1FSKB

Complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
NIVLTQSPKSMSVSVGERVTLSCKASENVDTYVFWFQQKPDQSPKLLLYGPSNRYTGVPDRFTGSGSTTDFTLTISSVQAEDLADYHCGQSYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Dominant epitopes and allergic cross-reactivity: complex formation between a Fab fragment of a monoclonal murine IgG antibody and the major allergen from birch pollen Bet v 1.
pubmed rcsb
source organism Betula pendula
total genus 45
structure length 214
sequence length 214
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskB01
4NJ9L 1PLGH 4MZ3A 1K3ZA 1LE5A 1IC7L 4KV5E 5DZNA 1QBML 4HS3A 5GSVA 3RX8A 3DUUA 2NY3D 4F7PB 1AO7E 2AJSL 5I9QB 4TNVK 3B2UD 3M8OH 3TFKC 3RL1B 4EUPA 3JWNC 5F7NC 1NDGB 4K7PL 5IQ9A 4DZ8A 2H26B 5C0CD 3IXAA 4BUHA 1CFBA 4NHCL 4UTBL 3S7GA 3QDME 4RMVA 4PBWD 1D3CA 4PB9H 4XWGL 1B4JH 2A83A 4GKZA 1TTFA 3OKNB 3GSVA 3NFPA 1RULL 4WV1C 1YEDA 3VH8A 3UZQA 2FBJH 3LOWA 4ZDHB 2NMSA 1FLRL 2VDOH 5HYSA 4L4TA 2APVA 2CD0A 2ZSVA 4ODHL 1U95B 1UM4L 1PG7L 5F7KC 3RRQA 3KR3L 4PY7A 4PJCA 3L3OB 5DQDH 5KVFH 2BVPA 2CUIA 2N1KA 1GRWA 2R23B 1OP3K 5E9DA 3TYGH 2CDEB 4ZUUA 1I7RA 4CU7A 5I1CL 1MNUL 3RIAF 3QI9D 4XNMA 2QKIB 2RJMA 5J13C 2Z8WC 4Q9RL 4WU7B 4KXZI 5C0CE 1DVFC 4OV5B 1RUQL 3K74B 4I5BA 5C0BA 2IBZX 4LF3B 2EEBA 1VKXB 1BQUA 3BPNC 3U2SA 4LBEA 5MEPB 1NBZA 3CDCA 4I2XE 1V7NH 4N0CD 4OZHB 5EC2A 1GGCL 3GMQA 4KI5D 5I1HL 1VB9A 1VEOA 2X70B 2OTUB 1XCQB 3CFBA 4JFEA 4AENA 2QQNL 3DO7A 4QRPD 3VFGL 4GBXC 5L6YL 3GI8H 1WFUA 2EYRB 1NKRA 3QCUL 1KIQA 5K93A 2CLRB 1RUMH 1A9EB 5FUZL 3LD8C 1LEGB 1KJ3L 3I6GA 4CJ0A 2B20A 5KVDH 3LN4B 1S3KH 3OAYK 4EVNA 1IZJA 5DD1H 3CMOL 2R0ZL 3U0WH 1R0AL 1HHHA 3MNVB 4GG8B 2QHLA 3FQRB 5D7LB 3TBVB 4KI5E 3ALPA 2EIZB 2Q8BL 4TSBL 1MREL 1F11A 4LQFL 1KXQE 1NC2D 1MLCA 3QHFL 5F7FA 5HVGB 3I9GL 4M7JH 2A0LD 1U8PA 3EYSH 1NC4A 1KCVL 1X5HA 2QSCH 2X4QA 2Z93B 4Y19A 1ZVYA 1EDQA 1BBDH 1V3JA 4BFGA 2I07B 3NIDF 5DTFB 5JO5A 1N6UA 1GJIA 2ZUXA 5F72S 3S36X 1ZGLB 2AXHA 1A3QA 4HX1A 4ZG1A 5JZ7C 1IBGL 4NQCD 5C9KA 1I8IA 3OB8A 1TJHL 2DB8A 2YOCA 3PGCB 1VFAB 2V5MA 2A1WL 4HFWB 1ZGLP 1UWEL 1JV5B 4NRXA 4XPAL 1D9KA 1XZ0A 5DJAB 3BXNB 3ARTA 3GSUB 3SQBA 2VLRA 2NY4D 3VD9A 3QQ9D 1I8KA 5F1KC 1BX2B 1ODAA 3C60C 3D2UB 4X4ME 1YEKL 4JFQA 5D2LB 3BPOC 2AV1A 1K2DB 5D72H 2QTEA 1S7TA 1U8LA 2WINA 3KLSA 4OZFH 1IVLA 4RGND 3AMLA 1BAFH 2YKLL 4Y5YB 1F3JA 3SGKC 5D7JD 2HFFB 5BO1H 3VJ6B 4L3CB 2FHFA 5HYQA 4JKLA 2Z35B 4NQCE 1TZIB 4JG1H 5DMGD 3HZVB 4FQCH 4LPCA 3E2HC 4XBPA 5F7HA 1C16B 4G6KL 3TN0A 2NXYB 4MNQB 1DN2A 3P30L 3U30B 4J23A 2NXZD 4R97C 4NNPL 2IANB 1SEQH 3OV6A 3HAEG 1FZOB 5HDLA 4WDIA 1PKQA 4F33A 1HINH 2AXGA 1I1AD 3LKPA 3SDCB 1X9QA 5ISZD 3O3BB 1CFVH 2R0WL 1XGTA 1U8HB 1CDGA 2RR3A 4NP4H 4I3RL 3V5KA 3PWPB 1S5IL 1T1XB 3UYRH 1CGWA 4P3DA 4LPYA 5AYUL 1DQTA 1MHHA 4RGNE 1SJEA 1PVHA 1X4ZA 2QR0A 3P9LB 2VLKB 5FUOH 3WJLC 4PJIE 5F9AC 4UDUA 1UKSA 3FQWB 3OQ3B 3PABB 1MVUA 4P2OB 3N1MC 3RWIA 3QWQB 4LLUA 1T7XA 2R1WB 3CUPA 3TH4T 5IFAL 3RGVC 4CNIB 5C2UB 4POZD 3MACH 3VWJA 5JNYB 3LQAL 1P5UA 4X83A 2JJTA 3CVIH 3RHWK 3EO1A 5A2LH 5ISZE 2XTJC 3HMXA 1L9NA 2ITCB 2C4FU 1A14L 2YZ1A 5JA8B 3PGFH 3P0VL 5I0DA 3RL2A 4PJEB 4WWKA 5EFIB 4Y4KD 2P5WB 4NQEA 4GRWH 3LKRA 3P3YA 1EO8H 4QY8A 1JGEB 1N0LA 5F7DA 3FB6B 2EO1A 1W72B 3NH7L 4PJ7A 5SX5K 2D7PA 4JVWA 1I7ZA 3UCRA 4F7TA 5I8CA 1BVZA 5IMOA 5D2NE 5TDNB 4UOJA 4OIIH 5E8DH 3ES6A 2R8SH 1Q9LA 3C8KA 4JAMA 1Q8MA 3JWDL 4P3CH 3GSWA 5I18L 4PJBA 5CEYB 2C3VB 2IALA 1K8DB 3RTQA 2GJ6A 1CDHA 3QDGA 1U58A 3QFJB 4ONFL 3EDJA 5IBTL 4BQ6A 1UA6H 1IGML 4WTZG 3D3VB 3S3PA 5DUPL 2D2OA 4AIXA 5F70A 1R24A 3IYLW 1J1XH 2ICEA 3RKPA 5CZXC 4QRQA 5C07B 3DVIA 2AXFA 4K7FA 4OZIB 4KROD 4XZUB 4LHQB 3RWCB 3MCKA 1UFUA 2XQYK 4PTTB 1HZHL 1LEIB 2X4TA 4AYFA 1IAOB 1JPGA 3MLVL 1ZEAL 1C5BL 4PJHA 1NGYB 2VL5A 3BMWA 4OZGA 2AW2A 2PTUA 4XMKH 4EJ1C 5C0JB 4HT1L 3VXMB 4E0RA 4YHYC 5E2TH 3BISA 4RX4A 3UTPD 3BWUC 3UC0L 2B5IB 4Z7WF 4OLUH 4KZDH 4PGBA 5CD3B 2VIRB 1OTSC 4KVNH 3MLYL 3G5VB 3P77A 2OLDA 2DQGH 1K6QH 3T4YA 5CJOH 2FL5A 5GGVL 2F54B 1L7TL 1C1EL 2NW3A 3GI9H 1PG7X 3HKFA 4X6FA 3BQUA 4PUBL 4X4XA 3SKNB 2YPKA 3IDMB 2XN9B 5E08L 4KAQH 1DANT 4BSVA 3CSYB 1Q0YH 1U3HD 4H1LG 1BQLL 4D0DA 4JO4L 1D6EA 5DS8A 3FRUA 1HSBA 2FX7H 4GMSH 4J4PA 2BMKA 2J5LC 2D4DA 1MCWW 2ZUWA 3QIUB 3NVQA 1FYHB 2DM3A 2X9YA 5J57B 4M6ML 3NOIA 5EZLB 5A2JH 1ZT4A 3OKMA 5ALBH 4PIRF 3P0YH 1CGYA 4BZYA 5JIPA 5LVEA 1JGLL 2YWYA 3HG1D 3MRIB 4XXCA 1Z6JT 5DD6A 4FZ8L 4MMZC 1HH9A 2NX5B 2XZZA 2IQ9H 5FYJH 1G84A 1UCTA 2OMNA 3O9WB 3V6OE 1R3IH 5L8LB 1NBVH 4R4BB 4XP1L 3RWEB 3SDDB 4Z8FH 5HHNA 3FQNB 4QF1A 2EDOA 1OARH 3VXPA 4HKZB 4YDIL 4PFEA 1QEWB 1CCZA 3OAZH 3K2MC 5FV2A 1G9NC 1MJUH 2CO6B 4WW1B 1I9RH 5IEHB 4LK4A 4MJIA 1G7QB 3ULUC 4NT6B 1D9KC 4WUUA 3RA7H 3QPXL 1T89A 1AGDB 4TNWK 4CVUA 3HG1E 4PG2A 1OP5H 4J12A 4PJ5B 1HH6B 2C26A 1XGUA 4MCYB 5DMJB 2YN5A 2E27L 4FG6D 4KKLD 3O11A 4D8PB 1HYSC 4UTAH 3QIBA 3BP5B 4Z76B 4G8EB 3GJFK 3N1QC 2JELL 4JDVB 1QP1A 5IOPA 1A1MB 5JPNA 4R8WH 3EDKA 3D25B 5IMMB 2AK1H 3L3GB 3SJVB 5B3JE 2HJLA 5IM7B 3SQOL 4U33A 4OI7A 4L8DB 3TN0C 3KYKH 5BJTB 2V2XA 3MV7D 3ULUF 1HOCB 4F7CA 1YQ2A 1IAIM 3TNMA 