1FT2A

Co-crystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Cocrystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft2A00
1LD7A 1S63A 1SA4A 3C72A 1TNYA 1O1RA 4GTPA 1N4PA 4GTVA 3EU5A 3E37A 1SA5A 4MBGA 1LD8A 1MZCA 1QBQA 3KSQA 4GTMA 3HXFA 1FPPA 3DSWA 1TN8A 3DSTA 4GTRA 1N4QA 1TN7A 3SFYA 3SFXA 4YDEA 1TNUA 3HXBA 3E32A 2ZISA 4GTSA 1NI1A 1O1TA 1JCQA 3Q79A 1TNBA 3PZ1A 3Q75A 2H6GA 3E30A 3PZ4A 3DPYA 2F0YA 3HXDA 2BEDA 1KZPA 3Q7FA 1D8EA 1FT1A 3DSXA 3KSLA 1O5MA 3PZ3A 1O1SA 4GTTA 1DCEA 1JCRA 4EHMA 3DSSA 4GTOA 4L9PA 3Q7AA 3HXCA 1TNOA 1X81A 3E33A 1TN6A 2H6HA 1S64A 1D8DA 1N95A 2IEJA 1N4RA 3DSUA 2ZIRA 4GTQA 1N9AA 4LNGA 3DRAA 1LTXA 1N94A 1FT2A 2H6FA 1NL4A 3DSVA 3Q78A 1TNZA 3E34A 3PZ2A 1JCSA 4LNBA 1KZOA 3HXEA 3Q73A 1N4SA 4YDOA 3EUVA 2H6IA 2R2LA
chains in the Genus database with same CATH superfamily
2VSOE 2A5UA 1TNYA 4X8QA 2JEKA 4PDXA 3E37A 4TXQA 3CEQA 4KYOB 2GRNB 4G8KA 4BWRA 4F7AA 3FTZA 5ARGA 3LY8A 4JHJA 1DNPA 3GZ2A 1JPLA 2Y69E 3CHRA 3LY7A 4JVSA 5AIJA 3AU4A 4YDEA 2E0IA 3JQ1A 4LNUD 2LXMA 4UWFA 3PUKA 4XIFA 4GPMA 5BT1A 3L08A 3N71A 4DLQA 5AQBA 3CSTA 3Q75A 3MX3A 3V2XA 4XKBA 4DI3A 3NB2A 4Y6WA 2PM7A 3DPDA 5BV1A 2ZGDA 3B7BA 3DSXA 5AYWD 5FT9A 4ACLA 4MLPA 1DCEA 2R5SA 2GW1A 4GTOA 2WXHA 2WPVA 2WXJA 3T8KA 4GYYA 1TN6A 2OVBA 4I6JA 2WXKA 4GZ5A 2AJAA 4EZJA 4ANUA 2L9BA 3QWWA 2FO1E 4XI0A 3MGBA 4I43A 2C2LA 4KT6B 4CGVA 4YDWA 1QNFA 2HYZA 3FUEA 2ILRA 1QQEA 5FQ4A 2CFZA 1UG3A 4BTBA 3IV0A 1KT1A 3EDTB 1O1RA 4GMRA 4GZ3A 3HRAA 4DX6D 4OVVA 3FH8A 4QFVA 4ACKA 3GZ1A 4Y6CA 3DSWA 2GRQB 3VTYA 4PH4B 5EN5D 3MKRA 3R7QA 2KATA 3OTNA 3MA5A 4ATZD 2I1JA 5BXUA 4AY6A 1E7UA 4N2QA 2ONDA 3ABKE 3PUJA 2C0LA 4BY6A 2L6BA 2P58C 4U8VD 4J8DA 3ZHEB 3CR3A 4AIFA 1IHBA 1NA3A 3DPYA 4I1OB 2CHZA 3R9MA 3ZFWA 3EU9A 3KD7A 4KZCA 3RSEG 3R7RA 3MJWA 3FU5A 4HI9A 3APFA 3LJNA 2IO2C 3E33A 2MYOA 3PS6A 1PC2A 3F6QA 2A4ZA 4R7LA 5ENNA 4DPRA 1NL4A 3AJIA 5JMND 4GMJA 5FTPA 1P5QA 3ML8A 3R9AB 2QZAA 4I1AA 2DIWA 2LAIA 5EX3A 5BW8C 3L22A 1IKND 1XGWA 4J8EA 1OCOE 3I5PA 3EU5A 2J07A 2I2OA 2AXUA 4GYWA 1GW6A 3KSQA 3TWQA 4KBQA 3FUHA 2YINA 5B1AE 2L6JA 2FBNA 4F53A 2WXMA 2XENA 3UM3A 2EQXA 3DXMG 3LXUX 2I1KA 4JC8A 4DUIA 2WXLA 3MZLB 5B1BE 4AM9A 3B7SA 1K3ZD 4HOSA 1WY6A 4IULA 1FCHA 3ONLA 2Q7FA 4IYPA 1HG5A 3FTWA 4B93B 3CHPA 4N3BA 1HH8A 3MCXA 5ENRD 3PH0C 3B13A 1TJFA 3B7UX 3ZRHA 3FWVA 3KEAA 4PS3A 3LDZA 3OXFA 1N9AA 2H6FA 3SO8A 3GYZA 1DVPA 2VQ2A 3FEXA 1BI7B 4Q69A 3FUNA 2QFCA 1OCCE 3ENEA 1EYHA 3IBEA 3APDA 1SZAA 3ZXSA 2YNQA 2YHEA 5AJDA 4MRUA 5ARFA 2Y4TA 1HFAA 4ZHBA 3HXFA 4I1MA 2V4LA 3PEVB 3JXIA 1FPPA 3RAUA 