z2IA 1X7DA 1R4NB 1HR0B 3I1YA 1XPRA 3C87A 4ZYXA 1FNBA 4RPIA 1MX9A 3CEHA 4QJ4A 4BQFA 4RVHA 1Q1NA 1HLPA 1VYHA 2DY1A 3GT3A 4LGYA 2WSLA 3FPJA 3L04A 2GLTA 2P2GA 4R68A 3UWKA 1GPWB 2C4KA 3IQEA 1R4ZA 4JODA 5EXSA 2GVDC 3RSFA 3RYFA 2BPOA 1G8YA 2ZWIA 3FYUB 5EGNA 1XMPA 1FUYB 1KETA 2JFUA 1GNSA 2GZAA 2VF5X 3NUGA 4QFDA 5H68A 5TY0A 2DWPA 4LF4B 2FMKA 2HPVA 4YO7A 3C0KA 1GHTA 1Q0UA 1WZUA 3B9RA 4EJFA 2Z30A 1VHDA 4WZBE 3QXHA 4I50F 4ZKDA 2BN4A 3DBVO 4N40A 4LYGA 4ZT7A 3UUGA 3ZHUA 3Q41A 5FO1A 4H7JA 3UNXA 4E3WA 1IBRA 3PUKA 2V4UA 3ZGOA 2IX3A 1WDWB 2RIRA 3ZU3A 4QBGB 1VBKA 4TWJA 4JASB 4D3ZA 4YCLA 1XTZA 1WW2A 1Y6RA 3NBXX 1THTA 1V1MA 221PA 5FTKA 1E2EA 2VRCD 4QOEA 5EPUA 1P4RA 1WQ1R 1XZQA 2WJHA 5A4JA 2X0IA 1N33B 3L1UA 4OGWA 1DKRA 3PSHA 5AXDA 1KMMA 1UK9A 4HSGA 1T4CA 5GGYA 4QQNA 3I4LA 1I0ZA 2PZEA 4L78A 4Z3OA 5MFZA 4ZOLB 5HDBB 3HY6A 3COSA 1ZNQO 5DYIA 2NUAB 4RIIA 1I2BA 5F3RA 1YJ8A 2P2CA 4EX7A 5D5QA 2CD9A 1PR5A 3I01M 4A0HA 3VH4A 2VHEA 3G9QA 3D7NA 4JNKA 1VL1A 3DHEA 3O03A 5FTWA 4LI3X 1C3VA 3VBCA 3I9NA 4F21A 1M0WA 2JC3A 5MFPA 1K63A 4RV4A 2P75A 5IRCD 2VFAA 3OPYA 4F4UA 1RZ3A 4LNUA 5J5VA 3TZKA 1N2CE 3E81A 3I34X 3MM4A 4O4LA 5A6SB 4PVCA 3ECAA 1RXWA 2D0PB 1UZUA 4NYMQ 1RI1A 4BVAA 5C1PA 1H8HA 3CLSC 3SNHA 4BFTA 1GCIA 3IIIA 2OCIA 5AT1A 5KSOA 3ZQ4A 2X5XA 1OA0A 3L1VA 2EQBA 3D3NA 2O20A 5A0VA 1IQUA 1BMFA 5AM5A 1DCMA 1OC4A 1OD6A 3NV7A 5C2JB 1T3LA 1IZ9A 3RKRA 3EGVA 4RMIA 3ZKAA 4WPGA 3C43A 3TAHA 3OQOA 4YT2A 4KGXA 5JZMA 1UDAA 3TI7A 1RW4A 1XMVA 1WG8A 1YRWA 1PLKA 2WNHA 3LPCA 4HQNA 1V3QE 3FPFA 1Q84A 1UK8A 2PJDA 1NBEA 3GH3A 3IX7A 3KSMA 5D87A 4ARUA 3BDVA 3QJGA 3LKBA 2I91A 3OA0A 3KQSA 4H7IA 1UKBA 4W8HA 3CU5A 3QRWA 5I9LA 