2EDWA 1NJ9B 3MUGB 4Q9CA 2XYCA 2J8UA 2Y25A 4HXBH 2VMFA 3NACH 1UWGH 5GHWH 5IHZA 4JHAH 2VR9A 2OSLA 1AGBA 1KJ2L 2AXJA 4QRRD 4BQCA 1D5ZA 1K4DA 1WZ1L 2C3HA 3O2VH 5JOFA 1X5AA 5JQ6L 1SQ2N 1N7ML 1RHHB 2DBLH 3DSFH 3HI5H 1M7DA 5DMKA 1WCQA 1U8IA 3I50H 2PO6B 4XAKD 4PJFE 3ZMRA 1KG0A 4I3SL 2XA3A 2WZPD 4NQVA 4M1DH 1BBJB 3MV7E 4B0MM 2A74B 3P4NB 3TJEH 1CLOH 1OGTB 3VWJC 4ODUB 2R29H 2JJTC 3NCFB 4HHAB 4KKCC 3MRKB 3V5HA 2VQUA 4JR9L 3QO0A 1QBBA 4HKJA 4JY5H 1F5WA 2ARJQ 3SGDI 4H88L 4GRMB 3TPUA 4DEPC 4WWKC 4QRRE 4UU9B 5B21A 4X6CB 2O61A 2XA8L 3HUJE 3IDXL 3KXFB 4JLRB 3W39B 4GS7C 3DX7A 4XP5L 5HYFA 3NFNA 2OM5A 1ZHNB 3GMPB 4XAKE 2GFBA 2K3TA 3SY0B 3ARDB 3FT3B 3RNKB 5DDHB 1JUFA 1CK0H 1Q0XH 4L8BB 2DTSA 3TF7C 3QO1B 4OUOA 1QHPA 3RTQC 3SKUD 4G8IB 3FB5B 4GRLC 2OL3H 4NCC1 4P5TA 5BRZD 3MA9L 3FFCB 3U0TB 1J0JA 5IV2B 2FD6L 2L0DA 1FVDA 3WNMA 2VNCA 3BPCA 4L1DA 2R1XA 3UYPA 5A3IC 4DW2H 5DC9B 1MJ8L 3KPNB 4R96A 3BJ91 5DA0B 4A6YB 3GUTB 3RI5F 4PJ7F 4P46D 2X4OA 2Y07H 4KUZH 5DRWA 4DK6A 1YEFH 5K9JH 3ISWA 3AS1A 3GMRB 1JWMB 1FGVL 1R3HA 2AEPH 2ICWB 4PP2A 3W9DA 3QG7L 3NIGE 1EHLH 3Q0HA 4DKAA 3K1KC 5E2VH 4M5ZL 3VFWA 3U4BL 1FL3A 3MLUL 1UEYA 1MLBB 5IBUB 4JHWL 3K0WA 3QRGL 1X4YA 4QCIB 2V2WA 5GGRB 4NFCA 4G9FB 5C0AA 3O4LB 3MYJA 2ZUQB 3D0LB 2YC1B 2FGWL 3HC4H 4NJ9H 4DKFL 4NN5B 5T1LA 2XOTA 2DI7A 4NBZB 2GT9B 4W6YB 1IC7H 5DJZA 1QBMH 3BQUC 1P7QB 5F7WC 2CMRH 4WUKL 3TO4B 2VH5H 3OXRB 5B39A 1VACA 3WIHA 3WFHB 3B4NA 2AI0L 5B8CA 5DFVD 3GJFA 5DJ0B 3L3KB 2N7BA 4OI9A 3T08A 4CVXA 4PJHF 1H15B 1SVCP 3VFVB 4OZGF 4J4PC 4UTBH 4EDXA 2Q76B 1MFAH 1F6LL 2DKUA 3VXOA 4G8FA 2E9JA 4P99A 2Y5TB 2NY5H 1U91B 2NY1C 3B3IB 4NO0A 4WHTB 2FSEB 4MB3A 1Y6MR 4XXCC 1T2JA 3DTXB 3V5DA 5LWYH 4N5EC 3UX9B 3HE6B 5ANMA 3L5XH 5CP7B 4GG6A 2A77H 3BD3A 2BXYA 2WV3A 1DCLA 2RCSL 1NAMA 5JW3L 3X3FL 4LIQH 2HJFA 4IRSA 3OSKA 4HWUA 3GMNA 3STLA 3IRZA 5E0QA 2HFTA 2A73A 5FYLL 1BQHG 4JPWL 5HDBE 5I1EH 3L5WA 4LHUB 4FN0A 3O6KL 4H8WL 3S34L 4LRNH 4MNGB 4LLYA 2UV3A 1T89C 5D9SA 2HYMA 1PX3A 3SPVA 4PG2C 4DAGL 1I7TA 4MA3B 1ZOXA 2X44D 1EO7A 4HWZB 3TCLB 5CEXA 3QZWB 1NGXB 4ZUTB 2RB8A 2IH3A 4LP5A 1W0WA 3C87A 3VD5A 1GIGH 1FV1A 4MAYD 4PJGB 3VFTB 3QIBC 4MNHA 1DEDA 1G6RB 4ONHA 1U93A 3U4EA 3HI1B 3MV8D 4CU8A 3O6ML 4ZPTA 3ZKXC 1FJ1A 3ZTJG 4MGXA 3VFNB 2BSRB 4QTHA 3TIEA 4DGVH 5INDB 1EERB 3V7AE 5F3HB 3FKUS 4R4ND 4YPGA 1QNZH 3KWWB 4JZOA 15C8H 5J12C 2Z9TA 5SWSD 5BQ7B 4EQ3A 2IF7A 3ECBB 5DUBB 1MPAL 3DVNB 3IFLL 3ARGD 1L6XA 4E41B 1BVKA 2Q8BH 1HILA 5KS9A 1J0KA 1EMTL 1AXSB 3QHFH 5KVEL 4RMRA 3VXTA 5E99L 3DUSB 3EYUL 3HS0B 2DQHH 1QFUH 3VXRA 3MV8E 3PWNA 1KCVH 4O2EB 3DX6B 4WCYH 2HP4A 1UXWA 4OM0H 2UYLB 1XF5A 3LB6D 5I1IL 1KENL 3FO0H 3B2VH 4KJQD 4WNQB 2BNQB 2QQKH 1HN1A 1PW3A 2F58L 2Y23A 3C2SA 3I75A 2DI9A 5SWSE 1KXTB 1BM3L 3PL6D 5DLML 2ED8A 3EYOB 1IMHC 3NBNA 3BKJH 4XNXH 3ILQC 2DIJA 2G2RA 1R5WA 3LS4H 4EN3D 2YPLB 5FO7B 4JFOB 5CSZA 2JCCE 4YR6A 4UZGA 5FCUL 3FQXA 2AJZA 2D03L 1FZKB 2ZG2A 4WGWB 4AMKH 4KMLB 5DJ8B 3LEYH 1ZLWK 1FGNL 3WO4C 2ERJC 1UB6B 1HIMH 4GMTL 1CDUA 4GT7A 1OQOA 4PY8I 4IRJD 3VGEA 4F7PA 4YUEL 2AJXL 4KK8C 2B2XL 3O2DH 2YUXA 4P5TC 2EEDA 4YZFE 3RL1A 2FLRT 3ZDYF 4OQTL 4Z78B 1NDGA 2H26A 4U1MB 3P30H 4DN3L 4PREB 1OTTD 2GYSA 5GS1B 2NTSP 1KCUL 5E24E 4K23L 4RMWA 2VISB 3ROLB 3WFZA 5IW1B 1RUAL 2FLBT 1FFOB 3OKNA 2R0WH 3FAXA 1X5IA 4ZDHA 3TFKD 4BZ1H 4OLYH 2VDNH 4Y4HB 4L29B 1ZLUK 3DO3A 1U95A 1JWSB 5K9QG 3GZKA 4JKPH 4CDGC 4GW1B 4UIKH 4TVPD 3L3OA 3UZVB 4IRZL 4R26L 2R23A 1XR8B 3QEHB 5JMRA 2CDEA 4LLWB 3ULUL 4RGOH 3BSZH 3W0WD 3O0RH 1CGSL 4P59H 2QKIA 5E00B 3CLFL 2EKSB 2VO5A 4K9EH 4WU7A 4OV5A 3CFCL 2VERN 3HC0B 1TMCB 1KCLA 2D4FA 2VLJD 4LF3A 3H7BB 4GXVL 1VKXA 4YHOH 3MZGB 4NUGH 1NSNH 2OZ4L 1OSZB 3F7QA 5ALCL 4GAFB 5MEPA 2C3WA 4XP6L 1ES0B 4YQXL 4CBPA 2IEPA 1ND0B 4OZHA 5B8CC 4KKNA 1FL6B 4XCCH 3LPFA 4N8VB 3RJDA 1DVFD 3GMLB 3SE4A 2X70A 2OTUA 1WZMA 2ZUTA 2IAMB 3MLRL 4TVPE 4Y16B 5F6HJ 1CLCA 2YWZA 5D1QB 2EYRA 4XRCB 3W0WE 2DIBA 4GUPB 2R56L 4ZNEE 2WP3T 2CLRA 4WFFD 1RK1B 1DDHB 5DK3A 1A9EA 2W38A 1LEGA 1J5OL 4XCYB 4YEEA 2VLJE 1T7WA 3SDXE 1B9ZA 3BZEB 3B5TA 4NNYB 4K94H 4Q9QH 3LN4A 4GBXD 2OJEB 3RWGB 3EOAB 1M6OB 1IM9B 2ARJB 4IRSC 5DUPH 1D6VL 4GLRH 3NA9H 3MNVA 4GG8A 3A6CL 3FQRA 2BJMH 5D7LA 3TBVA 4KKBD 2EIZA 1I1YB 1JK8B 3QCVL 4IIQB 2KQMA 4G8GB 4EXPX 4PP1D 1W0VB 4OLXH 3DOSA 5GGQL 3MSPA 4DWHA 5E8OB 1FRGL 1ZK9A 3CFDB 4NHUB 4WFFE 2Z93A 5JHLL 5IMKB 5CCKL 2I07A 5DTFA 2H2PC 1RV6X 5DWUH 1ZGLA 3PF2A 1PAMA 1FCGA 3T0EB 5GGUB 3KNBB 2UUDH 3PGCA 1VFAA 1T1ZB 4M48H 4HFWA 4Z7NE 4S1RH 1JV5A 5F6IB 5K33A 2X4PB 5DJAA 1QBLH 2JIXD 4JZJB 1EAJA 3BXNA 3GIVB 3PV7A 1NEZG 3CC5B 3GSUA 4YHMH 5JZ7D 3MLSL 5CUSL 4APQD 1BX2A 1GH7A 3D2UA 5MERB 5D2LA 1LP9E 1K2DA 2B8OT 4C56B 4N1CA 4XB8A 3T4AB 2IFGA 4Y5YA 2W0KA 2YD7A 1I3VA 2HFFA 3VJ6A 4M6MH 4L3CA 2A6IB 4OIBA 3VU2A 2Z35A 2ZJSH 3ZE1F 2ADJB 2W07A 3DI3B 1BQSA 4LARH 5E4EC 4XWOC 3HZVA 5H8DA 5M95B 2G60L 2VN4A 2Y72A 3C60D 1Z0NA 1UVQB 4ZAKB 4MD0B 1C16A 4JFDD 4MNQA 4Z7UB 2VR4A 4Y5XB 4PRPD 1KULA 2B1AH 2IANA 1MAJA 4LLMB 4ZFOB 1FZOA 5GRYA 1G6VK 3SDCA 4M43L 3O3BA 3EDEA 2HTKC 5F8RC 1U8HA 1YMMB 1QKZH 2FO4B 1MCQA 4KDWA 2PXYB 5ADOL 