3CVVA 3ZUVB 2V4HC 3CVYA 1G3NB 5AQAA 4JL0A 4AXHA 3SFYA 2WXRA 2IF4A 1TNUA 1EDUA 3UKRG 5FZQA 4A3TA 3K9IA 4C0MA 3HIZA 2XRZA 5EYPF 5ENPD 4FJYA 2PQNA 4PUCA 2FI7A 2H6GA 5DIZA 3RIBA 4F3VA 3BUAA 1KZPA 3D9LA 1QZ2A 3CHOA 4G1TA 4I17A 2XGSA 3V2OA 4J6IA 4N5CA 3HXCA 3MKQA 5JHBA 3B95A 4LERA 5H7PA 2ZXWE 4N3AA 3S7DA 1H6KA 3DRAA 3U3WA 3WG7E 4D10C 4JW1A 3JQ0A 4K5AB 3PRZA 2J4BA 2WQ7A 1AP7A 4NRHB 4ATGA 4E85A 2JLBA 4YDOA 3CV0A 1IYGA 2GGFA 2WQ6A 3ZW3A 4M7CA 4EPZA 3AG2E 1SA4A 4DX7D 5T3RA 4MBGA 1V55E 3CQCB 3UM1A 4B94A 3FH7A 4YNDA 4URKA 4WWOA 1K1AA 3D9IA 4NACA 2VGXA 1INZA 1S0PA 3Q15A 5LCWC 2A5EA 2WMOA 1WG0A 4KVMA 3Q79A 2CHWA 1UW4B 2ETAA 4RG6A 3QJZA 3RRUA 4XEIG 2LAHA 2LSVA 4CDNA 2XEVA 4TUUA 3KEZA 1E8XA 1YA0A 2RFAA 4JPSA 5D0QD 4JXTA 5E76A 3TG4A 2AWIA 4BX8A 1OUVA 4ANXA 2P9PG 5ANRA 5LOZA 3UINC 3G2SA 3UMVA 3ZKJA 4YVQC 3RJVA 3ULQA 4JHRA 1H6OA 3G2UA 5C1DA 3TWSA 3ZU7B 2R59A 5KJNA 3PZ2A 1KZOA 5ENTD 1N4SA 3NZUA 3L17A 3L16A 2R2LA 5BNWA 1KT0A 3ASFA 1SA5A 3BU8A 3D9JA 1W3BA 5B3SE 3CLJA 5AENA 3RRNB 1SVXA 1V54E 1N4QA 2OEWA 3FY4A 4DX1A 1NI1A 4HQDA 3ABLE 2GROB 1JCQA 4CT4A 3IKOB 1OWLA 3MEKA 3E30A 4UQZA 3B7RL 3MKQB 2AXVA 2JABA 3Q7FA 5BXOA 1FT1A 4DJAA 4HLLA 1BU9A 4HOUA 4GZDA 5FZRA 2LO6A 1X81A 4AY5A 1WAO1 2H6HA 3CSFA 3QDNA 3AS8A 3LCAA 3QNKA 4TRQA 2UWJG 3DEPA 4Q96A 4AP2A 5D0OD 3UUXA 1TNZA 4EBAA 3LVRE 3LPZA 3HXEA 2J4DA 2KCLA 3CVQA 3ZXPA 2H6IA 4GCOA 2OV8A 3IHYA 2WXNA 3J5PA 1E8WA 2VGXB 4ANVA 1ELRA 2CFUA 3CVLA 1N4PA 1TJCA 2J9QA 5J08A 3JUEA 5CHEE 4O1OA 3AS4A 3Q9UC 4JZYA 3JUIA 3ZN3A 4G26A 3TWXA 4C48B 5AN8A 2P9KG 3E32A 4GTSA 2Y4UA 3LKUA 4AVXA 1TNBA 3PZ1A 4CEMA 1E7VA 4FU3A 4U96D 3CVUA 3PZDA 2BTDA 3IEGA 3RKVA 1Z3YA 3D9NA 4HRLA 2LUHA 4U8YD 4U0SA 2ETCA 3QARA 3HVEB 4UQYA 2DYRE 2VGEA 2EILE 3UX4A 5LCWJ 1MX2A 4J7WA 4GZCA 5EX0A 5BUZA 1ELKA 2XS1A 2AVPA 3P1UA 2R02A 4FC8A 1OWPA 2F8YA 2VJ8A 3L9TA 5IY5E 1OXJA 1JUQA 3Q78A 2F8XK 2X6FA 3D3MA 4EQFA 4UWLA 4DX2A 4TV3A 2FO7A 3AG1E 4DK5A 3ASOE 5FQ8A 2QYUA 3ZYKA 4CDRA 3C72A 4EZKA 2L0IA 4CCAA 4FHKA 3TAXA 4B89A 2EINE 3UT8A 3QK0A 4FLHA 3MV3B 3QWPA 3O48A 2BKKB 1MX4A 3HYMB 2HM8A 3D9OA 3V31A 4CGWA 1E8YA 3KAEA 2X6KA 4YVOA 1UN8A 1OWNA 1EPUA 3AU5A 2NYJA 4U04A 5ANLA 3ML9A 5FQ6A 4RLYA 5G05C 1AWCB 1NP7A 3CVPA 4O6FA 1SW6A 2ETBA 4DRXE 5CCMA 1MX6A 2XPYA 3PZ3A 1HZ4A 4A1SA 3MYVA 3ISMC 4HLEA 4BSZB 2X38A 3JCKC 3J5QB 3FUIA 3ABME 3Q7AA 1D9SA 3FTUA 1NZNA 3PDNA 1OCRE 3URZA 4U7EB 5AJLA 3HDXA 2GRPB 3SBSA 4AV7A 5KNGA 1HS6A 3UIPC 3AG3E 3CK9A 1U3CA 2Y1LE 3FTYA 4GA2A 3MV2B 2MOWA 5CMYA 4KXKB 2BF0X 3SFZA 2PNNA 3Q49B 4XX5A 3D9MA 4J8SA 1E96B 2NXPA 3DWLG 3L82A 