4MJLA 2XYPA 4XB1A 1FX1A 1A5TA 3RVOA 3OOWA 3F7NA 3Q5DA 4DQKA 2ZJ3A 2WJ6A 3RFVA 1LXCA 1MTZA 2X9GA 3KQUA 3WJ1A 2ZQYA 1ZXLA 2CHFA 3CLRD 4Q6BA 3UGTA 5CFZA 3CRW1 4CKBB 4KIGA 1FS5A 3O4VA 4RIFA 4X1IB 4I81A 1XSEA 2Q3EA 4DSZA 3KR9A 1UAGA 5TGTA 1Q0RA 2E4YA 4EW1A 5CDFE 5J4YA 1QP8A 2Q3HA 1BNCA 5HUQA 1SC4A 4TTVA 4QM6A 1V37A 4CN9A 4WE3A 1CG6A 4LOAA 1QORA 2QN3A 1IULA 1EEHA 1UJ4A 2A58A 3DKRA 3KKEA 3PR3A 4RW0A 4TRNA 3ZW8A 5LD2B 3IR6A 1NONA 2XTJA 4PBSA 1K08A 2D7JA 3ORQA 3RTBA 5YASA 1AMNA 1Z39A 2VK2A 1TF5A 2EYQA 3LWNA 3OE4A 4W1RA 1DQRA 4JJAA 5HW0A 2BD0A 4D8TA 3Q10A 2P4QA 1QV7A 5KTOA 3EWAA 4R8MA 4K9RA 4RLSA 3UH0A 4ZCTA 6PFKA 4OPMA 2K2QB 4O29A 2NO9A 2Z56A 2VZ9A 3MIZA 3Q8KA 1L4BA 1KIMA 4ND2A 4FSDA 4Z7QB 1JFTA 1QGUB 3OT4A 4GPTA 1NM5A 3I3SR 4URZR 4PCAA 2O8BB 1CEQA 2E37A 1B26A 1Z83A 3GMDA 1FFXA 2HF2A 3A6DA 3NVAA 4HDQB 3L9WA 3AXSA 1E9FA 4KXVA 1TVKB 3OC6A 1OHHA 3Q6MA 1NJ6A 5DGCA 3GLIE 4RKWA 4N0QA 3DAPA 2XMSA 2VQ3A 3QH4A 1PSWA 3NH9A 4JP1A 3SR3A 4ZP1A 5HQ3B 2CE2X 4O2LA 1K27A 1X92A 4XR9A 4DLVA 2A7XA 1WHTB 3AP3A 3R5KA 3SU8A 2C3PA 3STWA 2SCUB 1H1LB 4WL0A 4I9FA 2PFGA 3BG5A 4IIFA 1O7JA 1GAWA 2XQVA 5H3HA 2QD4A 2UKDA 4W5TA 3AHEA 4GP9A 1CUIA 1IB0A 4IMJB 4D8YA 3AF3A 2EP5A 1KI3A 3O84A 2ZYIA 1PFQA 3L7DA 2VYNA 1WP4A 5ELLA 5L95A 1AJEA 2Q9UA 4GWKA 4YRGA 1BJRE 4DL9A 3SE7A 5J4VA 2W6PA 3JVUA 1K8ZB 2OCDA 4XYMA 2FH5B 2P2ZA 1U1IA 3NEAA 1XEXB 1FYFA 4WV3A 3LCUA 1JAHA 5LU8A 4FEYA 4ERXA 2JCBA 4HLQB 1CETA 2PXXA 3MN1A 3SS7X 2PRIA 2HLHA 3O2SB 4DRXB 5L4SA 1AM4D 1WZEA 3RQSA 5D3MB 4F92B 3NTQA 1XP5A 3OKFA 4JD5A 4ZCPA 3RJTA 1E7RA 5B37A 2PWBA 1DEAA 4DUPA 4BPBA 2J6CA 1IN8A 2O0LA 4RELA 4UATA 1DPGA 3WGHA 1J49A 2X0JA 