3PWPA 1T1XA 4WTXA 3TGXA 3E8UL 1OAQL 5IQ7L 2H3NB 3P9WB 4KTDL 1OW0A 4M5YL 4OSUH 3P9LA 2VLKA 3U83A 4XPGH 4OKVB 4ELMB 3FQWA 5FDWB 5KS9F 3PABA 3DV4B 1ZWIB 3CDFA 4P2OA 4JFDE 2R1WA 4Y89A 4GRWB 4Z5RB 4CNIA 4LGPB 1T3FB 4U4BA 3TT1L 4PRPE 3QUMH 5JNYA 4ZD3L 2APTA 5FYLD 6FABL 1BJMA 2XQBL 3O3UN 2ITCA 5C0RH 1A6UH 3MRBB 2ZNXA 4D9LL 1DJSA 4PJEA 5I9QC 4ONGL 5EFIA 2P5WA 5CGYC 3RGVD 5FOBB 1JGEA 4PRAB 4TSAH 5IW3A 3FB6A 1W72A 4QNPF 3W5MA 2VXQL 2F8OA 2DQIL 4FTVB 2I25N 1GHFL 4HSQA 5TDNA 1E4WH 2XTJD 4U7MA 3DHJA 2DDQH 5GGVY 2C1PB 1PKOA 3VFSB 4G6MH 3GRWA 5CEYA 2C3VA 1BJ1J 2ATKB 1K8DA 4HUKB 1VGKB 5DR5L 2MNUA 2V17L 3AM8A 1N7MH 3QFJA 5FA4B 5FYLE 1INDH 2H2SC 5D6DA 3QSKB 1MFEH 3T2PA 2F9BT 4I3SH 5C07A 1ORSB 1A9BB 3V8CA 4OZIA 4XZUA 2QBWA 1IGJB 4L4TD 3RWCA 4PTTA 3K8MA 1LEIA 1IAOA 4CAGA 2XTJE 3CCHB 2A38A 1CL7L 2GAZB 3R4DA 1NGYA 5E9DD 5IGXL 4C57C 5C0JA 3VXMA 4IBLT 1NCAL 5DEZA 5CZXD 3RAJH 3THMH 3INUH 3HLAB 3KLDA 4ERSL 5DRZB 3SE4C 2KH2B 4XP5H 5C0BD 5CD3A 1UH3A 3G5VA 3OMZA 1IT9H 3KDMB 1JF6A 4RWYH 1UJ3B 2F54A 3B9KB 1OM3H 2YUZA 3B9AA 3MREB 4L4TE 2HG5B 3SKNA 3MTRA 4JO2L 4QXUH 3IDMA 1GZQB 2XN9A 4M1GL 2D9QB 4JFED 3CSYA 3C6LB 4PJCE 4M00A 4CN4A 2ZP0T 5E9DE 4WWID 2B4CC 3O6FD 2E7BA 4KJWD 1CZ8L 3QIUA 5J8OA 4I77H 5FFLA 5BXFB 2R0KL 5EZLA 3R0NA 3U7YH 3V6BR 5C0NC 1MAML 3MRIA 4PLNC 3T0AA 2NX5A 5EZIL 1B0WA 3O9WA 1EGJL 4R4BA 4BSJA 3RWEA 3SDDA 4Z7OF 1RY7B 4PBXA 5BMFH 5DD5L 2VAJA 3FQNA 3QG7H 4FQJL 1QA9B 5D71L 4HKZA 1II4E 1QEWA 5E2WL 5IB3B 3MV9B 3LQZB 3LZFH 4ZUSB 3O4OB 4LSPL 3Q6GL 5D6CB 4WW1A 4AEEA 1NC4D 3GNMH 2HKHL 1Q1JH 5IEHA 2HJKB 1PFCA 4Y19D 2LU3A 4NT6A 4OTXL 1YPZB 1AGDA 5SX4H 4PJ5A 2EDFA 3SEPA 1L9MA 1HH6A 4NO3B 3SCMB 2WIIB 5J4MA 4MCYA 4FFVC 5TGBB 5IJVB 4XH2B 4D8PA 4BFIB 2XI9A 5DURD 1T1YB 3F7VB 3BE1L 3IETB 3GO1L 3BP5A 1V3MA 1D9KD 1I9EA 4G8EA 4OD3H 4Z76A 4Y5YC 2DLFL 5E5RB 3WNPA 4JDVA 1A1MA 2DQTH 1FFPB 3D25A 4BUGA 5IMMA 4JQXA 2VLRD 1JF1B 3L3GA 4NN7B 3SJVA 5MP6L 1C5CH 4PG9B 1XFPA 5IM7A 1I4FB 4HG4K 3T0XA 1A7NL 3DHMA 4L8DA 4TPRL 5E6ID 2NXYC 1HYSD 4Y19E 5E8EB 2YPVL 5BJTA 3U30C 1HOCA 4NZUH 4I0CC 4WI4A 1NJ9A 3MUGA 1ACYL 3SDCC 2AVGA 4WEBH 4UOW1 4UT6L 5D2LF 4TSCL 2IBGA 3TN0D 2WP3O 3CZFB 3FN0H 1OW0C 4H8WH 1XGQB 2AKRB 3S34H 1ZXQA 1S7SB 1CE1L 1RHHA 3OZ9L 3OL2A 4S1SL 2PO6A 5B38B 1QYGH 3WS6A 4DAGH 4URTB 4P2OC 2V7HB 3V8OA 1JPSL 3GMOB 2E5EA 3D9AH 1BBJA 4OCRL 2A74A 3P4NA 1OGTA 4M1CC 4ODUA 2R39A 5ACLA 1DBKH 5ITBH 3NCEB 4HHAA 1T6WA 1RHFA 3MRKA 2C1OB 4UV4L 3ARUA 5EZOL 5F88B 5DSCB 1NQBA 4GRMA 4UU9A 4X6CA 4XNZB 3RBGA 1LWRA 1QZ1A 3KXFA 3R8QA 4JLRA 3W39A 2GSGB 2EC9T 3VW3H 1RPQA 5TDOB 2OL3B 2X5PA 1ZHNA 4MQSB 3ZT5A 1PKQE 3GMPA 2CH8A 4PJDB 4KKCD 5CP3H 3SY0A 1AP2B 4GAJH 2C3XA 3ARDA 3FT3A 3RNKA 2ICWJ 5DDHA 4HULB 1MPAH 1MF2L 4OCWL 1YYLL 3IFLH 4WWKD 2VYRE 4W6WB 1AKJB 4L8BA 5CILL 4F58L 4NQED 5DJCB 1QPXA 3QO1A 4LSRH 5KZCD 1KACB 1NFDE 4G8IA 3FB5A 3M1BB 3AM8C 4RIRB 5EU5B 4DN4H 3FFCA 5D6DC 1N6QH 3U0TA 5IV2A 3PV6B 3MRCA 1MCWM 3AU1B 4K3HA 4PJEF 1CFTB 1E28B 3BKYL 1KENH 3KPNA 2QQLH 4LSSL 4U6VH 4A6YA 3RTQD 3GUTA 1P4BH 4X7SL 4KK6C 4TN9A 2GJ6D 3QDGD 3OPZL 4EI5B 3MO1B 3QUXB 2BSED 1C5DB 1YNKH 2X4SB 4Y7MA 3GMRA 1JWMA 3AB0B 2ICWA 5IB4B 4RFOH 1KIPB 4HG4J 3HAEH 4NQEE 2Y6SC 5A3ID 3NABH 2FX8L 1MLBA 2B5IC 2FH8A 4QCIA 1CBVL 5FCUH 5GGRA 2P4AB 3V4PL 1D5MB 3H9SB 4G9FA 3O4LA 3D0LA 2NLJB 4AIOA 2YC1A 1ETZB 5GGTA 4PJBE 2GT9A 2VDPH 2RFXB 4GMTH 1P7QA 4RX4D 3TO4A 1I9JL 2GJ6E 3OXRA 3QDGE 1JTTA 5EU6B 5F1IB 3BWAB 3WFHA 1AC0A 4QO1A 5DJ0A 3L3KA 3T0BA 1F4WH 2I26N 4JN1H 3MC0A 1N0XH 4OQTH 3WFCL 3NN8B 3LHPH 1H15A 2APXA 2HT2C 4LSUL 4YDKL 4JQIL 3RKDC 3VFVA 4TUKL 1EPFA 3T3PF 2CRZA 2Q76A 3QEQB 3QIUC 1M1SA 1ADQH 1KCUH 5D5MB 2FATL 2Y5TA 3BQUD 5HPMB 1U91A 3B3IA 4WHTA 1Q9WB 1RUAH 2FSEA 1LNUB 5C2BH 3DTXA 1TJIL 4PJHE 2V9RA 3HE6A 2FEEL 3O9WC 5CP7A 3SDDC 5TQ2H 4J4PD 1FE8L 4MS8C 2FIKB 4X7EC 3FOLB 2JJSA 4QGYA 2NY1D 3DETC 3WUWB 3GHBL 1DEEB 3ME0A 4Z77B 2EH8H 1JZ4A 2CJUH 1UQSB 1UYWL 3VXSB 2Q3ZA 3CLFH 1U8JB 2UZYB 4N5ED 1C7TA 4X80H 4J3OC 3T04D 1PSKL 1QRNE 3AY4A 5DF0A 5FUCC 2DQCL 4NKQB 1LDPL 4MNGA 2APBA 1AGFB 4G9DB 2VXVH 3HE7B 2MPAH 4MA3A 3MRMB 4HWZA 3TCLA 4YQXH 4KUCD 4PB0H 1BWMA 3G6JB 3V0AC 3QZWA 1NGXA 1JHLL 4ZUTA 4Z95L 3DVGB 1Z9OA 4MJID 3WCYA 3VD7A 1YEGH 3DIFB 4PJGA 3S35H 1CU4L 3VFTA 3C09B 2VUOA 4YXKH 2AJUL 1G6RA 1CF8H 1IARB 3SE8H 3SKOB 3HI1A 2R56H 4JQXC 3B6SB 4J8RB 2B0SL 4HIXL 2F19H 3VFNA 2BSRA 1JRHI 5INDA 4XHJC 2EDDA 4LAQL 4NPYB 5F3HA 3D5OF 1IAIH 2E8YA 5MI0B 3QIBD 3KWWA 2BX5A 4U6HB 2QEJA 5BQ7A 1D5BB 4YHLL 4RMUA 3ECBA 5DUBA 5IW6B 5ID0B 4NOFA 4YFDB 4J2XA 3MCLH 5I8KH 3DVNA 3WHE0 5KAQG 4GQ9H 4E41A 4OM1L 4MJIE 5HGHB 1AXSA 2VJXA 5JDSB 5A16B 1UXSB 3DUSA 2X09A 3UAJC 4MXWL 3HS0A 1JNLH 1P84K 3CH1B 43CAB 3PDDA 3S96B 4O2EA 5F44A 3DX6A 1RURH 2PO6C 2ICWI 3WS6C 1X6NA 2UYLA 5CCKH 2H9GB 5TJWK 25C8L 3H0TB 1ZTXL 4QHLB 4WNQA 2BNQA 2JLLA 3T1WA 4CUCA 5FGCE 3DROB 1YA5A 1JYWA 4HWBA 1GGIL 4XPFL 3ZTNH 1E6OH 3FB7B 5IVZB 3EYOA 3Q5YA 1YNLH 4C83B 1KB9K 1U8OB 3IU4H 1NGPH 1FNHA 2YPLA 3ROOB 5FO7A 1H3WM 3NZHH 4JFOA 1L7IL 4RRPG 4XVTH 1JNNH 1NCTA 5SWZB 4N0YL 1VCAA 4G43B 1FZKA 2J8UE 1D5XB 1FQ9C 4GQPH 