3FTSA 3CQGB 3FU6A 2QYJA 2EIKE 1QBQA 4GTMA 4JEHA 3DSTA 2YHCA 3PVLA 4BT9A 4GU5A 5JA4D 3D9PA 2DVWA 4HORA 3EJNA 3OXLA 4ZFHA 4WNFA 1S70B 3I3NA 4J8YA 2XZTG 3PE3A 1HU3A 3CVNA 4DI4A 4QQIA 5JJTA 2PQRA 3UQ3A 4BT8A 1YMPA 3ESLA 2F0YA 4GA0A 4LSZE 3TWVA 4L2YA 5AQ9A 3NOCD 5ITZF 3BG0B 4L1BA 4Q94A 3FU0A 2KC7A 3CHMA 4FJZA 3IXEA 1EF1C 3V30A 4PS7A 4U07A 4YDYA 5BPPA 4WWPA 2KBXA 2RG8A 4GTQA 2XS8A 2V0PA 4PS8A 3CGHA 4TXPA 3U4TA 3ZYLA 3ULEG 2IFUA 4BSXA 4XI9A 2VGYA 4G8LA 2DCPA 2DWZA 1SZ9A 1K1BA 2X6IA 5KCMA 4FP7A 3RU0A 2QC9A 4M3OA 3CK7A 4UWHA 3I4GA 1H19A 3ASHA 1KLXA 4ABNA 3W9GA 3CKBA 3S2AA 2V8SE 4G11A 4C0EA 3LYAA 3CVXA 1OY3D 2WM9A 4GAAA 1TN7A 2DBAA 1IHGA 2V5QC 3HXBA 3LVQE 4ILGA 4OVUA 2NSZA 3D9KA 2X6JA 3EHMA 2P9LG 2R17C 3UM0A 3O4ZA 3LS8A 3P2BA 3TWWA 4U0ZA 1Z3XA 1MJ0A 4HFGA 3TL5A 4FA6A 2XCCA 1N0RA 2B6CA 3NOGD 2AW6A 4H7XA 3TWUA 4A3VA 3CIAA 3UTMA 3DSSA 4L9PA 5D2MC 4RSYA 3SBTB 3CHQA 3NZSA 4L23A 1HE8A 4IN3B 5LP0A 2FF4A 2WB2A 1S64A 1D8DA 2IEJA 4KVOA 3VLEA 2AXZA 1OCZE 3X2QE 4U95D 2IOLA 2J08A 2IY0C 3LY9A 4UI9K 3PEUB 3DEOA 3E34A 1XNFA 1UN9A 3SI5A 3TXNA 2RFMA 2I6HA 1OWMA 4CZ2D 3Q9NC 4B8AA 4MS6A 1A17A 1S63A 2J49A 2M63A 4GTPA 5CRVA 4K0RA 3T8MA 2XQ0A 1N54A 2WXPA 1LD8A 2KZTA 3UXGA 2VYIA 4W9RA 3KS2A 4CRWA 4CDMA 2B0OE 4J8FA 2XEHA 1U2VG 4WNGA 4HI8A 5AARA 2P9NG 1H6PA 5AQ7A 3SFXA 1H2TC 4OYSA 4J0UA 3VLDA 4JEUA 3G2VA 3CHSA 5FIOA 4N3CA 4B8CB 4GPKA 4OAUC 4TUMA 4BFRA 2FULA 2WXGA 2KM4A 4HB5A 4UWGA 1O1SA 3TWTA 4K03A 1JCRA 3SQVA 1MYOA 3U9WA 4NIKA 1UJJA 4N5QA 3VTXA 4I2ZA 1E8ZA 1H2UA 2XGOA 3BG1B 5FINA 1WM5A 1N95A 4U8HA 3NF1A 4N39A 1A5EA 2VSXE 5FZSA 2WVIA 5G55A 3GZSA 3UI2A 3SF4A 4APFA 1FT2A 5EKQD 3L54A 3ASGA 1JCSA 4LNBA 2Y0BG 3ONKA 1RW2A 1BPOA 2CG3A 2L0TB 2X6HA 3S7JA 4A63B 3EIJA 4ANWA 3U64A 1H0AA 1ZBPA 3BEEA 1DC2A 1MZCA 2IO3C 3SZ7A 5KJLA 5A23A 2XPZA 3TXMA 4LUNU 5KBAA 3CK8A 1IQUA 4KMOA 3TWRA 4U63A 5D66A 2ZGGA 4GYOA 1BD8A 3TG5A 3NAWA 1NA0A 5CRUA 2ZISA 2VTBA 2UY1A 5CMWA 1HO8A 3Q47B 4K5BA 5ENOD 5DBKA 3RK6A 2DZNA 3PZ4A 3JXJA 4FLBA 5HKPA 3UKUG 3FUKA 1D8EA 1VDYA 4BERA 3KSLA 3IHVA 4LEUA 2LXLA 2IONA 4WNDA 5EDSA 1UOHA 3FEYA 3UT7A 2LNIA 4E6HA 3Q4AB 3FU3A 1OT8A 4K5CA 3AAAC 3SGHA 4I6GA 3T5VA 3SD5A 4FHJA 4DX5D 2P2CP 4FULA 1TEZA 4UWKA 3DSVA 4AOFA 4JB8P 3LJ3A 5JJ7A 3BQOA 2WXOA 1KPSB 3Q73A 4UI9C 2KZTB 5KJKA 3D9HA 1LTXA 1PY1A 1PAQA 1LD7A 2GRLA 3ASDA 3PE4A 1HXIA 3JYSA 2KCVA 3OXGA 3EIQC 5G04C 4AJWA 4BX9A 4I9CA 3HG0D 4U0UA 5FQ7A 4IRUA 2HE0A 4V3IA 4GTRA 4APOA 2BKGA 3FFLA 2MRIA 4L7TA 2XEEA 2GRRB 5AAOA 3L6AA 4I9EA 3I4RB 1N52A 3SHFA 2R05A 1IQRA 3G2WA 1YYHA 3C5RA 1FVHA 4ILHB 