4DQ0A 2VJNA 4TL8A 3VYSB 2XMGA 3RREA 2HA2A 1R6AA 1YL6A 3WI7A 4N0MA 5DWVA 2CV2A 4UBIA 1V9LA 5DSXA 1IBCA 2PGNA 2ZYVX 3D3QA 2RB5A 3RW9A 1E3MA 1YRAA 1DB3A 2ZUEA 2C1ZA 1C8BA 1Z38A 2VOJA 1WB4A 3FFTA 3L7IA 4AM8A 3Q15C 4X44A 4J91A 4PGGA 4HAYA 3A70A 3AKDA 4YT8A 2Z5GA 1QG0A 3QWHA 4JDUA 3K9HA 1W4RA 1JSRA 2WWIA 3RRXA 4EA9A 1C3JA 2NVUA 2FOLA 1QIMA 4B6SA 1SUPA 4MDFA 1ZVMA 1D6JA 1GXSB 3A37A 3PKIA 4LV8B 1KO5A 1XVLA 2F3QA 2B21A 3PICA 1E1QA 4DV1B 4P22A 2XE6A 3GLGE 1TUIA 1TM3E 3TX6A 3MQFA 2WSBA 5SY6A 4TZ6A 2B35A 4L9SA 4A1FA 5CT8A 3RTDA 1Q7TA 2ZTSA 3BGOS 3IURA 4F0JA 2PN1A 2PQ6A 1DV2A 1JX6A 2FRDC 3M6FA 3PDIB 4MLZA 1J2UA 1XRSB 2H17A 2EIXA 4FIDA 1EMDA 1PQPA 4V03A 3SIXA 3VU1A 4FCVA 2NZJA 4J6EA 2WM8A 3WS7A 1FNDA 4DANA 1JG2A 4LTNA 5CHYA 1ZYUA 1OTYA 3KKMA 2PGIA 1D7OA 1GZ4A 2XZTA 4NU8X 3TBFA 3IAXA 3CF4A 2A30A 2I80A 4HQKA 5DGIA 3FMOB 3T3MB 5AUOB 3AOEC 1J33A 2R96A 4D9EA 3NPAA 3UWDA 3THYB 3O38A 1O5TA 2EP8A 3D1VA 1NBHA 5BRAA 5HJEA 2OC4A 3HFGA 3E15A 1C4KA 3DZFA 1I1OA 3Q12A 2D1SA 3KETA 1EK5A 3H8SA 3LI2A 5D3QA 3NT2A 4NCBA 3TF5A 1KJJA 4DCJA 1N6PA 1XWWA 2WABA 1O6FA 3SMVA 2PWZA 1XZIA 4WUVA 2BMAA 5A5DA 5AMXA 1GUYA 1DX4A 2NOAA 2XCUA 4K28A 5K0TA 3CX8A 1Z5WA 2MDTA 4A5OA 1MEOA 1RNLA 3QU5A 2QUHA 1LI7A 1UWKA 2YS6A 3UMMA 3MJHA 3Q8MA 1P9OA 3NHKA 4PCLA 4MTCA 4E21A 1GLNA 3BE4A 3ZWPA 1E4VA 4J8PA 2VA8A 1O8BA 3MMNA 2WJYA 1J25A 2BGJA 1Z0KA 5EZSA 3B6MA 3AOGA 4ZTUB 4MUGA 3ETEA 2PL1A 3NGXA 3CJQA 3HBFA 4JBLA 5EHGA 4BDSA 5CYFA 3FIJA 2ZJYA 1EX7A 2CSUA 1NNLA 1FEZA 1KI2A 1TEHA 3CJTA 4GKAA 4PSUA 5HR5A 1FTYA 3EEBA 1BU5A 1QG4A 1RS0A 3IUQA 1NUTA 4UE6A 4ZQEA 1N6HA 1EDOA 4U7GA 1A1VA 2ORED 2J87A 4YK7A 1XNJA 4XI9A 1U7OA 2N3ZA 