5DJ8A 3X3GL 3ARDC 2ADFH 3ILQD 4PS4L 1UB6A 4UDTB 1KB5H 2VXUH 3MLWL 4JY6B 3ULVC 5EUKB 1A6AB 1F58L 3BDYL 2ATPB 2G60H 1ERNA 2QV2A 3BT2L 2Z92B 4Z78A 1PEWA 4U1MA 4PRIB 1OT1A 3ZZ1A 4PREA 2LABA 5GS1A 4ODSH 3QULB 1RJCA 2VISA 3ROLA 1AD0B 5IW1A 3A6BL 1FFOA 2Y06H 3GM8A 3MMEB 1KBGH 3JSSA 4U3HA 3ZDYE 4P5TD 3ZE2E 3E8UH 1Y0LB 2LE9A 3CFEB 1OAQH 1BF8A 4Y4HA 4L29A 4KTDH 3K81A 1JWSA 1QSEB 2PW1B 1UEMA 4P23B 5JW4N 2IWGA 3EKCA 4GW1A 1J0HA 5HI3C 1YJDL 4R7NB 3ULVF 3V4VH 1QFWM 3QEHA 1LO2H 4LLWA 5HD8C 3T8XB 1B4RA 2LTQB 1RK0B 5E00A 1HK6A 2EKSA 2ZUQC 3G5XB 3HC0A 2IFFL 4NN5C 1NMCB 3H7BA 4PJ8B 2NY7H 2ZCKL 1UWXK 2XQBH 3TO4C 5L8KB 1OSZA 3NCJL 4B7IA 2OP4L 1ES0A 1NFKA 1MAKA 2Q8AH 2IG2H 1ND0A 1P84J 4ONGH 5C0AD 1WUNT 1FL6A 4M6OL 1PZ5B 4LSTH 4N8VA 3MOBL 1QLFB 3GMLA 3Q48A 4XNUL 5E8NB 2N4IA 2KL6A 3G6DH 5F9WB 5E6YA 2IAMA 4JFPB 4UILL 4Y16A 2VXQH 5T1LD 2DQIH 1WIPA 1GHFH 5D1QA 4XRCA 2D9CA 4CVWA 3GB7B 4GUPA 5FHAL 1RK1A 1DDHA 1OAUH 2CDGB 4ORZC 5FKAB 3BGMB 3HE6C 4XCYA 1R5IB 1KB9J 4XMPH 1OAXL 1G7MB 3BZEA 1CLYH 4NNYA 3H3BC 2OJEA 2JJSC 3RWGA 2FHBA 3EOAA 3N06B 1M6OA 1IM9A 2ARJA 4NO0D 3MROB 4YHPB 5C0AE 1RZKC 4G7YL 1I1YA 2DYPB 5GS0L 5IIEB 4UT7L 1JL8A 1VADB 3K8LA 1JK8A 3AY4C 5GRWA 4IIQA 1E4KA 4G8GA 4AM0B 4HDIB 2W9EH 2O93L 5DD3L 3WN5B 1E6JH 1W0VA 1FFQA 4RGMB 4RSVA 3L3JB 5E8OA 4IRSD 2D3VA 3CFDA 1GPOH 4NHUA 2DQJL 5IMKA 3KYNB 3OG6B 4YHKH 3O81A 1KTLB 1JN6B 1DFBH 2VLMD 4MAUL 4N8CL 1S8DB 4DFIA 2J6EH 4NZDA 1DQLH 1A7OL 4K3EH 3WS3B 2XQYG 5HHVL 3T0EA 5ETUB 2GCYB 5GGUA 4DTGL 3KNBA 4FFZH 3P4OB 1T1ZA 4S11A 4JJHA 1EJOH 4YO0B 4LSQH 1W72L 2EDTA 1WCBB 2X4PA 5ANME 3HZYB 4JZJA 3V4UL 4GG6E 3GIVA 1NFIB 4JO2H 4XPTL 3CC5A 4M1GH 2MHAB 2OMBA 2VOTA 1JPST 3UDWA 4OUUB 5MERA 2UY7A 3N85H 2EH7H 4C56A 5SV4A 1SHMA 5EO9B 5B4MC 3T0WA 2VLME 3T4AA 1V8HA 4PLOB 1XGYL 3DMMB 4XPBH 2R0KH 4UIMB 2A6IA 3O6LL 4Z7VB 4DOHB 2ADJA 5C0DB 1MAMH 4PYGA 4PRHD 4PJGF 3V0WH 1PGRB 4ZAKA 5EZIH 1P7HL 4MD0A 2YD2A 2ZSWB 4AL8H 1TXKA 1WICA 4KPHL 1UM5L 4Z7UA 1RI8A 2YHGA 4HBCH 1KN4L 4Y5XA 5E1AB 1TTUA 4LLMA 4ZFOA 3F58L 2XRAH 4XWOD 4NSKB 4F8TA 1YMMA 1YECL 2PXYA 2GKIA 4LSPH 4DUXA 3VXRD 1RFDH 2H3NA 2W65B 3LSOB 1I3GL 4JRWA 2OR8A 4P2QD 5GXBB 4OFIA 4OKVA 4ELMA 5KSUB 5FDWA 4PRHE 1BOGB 1YDPB 2HTKD 3DV4A 1MFCH 1ZWIA 2QADB 4W6XB 2ADIB 3E3QC 4Z5RA 1Q94B 1T3FA 4XC3L 1DBAL 5I0ZA 2O5XH 4MQXC 5E95B 3QUYB 3IFNL 4K71B 5EOCL 5FM8A 4HJ0D 1CFQB 2AERT 1JTOA 3EFDL 3MRBA 1N5YL 3VXRE 1FC1A 1QSVA 1XGRB 3K2UL 1FAIH 2DKSA 5FOBA 2Q1EA 4HUUB 4PRAA 1T0MB 4P2QE 4AEIH 3AREC 4P2RB 5GS1C 4FTVA 4NWUH 1OVZA 4OCYL 5EBLB 3JZ7A 2C1PA 2EIEA 4ZFGL 3ZTJH 4LEXH 3VFSA 2W59A 5CGYD 5CEZD 5L88L 2ATKA 4Y4HC 3BW9B 3VFUB 1VGKA 3OKDB 4QHUA 4YXHH 5J89A 1CE1H 4LCWB 5FA4A 3HC3L 3VFOB 2H1PL 1H8OA 4MZ2A 4KRPB 4L4JA 4U3XA 3T3MF 3VFPB 4K2UL 4NZRL 5IEKB 1ORSA 1A9BA 4Y5VB 1JPSH 1G0DA 1IGJA 2AEWA 5AUMB 2EDEA 1ZA6A 5DMIH 3S5LG 2H2SD 4WW2F 3CCHA 1A7RH 2GAZA 1KYOK 1WWAX 4X7TB 2DJ4A 5TF1L 1X5YA 2VDML 5CEZE 5D1ZB 3SGEH 4HK3J 1TQBB 4Y2OA 3HLAA 5CZVH 1CLZH 4UB0L 5DRZA 4W4NA 4BZ2H 1MRCH 3VDBA 3ETBF 2IAMC 1EO5A 4Y16C 1IAKB 5L7XL 3U0PB 5D1QC 5JMOC 3KDMA 1UJ3A 1KNOB 4HKBB 3B9KA 3MREA 3CU7A 2HG5A 4OBRA 2W9DH 1GZQA 5HVHB 3C6LA 4FP8H 2E7MA 2FX9H 4IDJL 3LRGA 5KVGL 1U0QA 1VA9A 1FZJB 1YEIH 1WK0A 4TRPH 3RU8H 4OGAC 3MJ9L 4XP9L 1HHGB 3P0GB 5BXFA 3NFSH 3BKYH 5JOPD 3DV6B 1NCWL 4LSSH 1DBJL 4IIQC 4X7SH 1E4KC 4L8CB 3ARPA 5JPMB 1ZLSH 4OCXL 4AG4H 2JJWA 4NM4H 1MCPL 1LDSA 3KYOB 2NTFB 2X7LB 4FXKB 1OCWH 4N0FB 4OZHE 5D7LD 1QA9A 2E9WA 1ZANL 1E4XH 4JO3L 1NUFA 1XIWB 5C0ND 4HS6B 2OJZH 4OF7A 5IB3A 3MV9A 3T0EC 3LQZA 4ZUSA 4F80A 1AXTL 5D6CA 2PNDA 3MLPA 5DVMA 5I66B 4YPJA 1HHIB 2HJKA 5KSAB 5F6IC 2WBKA 5GIRB 1YPZA 5JOPE 3TV3H 4JZJC 4P9HC 4PRBB 3KHOA 4P5MB 1I9JH 4NO3A 3SCMA 2WIIA 3LKSB 3UDWC 2EECA 1U3JA 1F3DH 5F9DC 5TGBA 5IJVA 4XH2A 3NCYS 4BFIA 3SDAB 3ULVL 1T1YA 4XVSH 3WFCH 3BAEH 2Z31B 3RY6A 3F7VA 2X10A 5D7LE 3IETA 2V2TB 4BM7A 1P4IH 1OSPL 4O58H 3MOAL 3BIKB 2CRIA 1FFPA 1INQB 3EAKA 2V7NB 5I8EB 1L6ZA 1JF1A 1FPTH 4FFVD 4M7LL 4PG9A 5D93B 1I4FA 3D2UD 4ZAKC 2HFGL 4OCSL 1KYOJ 3OKKB 5E8EA 4Y5XC 4F8QA 1UACL 2NCMA 2C4FT 1NMAH 1AD9B 1VDGA 4IJ3B 4WY7L 1H5BB 3Q1SL 1OGAD 1TZGH 2YZ8A 1A02N 1N3NB 2PXYC 1HQ4B 4YX2L 3BFOA 5IBLC 4MNQD 3CZFA 2B1HH 5FM5M 1XGQA 2AKRA 4LSVH 2EXYC 1S7SA 2VZ1A 4LMQI 2IAND 2DM4A 4KHXL 5BVPH 2D7OA 5B38A 3SDCD 1RZ8B 1FH5H 5D2LE 1QLEL 2V9QA 2V7HA 3PWPD 1OAYH 3GMOA 1H3UA 4OGYL 5GGSB 4Z7UF 1G0XA 2VLKD 2HRLA 1PZUB 5IWLA 4OCNC 5EUOB 4FQQB 2J4WH 4Z7WB 1OGAE 1YZZA 2VZVA 2C1OA 4DJMA 3C08L 5F88A 4GJTB 1Z9MA 5DSCA 3ZHKA 4P2OD 4MA8H 4GW5A 4LVHB 3ARVA 4I48B 4M6NH 5I1JL 2LQRA 4XC1H 4MXVE 3HNSH 4LLAA 4M1CD 2GSGA 2IANE 5F7MC 1BVLB 2OL3A 1M71B 3QG6B 5TDOA 4NN6B 3CVHH 1UZ6E 4PJDA 5F1OB 1WC7B 5E56A 1AP2A 4TUJB 1EBAA 3PWPE 1BJ8A 5L8JB 3LKOB 1AKJA 1OF2B 2P5WD 4GRWF 4LLVB 5DJCA 4XCEB 1RVFL 2VLKE 2VE6B 4HGWB 1RZKL 3M1BA 5ESVB 4RIRA 1CFSB 5EU5A 3L7FB 1KPRB 1X5GA 3RWHB 3PV6A 2ZCLH 2BVEA 2W91A 5IB1B 3AU1A 4KDTA 1JPTL 1UKTA 4DVRL 3EJZC 1KUMA 1CFTA 3BVNB 3QPQD 1E28A 3T2NH 4P3WA 3JV0A 3ZSTA 4EZMA 4JDTL 5F7LB 3QFJD 4EI5A 4R90L 3RVXC 1RQ5A 3MO1A 3QUXA 2X4SA 4UOW0 