1ZB1A 3EHQA 4I2WA 3SNXA 3QC1A 4BESA 3L13A 5J90A 1BLXB 1N11A 5E75A 4B0ZA 3RRMB 4LCTA 2XGMA 1Z6TA 3FH5A 3G2TA 3SY2A 2I9CA 3QAQA 1H2VC 1TNOA 3PREA 3APCA 3C3QA 2X3MA 3DSUA 4NQ0A 2WXFA 3ASNE 5EILA 1L5JA 2WXQA 3NBNB 3FUMA 1HX8A 1OWOA 2NC9A 1YCSB 4P29A 1K8KG 2EIME 4RG9A 3EHRA 1JWGA 1HF8A 3NQPA 2WXIA 5C2YA 4BTAA 2V5FA 1WDYA 4GA1A 2QY7A 1Y6IA 1MQSA 3ZYQA 5JHAA 2RKKA 4GTVA 1ZU2A 2VTBB 4ME2A 2UY1B 2DZOA 2XZDG 3C3OA 2PL2A 4HRNA 4G2VA 4L2LA 3EHNA 5KNHD 3ZGQA 4HBDA 3ULYA 3Q5MA 2XPIA 4BETA 4CYMD 1DCQA 2BEDA 5T8IA 4FADA 3S7BA 4HVBA 4C9BB 3ZEFA 5EIDA 1ELWA 2ZU6B 4UUCA 2IU1A 2P9SG 3PNTB 1B89A 4LRZA 3FULA 1MHQA 4G25A 3TGOA 4TXRA 1BI8B 4H7YA 2YQ8A 3RO2A 4OAVB 1IXVA 4G23A 3E4BA 3ZIMA 5FJYA 3T5XA 4A1GA 2J09A 3ZPJA 5T4YA 1X5BA 2PM6A 3FTVA 3FHEA 4HS2A 5CERB 4ILIA 2OCCE 4LG6A 5CECB 3UPVA 3CKCA 3UM2A 1RZ4A 1HG2A 3ZYMA 1U3DA 2OVFA 4A55A 3FUFA 4HRMB 5LX8A 3ESKA 1TN8A 3OAWA 2OOEA 4BEPA 5CEAA 1UJKA 3TJPA 5EYLA 2HO1A 4NURA 1E90A 3C98A 5ENSD 2LSUA 5FWQA 4UI9J 3B7TA 4CT0A 2PZIA 2MHKA 2CHXA 2HR2A 2J8SD 4HOQA 4DLOA 1TYQG 5CBNA 2IQCA 3C3RA 3FUDA 3ZNGA 3PNLB 3QKYA 3HXDA 3QWVA 4XKCA 5ENQD 5G04J 2OEVA 4GTTA 3QOUA 4EHMA 2FEZA 4F1SA 4WWNA 1LF8A 4KZ0A 5HI7A 2DYSE 1SQMA 2C0MA 5KWDA 5LFAA 3U66A 4HNAD 4EBAG 5BV0A 2ZIRA 4O1PA 4GB9A 4F1PA 4LNGA 4JD2G 2GRMA 2E2EA 4EZLA 2CG2A 5CBOA 3HHMA 5G2NA 3EUVA 5HRYA 5HS0A 3FP3A 4EECA 2Y3AA 4WNEA 4WUYA 4RVBA 1JWFA 4MKTA 2WQHA 1TR4A 5G05J 3WXXA 2F37A 3UT4A 4RQIA 5CCLA 1QYMA 1NFIE 3VLFA 4XE0A 2VSNA 3DBSA 4UQXA 2XHEA 3W9FA 5KJMA 3S7FA 3LEWA 4JA9A 3FUJA 2XRYA 4AEZC 5CEDB 5EIBE 1O1TA 3AG4E 5M72A 3ZVVA 4HXIA 2VSYA 2WMNA 4HOTA 3AS5A 3HVEA 1O5MA 4GMLA 4XZ4A 3DXKG 3T9KA 2IOSA 3ZHEA 2EIJE 5A7DB 5HQ8A 3CVWA 2R03A 3UIOC 1FVFA 1N0QA 3V79K 5JJ6A 3GW4A 2IJGX 3FTXA 4N2SA 4G24A 1N4RA 5A6CA 4Z68A 1N94A 2BUGA 2KCKA 2RD0A 1Y8MA 2KXPC 4O60A 3QB2A 4GZ6A 1Z5SC 1Q2ZA 4WAFA 3RO3A 4GCNA 4F6RD 2P9IG 3FDHA 2XCBA 4I6EA 4JHKA 4JA7A 2P9UG
chains in the Genus database with same CATH topology
1LD7A 1S63A 1SA4A 3C72A 1TNYA 1O1RA 4GTPA 1N4PA 4GTVA 3EU5A 3E37A 1SA5A 4MBGA 1LD8A 1MZCA 1QBQA 3KSQA 4GTMA 3HXFA 1FPPA 3DSWA 1TN8A 3DSTA 4GTRA 1N4QA 1TN7A 3SFYA 3SFXA 4YDEA 1TNUA 3HXBA 3E32A 2ZISA 4GTSA 1NI1A 1O1TA 1JCQA 3Q79A 1TNBA 3PZ1A 3Q75A 2H6GA 3E30A 3PZ4A 3DPYA 2F0YA 3HXDA 2BEDA 1KZPA 3Q7FA 1D8EA 1FT1A 3DSXA 3KSLA 1O5MA 3PZ3A 1O1SA 4GTTA 1DCEA 1JCRA 4EHMA 3DSSA 4GTOA 4L9PA 3Q7AA 3HXCA 1TNOA 1X81A 3E33A 1TN6A 2H6HA 1S64A 1D8DA 1N95A 2IEJA 1N4RA 3DSUA 2ZIRA 4GTQA 1N9AA 4LNGA 3DRAA 1LTXA 1N94A 1FT2A 2H6FA 1NL4A 3DSVA 3Q78A 1TNZA 3E34A 3PZ2A 