1MH9A 4EEZA 1SQ5A 2HBQA 3TCXB 2IYOA 4TT3A 4WZAE 10MHA 4Q3BA 2F3TA 1UKVY 4BMDA 1X1TA 1CP2A 1CUYA 3D5QA 3JQAA 4B43A 4DR4B 1O08A 2IIQA 4YJGB 1RRMA 1XU7A 1WXQA 2A9RA 2QLNA 1M2OB 4UZEA 4D6PA 4E5MA 4EG8A 1HYHA 4L95C 3AHJA 1T4GA 3NIDB 5G40A 3R77A 5JWRA 1F51E 4C4YA 1N57A 3L7BA 4EDFA 5JQGA 2HDNB 1S3GA 1DKOA 4COOA 1Q1QA 3HWSA 1VKOA 1QKKA 3ANLA 5IPFA 1N6KA 3GCGA 1TVMA 1JU9A 1XXHA 3W1VA 3DULA 3MYYA 5EESA 4UVIA 3WO1A 1H4QA 4FBLA 4B6EA 3N86A 4D82A 4XVCA 2I6UA 3BIXA 3ETCA 5GAJA 1C4WA 1KJZA 1K3FA 1XCLA 1E1CA 1EAYA 2I4RA 1PEAA 3GLRA 4NSNA 2B1JA 1Y3HA 4US0R 1OXBB 1D6MA 1JLSA 1WCYA 2AC2A 4K40A 4JT4A 5K3BA 5TARA 4HFNA 3OIYA 1V6AA 2CLMB 4KR2A 621PA 3OE7D 4O0MA 2QD2A 4B46A 3R3JA 3NONA 1MX3A 2B3DA 2I3ZA 4LHSA 1I7PA 1BGVA 3GLTA 4HUQA 1KQOA 1CJVC 3A1TA 4GHWA 1I4DD 1Z0IA 1JJBA 4IOLA 4HYTA 2NNWB 3KFLA 4R01A 4Q9KA 5F7JA 3IULA 5K0CA 4K7JA 1OLUB 1H2RS 1WEHA 1P7WA 2BZGA 4YCDA 5KNCD 2RD2A 3DBIA 4B76A 5AKZA 1PJSA 4MV3A 4O2BF 1G1MA 1KFKB 3H2ZA 4F9GA 4P3PA 4BGVA 2XBLA 4NMXB 5E7MA 4DJTA 1YZFA 2X7HA 1ZMOA 3BHNA 4HDNA 2JKVA 4ZQIA 4YMGA 3QVKA 3UJPA 3S5UA 3M3PA 2XIJA 3EY9A 2V74B 4LEIA 1MX1A 3KQYA 3J80A 2WU8A 4MLCA 2Q0HA 4D3FA 2A5LA 4GH5A 1BE8A 4XVQA 3QXSA 2VNKA 3UAOA 4CKEB 3GGGA 5CA0F 4YRMA 4BEJA 2GBGA 4EAAA 4QNMA 2WM9B 4C0BA 2OAEA 1N9KA 4F6LA 1E2HA 1Z16A 4JYBA 1ZGZA 5E2BA 1YKSA 2VJAA 1NQAO 2YHUA 1Y9JA 5BV1A 1G9TA 2H63A 2HWXA 3JRXA 1P2TA 3AY6A 1XBTA 1RXCA 4YUXA 4GXNA 4UBMA 5D5HA 5IW8A 5LQSA 1QZ3A 2BEUB 4C7VA 3WB0A 5L3SA 4LF5B 1I33A 1T8PA 4YONB 3DEAA 2VDJA 1QQ7A 1VLMA 1T15A 3DT6A 1AN9A 3I5UA 5KYYA 1V4BA 2IV7A 4RTJA 1E58A 2OCXA 5CR9A 5ICCA 1V9CA 4MPRA 1NQOA 2YX1A 1SXJD 1T36A 3GFRA 2R1TA 1YS6A 1TCUA