5ERWB 5TE7H 3G9VA 1I8MB 5IB4A 5F97E 3WIIL 5J9PB 3RWDB 2HVKA 2P5WE 1KIPA 5DUMH 3MGOB 4IS6B 1CDCA 5FHBH 1FZMB 3GSNH 4KK6D 5FDYA 2FZ3B 1D5MA 3H9SA 5IT2L 4TVPH 4MA7L 3GSRB 3X17A 3QJHB 1MVFA 2NLJA 1RIVL 1UJ3C 1ETZA 2XKNB 4LOUC 3B9KC 4PS4H 1Z5LB 4K07A 3VXMD 1YEHH 2AV7B 2RFXA 3L1OH 2YN3A 5C0IB 3RDTB 2AEQH 5EU6A 5F1IA 1FDLH 3BWAA 3QFJE 1RZJL 3C6LC 1A6WH 3BT2H 5HYEA 5LCVL 4PGCB 4ZO7A 2Y9RT 1DUYB 3NN8A 4F37F 3BP7B 1S9XB 1NCDL 3LH2L 2F5BL 1YC7A 1EV2E 3QEQA 4OZIE 3OR7B 5D5MA 4FFWD 4RISL 3CK0L 5HPMA 4NC1C 1Q9WA 4G6AC 2XN9D 3V52H 4RFEB 1LNUA 4JY4B 1F4YH 4YXLL 5C6TH 2WK2A 3RKDD 2HT2D 3VXME 3WFEH 5EC1B 2FIKA 3FOLA 3GJEB 3QIUD 3PGDB 5T5FH 4H0GA 1PY4A 1PLGL 1FHGA 3WUWA 1DEEA 4YK4B 4Z77A 3FAWA 5GJSL 5F89B 3VXSA 1UQSA 3BZDA 2NX5D 2ZG3A 4PJAE 1U8JA 2HH0H 4UV7H 3O9WD 5KG9B 5K9KB 3SDDD 1MFDL 2IFFH 4MS8D 3M8OL 4KI1A 1AGFA 4G9DA 4BQ9A 1XMWA 1J88A 2XN9E 3WEXB 2P43B 3HE7A 3EYQC 3DETD 3KG5A 3NCJH 4NQCB 3MRMA 5HGGS 3MLXH 4PB9L 1B4JL 3VE0B 2Z8RA 1H8SA 3G6JA 3H3PL 3DXAB 3DVGA 3RY6C 1FG2B 1C7SA 3DIFA 2P49B 5HYJB 4QGTA 3TIDB 2VDOL 3SKOA 4PJ5D 3B6SA 4J8RA 2NX5E 4NN7C 5K59E 1JYVA 3CXDH 5KVFL 1GC1C 3E0GA 3IKKA 3TYGL 3NIFE 2HVJB 4NPYA 1T20B 2CIIB 5EG6C 5D7JB 3PP3H 4C55A 4H1LB 5TFSH 4F9LA 3PDOB 3WSQH 1D5IH 4U6HA 1MJ7H 4NDMB 2VDLH 1D5BA 4OT1H 1FNEB 3UPRB 1ZGLM 3KAAA 3I2CH 2DF3A 5IW6A 5ID0A 5TF0A 3SJVD 3FO1B 3KYMB 3ZHDA 5I15H 1A6VL 4NJAL 5FUCE 5HGHA 3HNTH 4XHJD 5JDSA 1FL5B 1UXSA 1V7NL 4G6JH 4KGLA 3BRDA 3WFDH 1N2RB 3CH1A 3UTTB 43CAA 4PJ5E 4R2GB 1V5JA 4I8DA 3GK8H 3GI8L 2H9GA 1MY7A 3JTSA 4MAUH 1U8QB 2O5YH 3H0TA 4QHLA 5EB9A 3UTQB 1KEGH 4NBYB 1VENA 1A7OH 3PHSA 3KLAB 4M7KH 3UAJD 1CTNA 3DROA 5IWLC 2BY1A 5KVDL 1LILA 3FB7A 4HFUH 4HV8B 5IVZA 2PO6D 5BV7H 4TULH 3SJVE 1H3PH 2CKBL 3TT3H 4C83A 2YBRB 4GRLB 1U8OA 2IJ0C 1ACZA 1S3KL 2VKWA 3ROOA 5DD1L 2DL9A 4XNZC 3U0WL 5SWZA 5TH2B 3KPMB 4B5EA 5EO0B 1ZHLB 1DN0B 3ZKSD 3UTSB 2G5RA 3VWKB 4G43A 1D5XA 3FL7A 2HWZH 4M7JL 4UDTA 4ENEC 3EYSL 3IVKB 1XGPB 4JY6A 2QSCL 3ZL4H 1F4XH 2CLVB 5EUKA 1A6AA 1JGUH 3KXFD 1BBDL 4HZLB 2ATPA 1GGBH 2Z92A 2WWKT 4FQ2H 2XZAH 3IU3B 1RU9L 1T04B 1IAMA 4KWUA 5KBNC 5KSVB 3ARDD 4PRIA 1TETH 3FJTA 4Q74A 3MJ8B 1QPPA 3F58H 3QULA 1ZLVH 1T0PB 4BFEA 3LPWA 1AD0A 1GOHA 4Q9BA 4L8SB 3MMEA 5KW9H 1C12B 1YECH 4EI5C 1T03H 2FIRT 3EYFB 1KELL 1Y0LA 3CFEA 3B9EA 3FFCD 3QUXC 3NCYP 3AB0C 5J6HB 2F8XC 2J88H 1I3GH 1QSEA 2PW1A 4P23A 2OTPA 4X6CE 1JGDB 3WDHA 5D72L 4EUPH 4R7NA 3KXFE 1CICB 1CGVA 4JFZH 3OJVC 2VXTH 3NPZB 1BFSA 3T8XA 1BAFL 3RIAK 1NEUA 5FYKL 4NM8H 5BO1L 1RK0A 5FYJU 2BCKB 3G5XA 4JG1L 4QT5B 2G75B 2D7NA 1LE9B 4FQCL 1EUUA 1S7XB 4PJ8A 4BKLB 3U6RB 4JVPA 3IFNH 2VITB 4FQ1L 4L3AA 5EOCH 5IJKA 1NL0H 2APWA 1H9VA 4Z7QF 5HD8D 2DN7A 3R1GL 1F2XK 1SEQL 1AH1A 1A22B 3FFCE 1HINL 3O4LD 1PZ5A 5CKGA 1QLFA 1CFVL 5E8NA 4NQSB 4Y88A 5EPMB 2G9HB 4JFPA 4NP4L 7FABH 5M94B 1SYSB 3UYRL 2C3GA 1SJVA 1P7QD 2GQHA 3TO4D 3GB7A 5FUOL 4OZ4B 1X7QB 5J1SC 4PLJC 4YC2B 2CDGA 3MA7B 3ABZA 5FKAA 3BGFB 2K7QA 3BGMA 2A9NH 4KK9C 1R5IA 3S37X 4QXWA 1G7MA 4YDLB 5HTSA 1MCSA 2D7MA 5JQHC 5D1XB 3WFBH 3EUUA 3HG1B 3MACL 5HHOB 5J06A 2EYTB 1NGZB 3MROA 4YHPA 3O4LE 5HHPB 3GMMB 4I3GA 5B22A 2DYPA 5IIEA 1MIMH 3HE6D 1VADA 1HXYB 2DM2A 1OY3B 3PGFL 2IPKB 2PYEB 4LPUA 4HDIA 4AM0A 3WN5A 5GRVL 2ED7A 1KLUB 5D5MF 1EO8L 3L3JA 4NC0B 3HE7C 1JTPA 5AZEH 4ACPA 1IGCH 5CMAB 3KYNA 3P2TA 1CGUA 4JM2B 3RNQB 1NCBH 5TF1H 2JKXA 1KTLA 1JN6A 4ZTOH 4ODWB 1S8DA 4NNXB 3I3DA 4OIIL 1U41A 5E8DL 2F8VA 4CMHB 4JDZB 3WS3A 2R8SL 5ETUA 2GCYA 3D85B 3C09C 3SOBH 4P3CL 5CIPB 3P4OA 2V9TA 4YO0A 4YHZH 5FB8A 1AXIB 3ARZA 5DJ6B 1UA6L 1WCBA 1YMHA 5L9DH 3HZYA 2NZ9C 1NFIA 5D7IF 2WQ8A 2MHAA 1DE4B 1J1XL 5MI0C 2CPCA 4UNTA 4IDJH 4HIJB 3TJHC 3MRPB 2NY2B 5EO9A 3GSXB 1J0YA 1G9NH 3DMMA 1X5ZA 3DSNA 4JPVH 3N50A 1RZGB 4Z7VA 5C0DA 4MNGE 1HXMB 1NCWH 4XMKL 5IHUH 4EEEA 1DBJH 3P4MB 1AR1C 3PJSB 5E2TL 1B2WL 4XI5D 2ZSWA 1FO0L 4KZDL 3FT4B 4KVNL 5DHVB 5B4MD 2DQGL 2AJVH 1K6QL 4YHIB 5CJOL 5DJYB 5E1AA 3LPGA 5EDXA 3O3EB 4E41D 4AT6B 5JIIA 3KPQB 1ORQB 2PUQT 4PJGE 3DWTA 3GI9L 4NSKA 5FK9B 1MQKH 1AXTH 1PG7W 3NGBB 1OLLA 1XEDA 3IAPA 3TBYB 4G5ZL 2W65A 3LSOA 4KAQL 3VD3A 4P9MH 4TQEH 4XP4L 3UPAA 3ARSA 1Q0YL 4MJ6B 3WLBB 3X14B 2CSPA 5KSUA 2FX7L 4GMSL 2BNQD 2EE6A 1BOGA 1YDPA 4LASL 3RUGF 3T0VA 3CZJA 1J0ZA 1JZ6A 5ALBL 2ADIA 3MJ6A 3P0YL 1Q94A 5EA0H 5DHYB 3BI9X 4GXUM 1N5AB 2IQ9L 4E41E 2YPLD 4X4YB 5HVFB 1X6LA 3QUYA 1T7VA 3DPBA 4EQ2A 1NBVL 1MOEA 1OP3H 1CFQA 4Z8FL 2MWCA 4KK5C 5TQ0L 1OARL 1XGRA 4W81A 1TZHB 4OCSH 4HUUA 4KMTH 1T0MA 2EEAA 1JZ7A 4MQXD 3DURB 2Q87A 1TJGH 4P2RA 3MRFB 4HF5H 3U9UB 2BNQE 5EU7C 3S9DB 5EBLA 4DGIH 4JGJA 2OR9H 4M8QB 3VGBA 1U6AL 2BNUB 4HCRL 3ZDZF 5JXEA 4K9EC 3RGHA 3BIAX 3HMXH 2NNAB 3QCTH 3BW9A 3E6HB 3VFUA 2YPLE 3OKDA 4LCWA 4P23C 4P2CG 3VFOA 1CTOA 3P73B 4KHXH 1EHNA 1QFWH 4D0BB 4WI2A 4ODVH 1A3RH 2MKLC 2ZKHH 2LTQC 3VFPA 4W68A 1QLEH 2ZWLT 1P6FA 3E3QE 5IEKA 2H32H 3UYOD 4Y5VA 1HHJB 1CR9H 1P2CB 3QISA 1LVEA 2AK1L 3LEXB 4Y4HD 5AUMA 4LKCB 1YQVL 3MV11 2ZZUT 1NMCC 3JUYA 1MWAH 4PJ8C 3C5SA 3OAYH 1HHKB 2FR4B 3PHQB 3KYKL 3GBLA 5GZND 3C08H 1N8ZB 4X7TA 2KUTA 1UGNA 5D1ZA 2P8LB 2P5ED 2RHEA 4HXBL 1NUDA 