1JCSA 4LNBA 1KZOA 3HXEA 3Q73A 1N4SA 4YDOA 3EUVA 2H6IA 2R2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD7 A;  1S63 A;  1SA4 A;  3C72 A;  1TNY A;  1O1R A;  4GTP A;  1N4P A;  4GTV A;  3EU5 A;  3E37 A;  1SA5 A;  4MBG A;  1LD8 A;  1MZC A;  1QBQ A;  3KSQ A;  4GTM A;  3HXF A;  1FPP A;  3DSW A;  1TN8 A;  3DST A;  4GTR A;  1N4Q A;  1TN7 A;  3SFY A;  3SFX A;  4YDE A;  1TNU A;  3HXB A;  3E32 A;  2ZIS A;  4GTS A;  1NI1 A;  1O1T A;  1JCQ A;  3Q79 A;  1TNB A;  3PZ1 A;  3Q75 A;  2H6G A;  3E30 A;  3PZ4 A;  3DPY A;  2F0Y A;  3HXD A;  2BED A;  1KZP A;  3Q7F A;  1D8E A;  1FT1 A;  3DSX A;  3KSL A;  1O5M A;  3PZ3 A;  1O1S A;  4GTT A;  1DCE A;  1JCR A;  4EHM A;  3DSS A;  4GTO A;  4L9P A;  3Q7A A;  3HXC A;  1TNO A;  1X81 A;  3E33 A;  1TN6 A;  2H6H A;  1S64 A;  1D8D A;  1N95 A;  2IEJ A;  1N4R A;  3DSU A;  2ZIR A;  4GTQ A;  1N9A A;  4LNG A;  3DRA A;  1LTX A;  1N94 A;  1FT2 A;  2H6F A;  1NL4 A;  3DSV A;  3Q78 A;  1TNZ A;  3E34 A;  3PZ2 A;  1JCS A;  4LNB A;  1KZO A;  3HXE A;  3Q73 A;  1N4S A;  4YDO A;  3EUV A;  2H6I A;  2R2L A; 
#chains in the Genus database with same CATH topology
 2VSO E;  2A5U A;  1TNY A;  4X8Q A;  2JEK A;  4PDX A;  3E37 A;  4TXQ A;  3CEQ A;  4KYO B;  2GRN B;  4G8K A;  4BWR A;  4F7A A;  3FTZ A;  5ARG A;  3LY8 A;  4JHJ A;  1DNP A;  3GZ2 A;  1JPL A;  2Y69 E;  3CHR A;  3LY7 A;  4JVS A;  5AIJ A;  3AU4 A;  4YDE A;  2E0I A;  3JQ1 A;  4LNU D;  2LXM A;  4UWF A;  3PUK A;  4XIF A;  4GPM A;  5BT1 A;  3L08 A;  3N71 A;  4DLQ A;  5AQB A;  3CST A;  3Q75 A;  3MX3 A;  3V2X A;  4XKB A;  4DI3 A;  3NB2 A;  4Y6W A;  2PM7 A;  3DPD A;  5BV1 A;  2ZGD A;  3B7B A;  3DSX A;  5AYW D;  5FT9 A;  4ACL A;  4MLP A;  1DCE A;  2R5S A;  2GW1 A;  4GTO A;  2WXH A;  2WPV A;  2WXJ A;  3T8K A;  4GYY A;  1TN6 A;  2OVB A;  4I6J A;  2WXK A;  4GZ5 A;  2AJA A;  4EZJ A;  4ANU A;  2L9B A;  3QWW A;  2FO1 E;  4XI0 A;  3MGB A;  4I43 A;  2C2L A;  4KT6 B;  4CGV A;  4YDW A;  1QNF A;  2HYZ A;  3FUE A;  2ILR A;  1QQE A;  5FQ4 A;  2CFZ A;  1UG3 A;  4BTB A;  3IV0 A;  1KT1 A;  3EDT B;  1O1R A;  4GMR A;  4GZ3 A;  3HRA A;  4DX6 D;  4OVV A;  3FH8 A;  4QFV A;  4ACK A;  3GZ1 A;  4Y6C A;  3DSW A;  2GRQ B;  3VTY A;  4PH4 B;  5EN5 D;  3MKR A;  3R7Q A;  2KAT A;  3OTN A;  3MA5 A;  4ATZ D;  2I1J A;  5BXU A;  4AY6 A;  1E7U A;  4N2Q A;  2OND A;  3ABK E;  3PUJ A;  2C0L A;  4BY6 A;  2L6B A;  2P58 C;  4U8V D;  4J8D A;  3ZHE B;  3CR3 A;  4AIF A;  1IHB A;  1NA3 A;  3DPY A;  4I1O B;  2CHZ A;  3R9M A;  3ZFW A;  3EU9 A;  3KD7 A;  4KZC A;  3RSE G;  3R7R A;  3MJW A;  3FU5 A;  4HI9 A;  3APF A;  3LJN A;  2IO2 C;  3E33 A;  2MYO A;  3PS6 A;  1PC2 A;  3F6Q A;  2A4Z A;  4R7L A;  5ENN A;  4DPR A;  1NL4 A;  3AJI A;  5JMN D;  4GMJ A;  5FTP A;  1P5Q A;  3ML8 A;  3R9A B;  2QZA A;  4I1A A;  2DIW A;  2LAI A;  5EX3 A;  5BW8 C;  3L22 A;  1IKN D;  1XGW A;  4J8E A;  1OCO E;  3I5P A;  3EU5 A;  2J07 A;  2I2O A;  2AXU A;  4GYW A;  1GW6 A;  3KSQ A;  3TWQ A;  4KBQ A;  3FUH A;  2YIN A;  5B1A E;  2L6J A;  2FBN A;  4F53 A;  2WXM A;  2XEN A;  3UM3 A;  2EQX A;  3DXM G;  3LXU X;  2I1K A;  4JC8 A;  4DUI A;  2WXL A;  3MZL B;  5B1B E;  4AM9 A;  3B7S A;  1K3Z D;  4HOS A;  1WY6 A;  4IUL A;  1FCH A;  3ONL A;  2Q7F A;  4IYP A;  1HG5 A;  3FTW A;  4B93 B;  3CHP A;  4N3B A;  1HH8 A;  3MCX A;  5ENR D;  3PH0 C;  3B13 A;  1TJF A;  3B7U X;  3ZRH A;  3FWV A;  3KEA A;  4PS3 A;  3LDZ A;  3OXF A;  1N9A A;  2H6F A;  3SO8 A;  3GYZ A;  1DVP A;  2VQ2 A;  3FEX A;  1BI7 B;  4Q69 A;  3FUN A;  2QFC A;  1OCC E;  3ENE A;  1EYH A;  3IBE A;  3APD A;  1SZA A;  3ZXS A;  2YNQ A;  2YHE A;  5AJD A;  4MRU A;  5ARF A;  2Y4T A;  1HFA A;  4ZHB A;  3HXF A;  4I1M A;  2V4L A;  3PEV B;  3JXI A;  1FPP A;  3RAU A;  3CVV A;  3ZUV B;  2V4H C;  3CVY A;  1G3N B;  5AQA A;  4JL0 A;  4AXH A;  3SFY A;  2WXR A;  2IF4 A;  1TNU A;  1EDU A;  3UKR G;  5FZQ A;  4A3T A;  3K9I A;  4C0M A;  3HIZ A;  2XRZ A;  5EYP F;  5ENP D;  4FJY A;  2PQN A;  4PUC A;  2FI7 A;  2H6G A;  5DIZ A;  3RIB A;  4F3V A;  3BUA A;  1KZP A;  3D9L A;  1QZ2 A;  3CHO A;  4G1T A;  4I17 A;  2XGS A;  3V2O A;  4J6I A;  4N5C A;  3HXC A;  3MKQ A;  5JHB A;  3B95 A;  4LER A;  5H7P A;  2ZXW E;  4N3A A;  3S7D A;  1H6K A;  3DRA A;  3U3W A;  3WG7 E;  4D10 C;  4JW1 A;  3JQ0 A;  4K5A B;  3PRZ A;  2J4B A;  2WQ7 A;  1AP7 A;  4NRH B;  4ATG A;  4E85 A;  2JLB A;  4YDO A;  3CV0 A;  1IYG A;  2GGF A;  2WQ6 A;  3ZW3 A;  4M7C A;  4EPZ A;  3AG2 E;  1SA4 A;  4DX7 D;  5T3R A;  4MBG A;  1V55 E;  3CQC B;  3UM1 A;  4B94 A;  3FH7 A;  4YND A;  4URK A;  4WWO A;  1K1A A;  3D9I A;  4NAC A;  2VGX A;  1INZ A;  1S0P A;  3Q15 A;  5LCW C;  2A5E A;  2WMO A;  1WG0 A;  4KVM A;  3Q79 A;  2CHW A;  1UW4 B;  2ETA A;  4RG6 A;  3QJZ A;  3RRU A;  4XEI G;  2LAH A;  2LSV A;  4CDN A;  2XEV A;  4TUU A;  3KEZ A;  1E8X A;  1YA0 A;  2RFA A;  4JPS A;  5D0Q D;  4JXT A;  5E76 A;  3TG4 A;  2AWI A;  4BX8 A;  1OUV A;  4ANX A;  2P9P G;  5ANR A;  5LOZ A;  3UIN C;  3G2S A;  3UMV A;  3ZKJ A;  4YVQ C;  3RJV A;  3ULQ A;  4JHR A;  1H6O A;  3G2U A;  5C1D A;  3TWS A;  3ZU7 B;  2R59 A;  5KJN A;  3PZ2 A;  1KZO A;  5ENT D;  1N4S A;  3NZU A;  3L17 A;  3L16 