3NACL 1UWGL 5GHWL 1KLGB 4JHAL 1ZE3C 5F9WC 1IAKA 5KTEH 1AGCB 4AY0A 3U0PA 4PTUB 3O2VL 1KNOA 4HKBA 4MXQC 3BKCH 3HI5L 3DSFL 4XNYH 3I50L 5F7EH 2UZIH 4AEHL 5HHXH 2IAMD 4Y16D 1ZHKB 3T2OA 4FQLL 3RX5A 4M1DL 5D1QD 3TJEL 1CLOL 4GXUN 2FDBP 2VWEC 4K3GA 1FZJA 1EJ6A 2P5EE 1IQWL 1HHGA 1JGVH 1S7WB 1JHKH 3DV6A 4JY5L 3AC0A 4L8CA 5JPMA 1QVOB 3WN5C 3AAZB 1JFQH 4RGMC 4C4KT 5I76B 3WLWC 3KYOA 1IM9D 1T5XB 2NTFA 2NY0B 2X7LA 4IOIB 4FXKA 4KKAC 1G9ML 4N0FA 2WWKO 4FQHB 2ZCHH 1BZ9A 1QHOA 4OGAD 5B3NA 1XIWA 4HS6A 3S37H 3G6AB 4ZFZB 4G8GD 1CK0L 3VRJB 1FC2D 2BVQB 2R2BB 3G08B 4QWWD 5I66A 1HHIA 1R3KB 1YNTB 1JIBA 2CLZB 2OL3L 1A0QH 5KSAA 5GIRA 5DVLA 4CW1B 1V7MH 3KPRB 4PRBA 3N1FC 4P5MA 3GM0A 2EDKA 4MAYB 1FIGH 1Q38A 5IVXE 3LKSA 2W9LA 3OGCB 3T0ED 5LCVH 1A4KB 2Q7YB 4DW2L 3L5JA 1TVDA 5C71A 3TVMB 2VDKH 2Z31A 4EOWH 4J3TA 2V2TA 1WEJH 3LH2H 2Y07L 2NPLX 1W8OA 3DMMC 3FZUC 3BIKA 4RISH 1INQA 2V7NA 5I8EA 4DZBB 1EHLL 1U42A 5E2VL 4YXLH 1CWVA 3OKKA 4C56D 1HWHB 5CHNB 5CJ5A 2ITDB 1F02I 2FRGP 1AD9A 3HC4L 1ZVSB 3TLRA 1H5BA 2JCCB 5KSBB 2PR4H 3T0EE 4GAGL 5GJSH 1N3NA 5EWIH 1HQ4A 4ZAKD 1TITA 5I17B 2CMRL 5I74B 3CXHK 4KQ3H 4DK3A 2VH5L 4M4PA 1MFDH 1MHEB 5SX5H 3WXWH 1SYVB 2VABB 2VZUA 2ENSA 2BSTB 5IESH 3TEUA 4Z7VF 4ZTPH 1RZ8A 4J6RH 1XR9B 2QADC 1MFAL 1YMMD 4MHHG 4OAWB 2PXYD 5F7UA 2NY5L 5ABDE 3H3PH 2NYYC 5IBLD 1GL4B 3VDCA 5GGSA 3LEVH 5ILTH 5AD0B 3QNZB 4X6DB 2EXYD 5LWYL 3IAQA 5EUOA 4FQQA 3QUYC 1AHWB 4K71C 3L5XL 4Z7WA 5DYOB 2A77L 2GI7A 4QHNB 1JCKA 1RIUL 4I48A 1P53A 4LIQL 5EH1A 5DVOA 1AR2A 4YGVB 2A6KA 2J3SA 1BVLA 3QG6A 1M71A 3HNVH 3QXWA 4R3SB 5I1EL 1WC7A 4TUJA 4N8VG 4TOYH 5C9JB 4PGDB 4LRNL 1YMME 3OAUH 3LKOA 3DRQB 5JXEC 4H26B 2Y36H 1A6VH 1OF2A 4JANB 3HB3D 4NJAH 4LLVA 4XCEA 1WV7T 4P4KB 5DC4B 5EIIB 1CD1B 2VE6A 1FFRA 2VL4A 3QDHA 4HGWA 4KHTH 4ZO6A 3MRJB 5ESVA 1CFSA 4L5FH 3L7FA 1GAFH 4ELME 5JW4Q 4FTVD 1KPRA 3RWHA 4KRPC 4HC1L 5EOQH 1GIGL 1N64H 3OKEB 1HWGB 5IB1A 5DFTA 3IGAB 1A7PH 2Q86B 3IDYB 2QQQA 4GRWE 4HWEH 3QXVA 3B9DA 7CGTA 3BVNA 4Y5VC 3RI5K 1CGXA 3ALWA 4JFFB 2X05A 4MDJB 5JW4R 4DGVL 4D0CB 1MCOH 3EFFB 4H25A 2ED9A 1I8MA 2CKBH 2Y7QB 1QNZL 1QRKA 5J9PA 3NZ8B 15C8L 3RWDA 3MGOA 4H20H 1I3RB 5D1ZC 4IS6A 4S1DC 1TQBC 3H9HB 2VLJB 1CG9B 1FZMA 4UNUA 1IE5A 2FZ3A 1INEH 4FTVE 5DI8B 3GSRA 1A64A 3QJHA 3I3BA 1KPUB 3QNYB 3RVXD 4OQTA 4V1DB 1KEMH 4QRPE 4PJXF 2PKDA 2XKNA 1L0QA 4LVOB 3QDJB 1Z5LA 4RDQF 2DQHL 1QFUL 1FORH 4UT9H 2AV7A 3V0VB 4WCYL 1CXFA 3RDTA 5C0IA 3FTGB 4OM0L 4OB5H 2C7UB 1J11A 5HVHC 2DOCA 2JJUA 5AZ2H 4PGCA 2FWOB 3FO0L 1RU9H 3B2VL 4XBEL 1DUYA 2QQKL 4LOUD 1KCSH 3BP7A 1S9XA 3N0PB 4WJ5B 4N0UB 3WKMH 5IB2B 1AY1H 2AK4D 3OR7A 1I1CA 5I6XB 3BKJL 4XNXL 5F71A 2XZQL 4QRSB 4G3YH 3BMVA 4RFEA 3LS4L 4LMQE 3QHTC 4HGKC 3C6LD 5TE4H 5FYJD 3A67H 4JY4A 3BKMH 4QTIL 1KELH 4YHNB 5EN2B 4LPWA 3K3QA 4Y1AB 3WIHH 3ZDXF 2XFXB 3GKWH 3RZWA 5EC1A 4QHKJ 4KZEH 1EHXA 2EDQA 3GJEA 3GJFH 3PGDA 4GW4B 4AMKL 2OZ4A 4G6AD 1XIWC 3LEYL 4IOSD 1MHCB 5T3ZD 5A43C 5F89A 35C8H 5FYKH 1Z2KA 1HIML 4X4MA 2OTWB 1LP9B 1U8MB 3QBTB 5KG9A 5K9KA 4RBPK 4J3WA 3O3DB 2AK4E 3O2DL 5KSAC 1CXIA 3IDJB 4FQ1H 2ESVB 5CAYB 3GFUA 4NQCA 3T65B 4X5XB 3R1GH 1NAMH 3MV9D 5FYJE 4BQBA 2BSSB 3VE0A 1FN4B 4DQOH 4KVCH 2X1QA 1KIRB 3DXAA 2EC8A 3SDAC 2YD8A 1BEYH 1VFUA 1ZA3B 2Z31C 1FG2A 5HY9B 3PP4L 3ZE0E 5HYJA 4U7KA 1DLHB 3TIDA 4LNRB 4BZ1L 4YFEA 4OLYL 2VDNL 5T3ZE 1U3YA 4JB9H 3KLHC 3ZYJA 1SEBB 3SCMD 4MCZB 4APQB 4JKPL 3A0OA 4UIKL 4ETQB 5D93C 4U0QB 4X0KB 3H42H 1WVZA 2X4NA 2MJWA 1LO4H 2VZOA 1I3UA 2A9ML 1A21A 4H8WC 2HVJA 4RGOL 1T20A 2BFVH 2CIIA 3BSZL 3O0RL 4HGMA 5D7JA 4Y4FB 5DRXB 5I1DB 4H1LA 4P59L 3PDOA 4AJ0A 3LMJH 5J0BA 3QXUA 4K9EL 4IJ3C 4NDMA 2FGZA 3UPRA 1H5BC 2CKNA 3MV9E 3FO1A 3KYMA 5JW5B 4YHOL 3TP4A 2IMMA 4NUGL 4KRMB 1NSNL 4KJPC 1FL5A 3CNKA 4XGZA 3BN3B 1YPZE 1F8TH 2YXMA 1EEZB 1N2RA 4XCCL 3UTTA 4X8XA 3NCMA 5BV7B 4KTEH 3ZO0A 1HKLH 2DLGA 5I1KH 3R06B 1X5LA 3FQUB 1U8QA 2EZ0C 1UB5B 2BOCB 2XKSA 3UTQA 4KGJA 3R0MA 3KLAA 1NAKH 1YY9C 3CLEH 1OLZA 4HV8A 5DJ2B 3U7WH 2YBRA 4GRLA 4K94L 4Q9QL 4LVHC 4C4KO 2CK0H 4D2NA 4BYHA 1BFVL 4LKXB 4JFHD 5TH2A 3KPMA 5EO0A 3NA9L 1ZHLA 4BA8A 2BJML 1DN0A 4LP4A 4M02A 3UTSA 3VWKA 4NN6C 2EDYA 2JK5B 2UVFA 4NGHH 4YLQT 3DX9B 4KV5F 2MQCA 1J86A 3BX7C 4YGAB 4WEMB 4OLXL 3H3KA 3IVKA 3QXDB 1XGPA 3IDIB 5I19H 2CLVA 2EDJA 3L6FB 5CS7A 3HZMB 4JKKA 4HZLA 1B2WH 5EUOF 3UZEA 1O0VA 3IU3A 5DWUL 1CXEA 1T04A 3TWCH 1FO0H 1CD0A 4W4OA 5KSVA 1KGCD 1MRDH 5KVMC 3MJ8A 4ENED 4JFHE 4M48L 5GSRB 4CN6A 1AKJD 1B90A 3VG0H 4S1RL 5LGHH 3SKMB 1SM3H 3U46B 3QHZH 4L8SA 1C12A 1QBLL 2MQ3A 3EYFA 3RWJB 3WHXB 5D70H 4G5ZH 5ESQB 4YHML 5J6HA 3U48A 5I71B 4XP4H 2OXHA 1JGDA 5CEZH 4OFKA 1CICA 2WMPA 3MXWH 4YDJB 4LASH 3FB8B 5AAWA 3UTPE 1IILE 2H8PB 4PJDE 3HR6A 2BVPB 4EI5D 3OKLB 3QUXD 2BCKA 2ZJSL 1KGCE 1N59B 3JV5A 1IAII 4LARL 4QT5A 4K8RH 2G75A 1LE9A 4QHKI 1S7XA 4KI5C 3U6RA 4BKLA 3AS3A 2VITA 5JOEA 2NW2B 3RDTC 4QKXB 4NWTH 5TQ0H 2B1AL 4TTDC 3GBMH 3H9SD 4N9GB 4U2ZA 4S10A 5FGSA 4YBHA 3V6OA 3UROR 3VRLE 2YMXH 4NQSA 2EE3A 2G9HA 5EPMA 1QKZL 3BHBB 1BIHA 1SYSA 1RUKH 3PQYB 4HUNB 4OSUL 2W60B 4OZ4A 5EU6D 4R9HA 1X7QA 4XPGL 4N1EA 1KV3A 1U6AH 3QAZB 4HCRH 3X12B 1A6ZB 1WTLA 4OCMC 2O5ZH 3MA7A 3QH3B 1CD9B 3O6FB 5F1NB 4DUWA 5CSBA 1MJJB 4JCMA 2VTFA 3UEZA 3IXTB 2BOBB 2IQAB 4KI5F 5D1XA 2DQFB 4JZNB 4JRYB 3HG1A 5HHOA 2DRUA 2X9WA 3KS0J 4JREB 3QUML 3MJ7B 3H9SE 2EYTA 1NGZA 4YK4C 5HHPA 2A0LC 2YRLA 3GMMA 1EH9A 5BCAA 3S97C 3HI6H 4QXTB 3KJ6H 4KK9D 1HXYA 5C0RL 1A6UL 2OK0H 1YQVH 2IPKA 2PYEA 3EHBC 3IRPX 1KLUA 3REWB 4TSAL 5EU6E 4IOFD 1T7ZA 2F53B 5CMAA 4MQTB 4JM2A 3RNQA 1MCJA 3VXSD 5HPOA 1E4WL 4ODWA 4NNXA 2B4CH 2DDQL 4Y19B 1F4AA 4JDZA 1OQXA 3PWJB 4GKNB 4POYA 4G6ML 3D85A 3PNWB 5D5ME 4YNYB 5DD0H 1C08B 5CIPA 3HE7D 3KPPB 3VXUB 2Q3AA 3WDIA 2IBZY 1A7BA 5DJ6A 1DSFH 1INDL 1H3GA 2FJGB 3LY6A 1GOFA 5DURB 1MFEL 1S78C 4AEHH 1DE4A 1EFXB 5D7JC 4FQLH 1NH6A 1DBMH 4PGEB 1EGJA 4X98B 2VDRH 3LKNB 3MRPA 4HIJA 5LG1A 3VXSE 3GSXA 5FM5O 3TBTB 3J8F7 1IQWH 5E6IB 3NAAH 2NZ9D 2XNAB 1RZGA 4FQXB 1Q9OB 1HXMA 3CPLB 3P4MA 3RAJL 3PJSA 3THML 3QEGH 3INUL 2FYYB 1ULVA 2WUCH 4R2GC 3FT4A 5I16B 5T3XL 2DD8H 1ZLWH 1G9MH 1L0YA 5DHVA 32C2B 3BH9B 3G6JE 3MRGB 4YHIA 1IT9L 3O3EA 4RWYL 4AT6A 5BOZG 1ORQA 3KPQA 1OM3L 3HHRB 3B5GA 4U0RB 5FK9A 4Y8AA 1AR1D 1OB1B 4NCDA 4PJIF 4MWFB 4QXUL 2ZUVA 4GH7B 3TBYA 2HA1A 3TC9A 2YSSB 2ZOLB 4MJ6A 3NPSB 1N4XH 5M7QA 1IC1A 3WLBA 3X14A 3CSGA 3IJHB 3ELAT 5K9OB 2WW8A 4HIHB 1QG3A 2D0HA 4FMKA 5TDPB 1NFDB 3MNZB 2GHWB 4I77L 1IGIH 3VWKC 4BSWB 1I9IH 4X9IA 3U7YL 1ZLUH 1FNSH 4OF5A 5DHYA 1N5AA 3VA6A 4X4YA 1IKFH 2IC2A 5SWZD 5BMFL 2X41A 2WQRA 4OFYD 5AYQA 5FF6B 5TPWH 3IKCB 3K4DA 4V2CB 1RZ7H 1TZHA 4GAYB 4PY8J 5DQJB 3DJ9A 2BY2A 4W4OC 4LQ1A 5BRZE 3LZFL 3DURA 1CE6B 2ZOKB 1CL7I 3MRFA 3U9UA 5I73B 3GNML 4HPYL 5JHDB 1Q1JL 5F7DB 4KK5D 4GAGH 4P2YA 3HCVB 1JHTB 2WANA 4M8QA 4L8SC 4N90D 1Z3GH 2BNUA 2H32B 3LDBB 5L2KB 1K4CB 2NNAA 2E7LA 3OJMB 3E6HA 4PRID 1AQKH 1MWAB 3QQ3B 3OR6B 5IFHH 2IALB 5SWZE 3P73A 8FABB 3MXVH 3WV0A 5ADPH 1CICC 4D0BA 3WHE1 3KYAA 4OD3L 2FJFB 3AVEA 5LGKA 4NYLB 2DQUL 2DQTL 1HHJA 3HPLB 1O7SA 2N7AA 5CGTA 1P2CA 5DC0A 3LEXA 1QD0A 3L9RB 4LKCA 1C5CL 3EO0B 1QSED 1MHPL 3GRWH 4MA1B 4P23D 3UBXG 2FR4A 1HHKA 1TIUA 3PHQA 4JPKL 4HMCA 1PEZA 4N90E 3IFOB 4DGYL 5ACZB 4POUB 1N8ZA 4NZUL 5ICZB 1RIUH 5L0QB 4X7DC 2P8LA 3V6OC 4PRIE 1KLGA 1XF4B 4GO6B 4WEBL 4PJ8D 4LRIA 4PTUA 3FN0L 2I5YH 3SDYH 4B50A 4YC2C 4B7LA 3BGFC 1QYGL 1QRNB 1QSEE 4YDLC 1J10A 2DWDB 1ZHKA 5D1XC 3MBEB 3D9AL 5EIQA 1BJ1H 5T5NG 4HC1H 3SKJL 4MXQD 3WO3B 3BRGC 5E4IA 1DBKL 4LPTA 4LEOB 5ITBL 2X4RB 3S4SG 4NRYB 1S7WA 1EXUB 3ZKMD 5H37G 4ZXBD 1WAAE 1MCIA 1QVOA 2HFEB 3AAZA 2CRYA 2R2CA 5HGBB 5I76A 5T1DL 4IOIA 1T5XA 3VW3L 2DM7A 3C5ZB 4JM2C 1WITA 4FQHA 1BF2A 4G80B 4GAJL 2DYPD 4NUJB 3RZCD 3G6AA 1NMBH 4CMHC 2QSQA 4XT1C 4IMLB 3I3EA 4ZFZA 1GYAA 3VRJA 2BVQA 3LIZH 1P4LB 2R2BA 1BD2B 4LSRL 3KPSD 3G08A 3WLWD 4KKAD 1R3KA 1YNTA 2CLZA 4DN4L 4CW1A 1OD9A 4KKLC 1SJHB 2AP2A 1N6QL 1ONQB 2R9HD 4IM8A 2AGJH 3KPRA 4MAYA 4O2CB 1YEEH 3OGCA 1EEUA 1A4KA 2Q7YA 3D18B 2QQLL 3TVMA 2DQDH 2VWEE 4U6VL 4XBEH 2NY2C 1VHPA 1P4BL 1YEJH 4JM2F 2A6JB 3CX5K 5JXAL 3PWUB 1YNKL 4JO1H 4OLWH 2ICCA 1T0NB 4DZBA 2XZQH 4RFOL 1ZKAA 5ECJE 3FOMB 1JI2A 1WJ3A 4M4RA 3KPSE 3NABL 3PHOB 4QTIH 1FVEB 3L95B 4ONOA 4L3EA 3V2AR 5AEAA 1QFPA 2SEBB 5CHNA 2DAVA 3T2QA 4L9LB 2ITDA 5EBWB 3DMMD 3FZUD 5BVJB 1ZVSA 2JCCA 5KSBA 3K46A 4H0HB 4Z18A 1LK3L 2PCPB 2VDPL 3FQTB 2YR3A 3NGBC 5I17A 4WGVB 2GIYA 5DQ9B 1RZIB 1MHEA 1SYVA 2VABA 2BSTA 2LVEA 1F4WL 3QDAA 4WHDA 4JN1L 1N0XL 5KOMC 3LHPL 4OLZH 4CJ1A 4I4WB 4S0SD 4ODTH 3AREB 1XR9A 4WW2B 4ESKA 4OAWA 1ADQL 3DI2B 1RJZB 3OXSB 5C2BL 5AD0A 3QNZA 4X6DA 5F9OH 3PP4H 1ZT7B 4F2MB 5TE6H 3AGVA 4OF8A 4Z7VE 1AHWA 4DOHE 1A1OB 1DL7L 5DYOA 3TYFB 5TQ2L 3HUJF 5HHQB 4QHNA 2QADD 2VQ1B 4XVJH 3EJJX 3BN9C 4YGVA 3RY5A 2A9MH 2EH8L 3IJYB 3VI3F 3V7AG 2CJUL 1Q72H 4XPHL 3STZB 2DWEB 4X80L 1FNLA 4R3SA 3VGDA 3QUYD 3RVVC 5C9JA 1HEZB 4RAUB 4PGDA 5EORH 2VXVL 3DRQA 2JB5H 4H26A 4IHOB 4JRXB 4JANA 3A6OA 2MPAL 3I6KB 2H6PB 4P4KA 2AQ3A 5EIIA 1CD1A 3MNWB 4OV6F 2E7LC 2XV6B 2FCBA 4PB0L 3MRJA 5FA3B 3QXAB 3IDNB 4P2RD 5JUEH 2HKFL 5F1SA 2VSCA 5K9QI 1XCQA 2CKBB 3OKEA 1CDIA 1YEGL 3S35L 2Q86A 3IGAA 4LL9A 1DZBA 4YXKL 5JXED 1CF8L 3SE8L 3UJIH 4GSDH 3CX5J 2AS5M 3NIGF 5DEGB 2F19L 4LCWD 4JFFA 3OKOB 4MDJA 2E8ZA 4P49A 4D0CA 3FO9B 3EFFA 4KRPD 1QSFB 1IAIL 1MRFH 4ZNEA 2Y7QA 3NZ8A 3IS0X 3W9EB 3JVGA 1IFHH 1I3RA 3FFDB 1U2CA 1BFVH 2ZNWA 1J1PH 4P48A 1CG9A 3MCLL 5I8KL 2K7PA 4P2RE 2X40A 5DI8A 4GQ9L 3U1SH 2FEEI 1KPUA 2XWJB 3QNYA 4LRIC 3OB0K 2APFA 4V1DA 4A6YH 3QDJA 1JNLL 1YUHB 1KLFA 1WIUA 5D1ZD 5GRUH 3B43A 4QHMB 3H9ZA 4YWGH 3QXTA 3V0VA 1RURL 4S1DD 3FTGA 1NCCH 3KJ4B 2C7UA 4LCWE 4O9HL 4DKDC 3MOQA 1FBIL 1FNGB 2FWOA 1CFNB 5C08B 2VDQH 4WJ5A 4N0UA 5IB2A 1EAPB 3ZTNL 1E6OL 1N6VA 1YNLL 3D39B 1D7FA 4OZFB 2VR5A 4YFLF 4QRSA 3IU4L 3NIDE 1NGPL 1A5FH 3FHAA 3NZHL 5GGTH 2W0LA 4FOMA 1AQDB 4XVTL 1JNNL 4YHNA 3ULSB 2LV4A 2AJYH 1EHAA 5EN2A 3CSPA 2NY0C 5IFJB 3S3JA 4Y1AA 3AMKA 4ZMAT 2XFXA 1KCRH 4FQPA 4I0PB 1NUNB 4HIIB 4GW4A 5HDBF 1H3XA 2ADFL 1BIIB 1MHCA 3Q3GB 1KB5L 3OX8B 2VXUL 5J7CC 3D69B 2OTWA 3BUTA 1LP9A 1U8MA 2V5TA 1OWWA 2J8HA 3ZDXE 1M4KA 3LCYA 5I75B 1TZIA 3O3DA 3HA0A 2FB4H 3BP4B 3S5LB 3BZFB 3IDJA 5HHMB 4OGZA 1J05B 1XIWD 2ESVA 4MAYC 4WFED 