A;  2R2L A;  5BNW A;  1KT0 A;  3ASF A;  1SA5 A;  3BU8 A;  3D9J A;  1W3B A;  5B3S E;  3CLJ A;  5AEN A;  3RRN B;  1SVX A;  1V54 E;  1N4Q A;  2OEW A;  3FY4 A;  4DX1 A;  1NI1 A;  4HQD A;  3ABL E;  2GRO B;  1JCQ A;  4CT4 A;  3IKO B;  1OWL A;  3MEK A;  3E30 A;  4UQZ A;  3B7R L;  3MKQ B;  2AXV A;  2JAB A;  3Q7F A;  5BXO A;  1FT1 A;  4DJA A;  4HLL A;  1BU9 A;  4HOU A;  4GZD A;  5FZR A;  2LO6 A;  1X81 A;  4AY5 A;  1WAO 1;  2H6H A;  3CSF A;  3QDN A;  3AS8 A;  3LCA A;  3QNK A;  4TRQ A;  2UWJ G;  3DEP A;  4Q96 A;  4AP2 A;  5D0O D;  3UUX A;  1TNZ A;  4EBA A;  3LVR E;  3LPZ A;  3HXE A;  2J4D A;  2KCL A;  3CVQ A;  3ZXP A;  2H6I A;  4GCO A;  2OV8 A;  3IHY A;  2WXN A;  3J5P A;  1E8W A;  2VGX B;  4ANV A;  1ELR A;  2CFU A;  3CVL A;  1N4P A;  1TJC A;  2J9Q A;  5J08 A;  3JUE A;  5CHE E;  4O1O A;  3AS4 A;  3Q9U C;  4JZY A;  3JUI A;  3ZN3 A;  4G26 A;  3TWX A;  4C48 B;  5AN8 A;  2P9K G;  3E32 A;  4GTS A;  2Y4U A;  3LKU A;  4AVX A;  1TNB A;  3PZ1 A;  4CEM A;  1E7V A;  4FU3 A;  4U96 D;  3CVU A;  3PZD A;  2BTD A;  3IEG A;  3RKV A;  1Z3Y A;  3D9N A;  4HRL A;  2LUH A;  4U8Y D;  4U0S A;  2ETC A;  3QAR A;  3HVE B;  4UQY A;  2DYR E;  2VGE A;  2EIL E;  3UX4 A;  5LCW J;  1MX2 A;  4J7W A;  4GZC A;  5EX0 A;  5BUZ A;  1ELK A;  2XS1 A;  2AVP A;  3P1U A;  2R02 A;  4FC8 A;  1OWP A;  2F8Y A;  2VJ8 A;  3L9T A;  5IY5 E;  1OXJ A;  1JUQ A;  3Q78 A;  2F8X K;  2X6F A;  3D3M A;  4EQF A;  4UWL A;  4DX2 A;  4TV3 A;  2FO7 A;  3AG1 E;  4DK5 A;  3ASO E;  5FQ8 A;  2QYU A;  3ZYK A;  4CDR A;  3C72 A;  4EZK A;  2L0I A;  4CCA A;  4FHK A;  3TAX A;  4B89 A;  2EIN E;  3UT8 A;  3QK0 A;  4FLH A;  3MV3 B;  3QWP A;  3O48 A;  2BKK B;  1MX4 A;  3HYM B;  2HM8 A;  3D9O A;  3V31 A;  4CGW A;  1E8Y A;  3KAE A;  2X6K A;  4YVO A;  1UN8 A;  1OWN A;  1EPU A;  3AU5 A;  2NYJ A;  4U04 A;  5ANL A;  3ML9 A;  5FQ6 A;  4RLY A;  5G05 C;  1AWC B;  1NP7 A;  3CVP A;  4O6F A;  1SW6 A;  2ETB A;  4DRX E;  5CCM A;  1MX6 A;  2XPY A;  3PZ3 A;  1HZ4 A;  4A1S A;  3MYV A;  3ISM C;  4HLE A;  4BSZ B;  2X38 A;  3JCK C;  3J5Q B;  3FUI A;  3ABM E;  3Q7A A;  1D9S A;  3FTU A;  1NZN A;  3PDN A;  1OCR E;  3URZ A;  4U7E B;  5AJL A;  3HDX A;  2GRP B;  3SBS A;  4AV7 A;  5KNG A;  1HS6 A;  3UIP C;  3AG3 E;  3CK9 A;  1U3C A;  2Y1L E;  3FTY A;  4GA2 A;  3MV2 B;  2MOW A;  5CMY A;  4KXK B;  2BF0 X;  3SFZ A;  2PNN A;  3Q49 B;  4XX5 A;  3D9M A;  4J8S A;  1E96 B;  2NXP A;  3DWL G;  3L82 A;  3FTS A;  3CQG B;  3FU6 A;  2QYJ A;  2EIK E;  1QBQ A;  4GTM A;  4JEH A;  3DST A;  2YHC A;  3PVL A;  4BT9 A;  4GU5 A;  5JA4 