3T65A 4LLYB 3ARXA 2BNRD 4X5XA 4ODSL 1Z9LA 2BSSA 2EDHA 1FN4A 3C8DA 1KIRA 3TVMC 2PYFB 4KJYB 1ZA3A 2Y06L 5FOJA 1KBGL 2XXCB 1VFBB 5HY9A 3O41B 5KSAD 4F3FB 1DLHA 4LNRA 1K3IA 5C1MB 1EVUA 3JWOH 2GY5A 1G1CA 1SEBA 4MCZA 4APQA 5MEQB 1HDMB 1WZLA 4ETQA 4C54A 2FH6A 2X1PA 5ESAB 4X0KA 3V4VL 2NY6B 5EOTB 1LO2L 3QUZB 4FA8A 2Z31D 3TA3B 5DRXA 4Y4FA 3QIWB 5I1DA 2MFNA 3BZ4B 3QWOB 4WFEE 2BNRE 4PRHB 4X6EB 4X7CC 1AE6L 1A7QH 2NY7L 2P45B 5JW5A 1G6RH 4G42B 2EXWC 5I74C 5IG7B 2Q8AL 2IG2L 3PXHA 5IR1B 1EEZA 5SV3A 3QP3A 4B41A 4LSTL 1WBZB 4NFBA 1T2QH 3G6DL 5DK2B 4I18B 5EBMB 3R06A 5SWQB 3FQUA 4JPIB 1RZFL 4KJPD 1HCFX 1UB5A 2BOCA 1UM6H 5DJXB 4P2QB 2OQJB 5EO1B 1ZHBB 1WFTA 2LU4A 5BZWB 1UC6A 1OAUL 2X6MA 2P1YA 1AHWC 3MRDB 5FGRA 5DJ2A 5D7KD 1CXHA 2JCCF 4XMPL 2X1WL 5KSBF 1CLYL 4HUMB 4NQDB 1EBPA 4NKOB 2OX5A 3GKZA 3UJTH 4XCFH 3D3VA 4LDEB 1P9MA 2ARWA 2EZ0D 4LKXA 4S1QH 1JVKA 2V5SA 4O5LL 1F90H 1YY9D 2JK5A 5I30H 3DX9A 2R4SH 1FO0B 1JWUB 3NTCH 1XT5A 2W9EL 3DUHA 1E6JL 1UJTA 4HWBH 2MCG1 2BERA 3QXDA 4YZFF 1S7QB 3IDIA 1GPOL 3L6FA 1TFHA 4KTYA 1G7PB 1X44A 4P4KC 1TCMA 3HZMA 2HRPH 1OTTC 4YHKL 4X6DF 1DFBL 2XWTB 1GGUA 5D7KE 1FLTX 2J6EL 1DQLL 4K3EL 5T3XH 2VIRA 1KXVC 4FFZL 4LNVA 3IDYC 4EBQH 3FRPG 4FABH 1FSKB 5GSRA 1EJOL 4LSQL 3SKMA 5E5UB 3MCG1 1IC5L 2RBLA 3U46A 5FKPB 2VLLB 4LVEA 5EUOE 1F6AB 4Z7WE 3RWJA 3WHXA 1IL1B 5ESQA 3VGAB 4Z0XB 1OTSD 3BD4A 5JR1L 2X1XR 4K3JH 2GTWB 4LPVA 2EDXA 2VZ3A 4AZ8A 2IPTH 3N85L 3JVGC 2EH7L 4KH2A 4YDJA 1IEAB 3FB8A 1GZPB 1S7UB 2H8PA 3MUHL 4XPBL 3LAFA 3OKLA 5C0BE 4OJFL 1N59A 1OAZH 1QOKA 1IGFH 5DFWH 4F7MB 3V0WL 4LVOC 3GIZH 1PX4A 3O8XB 4AL8L 1DQDL 4XAWL 5GJTH 2NW2A 5LBSH 4HBCL 4YDVB 3S35X 1BGXH 4N9GA 2P8MB 3RPIB 3G04B 3F8UB 5I1GH 3Q5OA 4JFEE 2XRAL 4PR5B 3AS0A 4JKMA 3BHBA 1WWBX 5GISL 1DBBH 1YJDC 1RFDL 3DVFA 4HPYH 3PQYA 2CGRH 5I6XC 1G7QA 3RDTD 2W60A 3SDXF 4TTDD 4G7VH 5CBEB 3X12A 1A6ZA 3QH3A 5D7SL 3O6FA 4CGTA 5F1NA 3WYRA 3QUKB 2Z8SA 1MFCL 1MJJA 3X11B 1S9WB 1X4XA 3IXTA 4KKBC 2BOBA 2IQAA 2DQFA 2UWEB 4JZNA 4JRYA 3RWFB 2AABH 1LD9B 2O5XL 3MJ7A 4DVBB 3ULUD 4PP1C 2DQUH 4NRZB 5CBAB 4QXTA 5AWNH 3ZKNC 1MSPA 3TM6A 1MHPH 4N68A 3REWA 3BPLB 1FAIL 4JPKH 1CDBA 4DGYH 2MTPA 4DKEH 2F53A 4J7RA 1MCEA 4AEIL 3IDUA 1J87A 3V6ZB 4EUPG 4NWUL 1P5VA 1A3LH 4MDIB 3S88H 4HJJH 3FCTB 4Z7NF 4ALAL 2R2EB 4XBGB 3MGTB 3PWJA 4GKNA 3EHBD 12E8H 1MCNA 4LEXL 3PNWA 1KFAH 5CZKA 4YNYA 4L4VB 4XMLH 1C08A 4ZUVB 3F7PC 4QXGH 3ULUE 3MYZA 3KPPA 3VXUA 4WFHD 1G0YR 4APQC 4U1IB 4YXHL 3VH8G 5IUSA 3MJ9A 2FJGA 4UMGA 1SY6H 2YK1H 5HYSG 4NQTA 4FRWA 5GS0C 1LP9F 2VLRE 5ICYB 3DXAD 3L7EB 1EFXA 5I8OH 4MLIA 4KY1L 4Y4FC 5HYJD 1EEYB 4PGEA 4X98A 3LKNA 4M3KB 2DIAA 1JBJA 5IKCB 3SKJH 1RD6A 4HPOH 1AI1H 1B6DA 5DMIL 43C9B 3TBTA 5E6IA 3HRPA 4XVUC 3B83A 1A7RL 2XNAA 4HLJA 4FQXA 1S78D 1Q9OA 3I6LD 4WFGD 3CPLA 1WBXB 2XG5A 4LAJH 5F3BB 2P8PB 5E7FA 3QQ4B 2FYYA 3GGWB 4P9HH 4Q6YA 1OGAB 5T1DH 1CLZL 4WFHE 5BV7C 5CZVL 4BZ2L 1MRCL 4U2YA 5I16A 3VWJD 2YA1A 4OF6A 3BH8B 32C2A 3ALXA 3DBXB 3BH9A 5DEFB 3MRGA 3MRQB 3DXAE 3CFKB 2IPUK 2L4OA 3MUY1 4G6FD 1MELA 3UO1H 5HYJE 1OB1A 4FNLL 4MWFA 2W9DL 3UTTD 4X99B 1CD8A 4R2GD 4U1SB 4MD5B 2DQEH 5HDQH 2YSSA 4FP8L 2ZOLA 2FX9L 2WNGA 4LPXA 5EBGA 4R6UA 3IJHA 3I6LE 4WFGE 1P9MC 1XH3B 5K9OA 1OPGH 4HIHA 1YY8B 5TDPA 1NFDA 1YEIL 2YD4A 3EDDA 4TRPL 3MNZA 3RU8L 2BRQA 3WE6B 4BSWA 3L3DB 3NFSL 4WHYH 2J8OA 4GRLD 1ZLSL 5JXAH 4AG4L 2F74B 5ID1B 2QLVB 2BRRH 4NM4L 1OCWL 4QEGA 5FF6A 3IKCA 3UTTE 3UTSD 3HMWH 3VWKD 1YYML 3PWVB 5HVWA 4ZO9A 2J7LA 1E4XL 3LKQB 4GAYA 3RFZC 5DQJA 2OJZL 4PJ7E 5T33H 1IJ9A 4KFZC 2YD1A 1CE6A 2ZOKA 4ZS6C 2D31B 3MRRB 1UWXH 3U4AA 5JHDA 4OD1H 3WD5H 1MI5B 1SJXA 1JHTA 3HCVA 5DVKA 1ZSDB 3M45A 5L2KA 2H32A 2WAHA 1LK3H 2CR6A 3TV3L 3WXVH 5A40E 4P5KB 5EZJB 3D48R 1K4CA 4IDLA 3GEWB 5I71C 4ZUWB 1MWAA 4KRNA 4D3CH 3QQ3A 4HS8H 3OR6A 1XF1A 1NANH 4XVSL 8FABA 2VC2H 3BAEL 3VGFA 4Z6AT 3UTSE 2FJFA 1P4IL 5AG8A 4O58L 3ZYZA 4NYLA 4NKIH 3HPLA 4LCIL 2EDBA 3L9RA 1FPTL 3EO0A 4HH9B 1NGQL 2MCPH 1J8HB 5C09B 4OZGE 1DL7H 1CICD 1ITBB 3IFOA 1TTGA 5ACZA 4HUWB 5ICZA 3H8NA 3S8WA 1NMAL 4HXAH 4RRPA 1FYTB 3IB4A 3GSOB 4K7PX 1HI6B 1TZGL 3IJSB 1SMAA 1XF4A 2J1KA 5C70A 4RCAA 4XPHH 5JORB 3D6GA 3F5WB 4AIZB 5D7IB 5C7XL 4LHUA 4KU1A 2B1HL 4UINH 3V6FB 4LSVL 5C3TA 3RIFF 1CXLA 1MIEH 2L7UA 4PJCF 3QAZC 4FZEL 3LVEA 1J1OH 3H7LA 4PJAB 5BVPL 5CGMA 2OI9B 2OXGA 3O6FC 3OJDB 1QRNA 2WIMA 4KJWC 5LQBH 1FH5L 2R0LH 4MYWB 2DWDA 1MFBH 4MMXC 1VSCA 4JVUA 4X5WB 1OAYL 4RAHA 3MBEA 2MKWA 2HKFH 4U6YB 1KJMB 4JREC 4P57B 3WNOA 4WUUD 1H3VA 5KOVC 4LEOA 2X4RA 2J4WL 4NRYA 1DQQB 1OL0A 4P4RB 1EXUA 4TVSa 5MENB 2BHYA 5FO8B 4MA8L 4Q7DA 1NLBL 2HFEA 4M6NL 5D1XD 4XC1L 3HNSL 4CN1A 5HGBA 1K9TA 1S9YB 2QHRH 5HHOD 5J1TC 4M9PA 3C5ZA 3U9PH 3CVHL 4G80A 3QA3B 1NLDH 4KQ4H 3FMGH 4NUJA 1FNAA 2PYED 4IMLA 4RNRB 2I60H 1P4LA 1ZV5A 1BD2A 2XY2A 1CGTA 2VXSH 2EYSB 2IH1B 5BS0B 1REIA 4R0LB 3RUGB 4WUUE 5T3ZH 4JM2D 3ZLQC 1CDJA 3PWLB 1DLFH 1SJHA 3C5JB 3F65A 1ONQA 2ZCLL 3BOVA 4O2CA 4O9HH 4RA0C 3D85D 1FBIH 4HQQH 1OAKH 5HHOE 3D18A 3T2NL 2ZG1A 5GS3A 2CQVA 3B8YA 2A6JA 3MLZH 1QFWI 5E6IC 3PWUA 5TE7L 4FQXC 2PYEE 1T0NA 4NO5B 4O2FB 5DUML 1U92B 3FOMA 4N8PA 1JF5A