D;  3D9P A;  2DVW A;  4HOR A;  3EJN A;  3OXL A;  4ZFH A;  4WNF A;  1S70 B;  3I3N A;  4J8Y A;  2XZT G;  3PE3 A;  1HU3 A;  3CVN A;  4DI4 A;  4QQI A;  5JJT A;  2PQR A;  3UQ3 A;  4BT8 A;  1YMP A;  3ESL A;  2F0Y A;  4GA0 A;  4LSZ E;  3TWV A;  4L2Y A;  5AQ9 A;  3NOC D;  5ITZ F;  3BG0 B;  4L1B A;  4Q94 A;  3FU0 A;  2KC7 A;  3CHM A;  4FJZ A;  3IXE A;  1EF1 C;  3V30 A;  4PS7 A;  4U07 A;  4YDY A;  5BPP A;  4WWP A;  2KBX A;  2RG8 A;  4GTQ A;  2XS8 A;  2V0P A;  4PS8 A;  3CGH A;  4TXP A;  3U4T A;  3ZYL A;  3ULE G;  2IFU A;  4BSX A;  4XI9 A;  2VGY A;  4G8L A;  2DCP A;  2DWZ A;  1SZ9 A;  1K1B A;  2X6I A;  5KCM A;  4FP7 A;  3RU0 A;  2QC9 A;  4M3O A;  3CK7 A;  4UWH A;  3I4G A;  1H19 A;  3ASH A;  1KLX A;  4ABN A;  3W9G A;  3CKB A;  3S2A A;  2V8S E;  4G11 A;  4C0E A;  3LYA A;  3CVX A;  1OY3 D;  2WM9 A;  4GAA A;  1TN7 A;  2DBA A;  1IHG A;  2V5Q C;  3HXB A;  3LVQ E;  4ILG A;  4OVU A;  2NSZ A;  3D9K A;  2X6J A;  3EHM A;  2P9L G;  2R17 C;  3UM0 A;  3O4Z A;  3LS8 A;  3P2B A;  3TWW A;  4U0Z A;  1Z3X A;  1MJ0 A;  4HFG A;  3TL5 A;  4FA6 A;  2XCC A;  1N0R A;  2B6C A;  3NOG D;  2AW6 A;  4H7X A;  3TWU A;  4A3V A;  3CIA A;  3UTM A;  3DSS A;  4L9P A;  5D2M C;  4RSY A;  3SBT B;  3CHQ A;  3NZS A;  4L23 A;  1HE8 A;  4IN3 B;  5LP0 A;  2FF4 A;  2WB2 A;  1S64 A;  1D8D A;  2IEJ A;  4KVO A;  3VLE A;  2AXZ A;  1OCZ E;  3X2Q E;  4U95 D;  2IOL A;  2J08 A;  2IY0 C;  3LY9 A;  4UI9 K;  3PEU B;  3DEO A;  3E34 A;  1XNF A;  1UN9 A;  3SI5 A;  3TXN A;  2RFM A;  2I6H A;  1OWM A;  4CZ2 D;  3Q9N C;  4B8A A;  4MS6 A;  1A17 A;  1S63 A;  2J49 A;  2M63 A;  4GTP A;  5CRV A;  4K0R A;  3T8M A;  2XQ0 A;  1N54 A;  2WXP A;  1LD8 A;  2KZT A;  3UXG A;  2VYI A;  4W9R A;  3KS2 A;  4CRW A;  4CDM A;  2B0O E;  4J8F A;  2XEH A;  1U2V G;  4WNG A;  4HI8 A;  5AAR A;  2P9N G;  1H6P A;  5AQ7 A;  3SFX A;  1H2T C;  4OYS A;  4J0U A;  3VLD A;  4JEU A;  3G2V A;  3CHS A;  5FIO A;  4N3C A;  4B8C B;  4GPK A;  4OAU C;  4TUM A;  4BFR A;  2FUL A;  2WXG A;  2KM4 A;  4HB5 A;  4UWG A;  1O1S A;  3TWT A;  4K03 A;  1JCR A;  3SQV A;  1MYO A;  3U9W A;  4NIK A;  1UJJ A;  4N5Q A;  3VTX A;  4I2Z A;  1E8Z A;  1H2U A;  2XGO A;  3BG1 B;  5FIN A;  1WM5 A;  1N95 A;  4U8H A;  3NF1 A;  4N39 A;  1A5E A;  2VSX E;  5FZS A;  2WVI A;  5G55 A;  3GZS A;  3UI2 A;  3SF4 A;  4APF A;  1FT2 A;  5EKQ D;  3L54 A;  3ASG A;  1JCS A;  4LNB A;  2Y0B G;  3ONK A;  1RW2 A;  1BPO A;  2CG3 A;  2L0T B;  2X6H A;  3S7J A;  4A63 B;  3EIJ A;  4ANW A;  3U64 A;  1H0A A;  1ZBP A;  3BEE A;  1DC2 A;  1MZC A;  2IO3 C;  3SZ7 A;  5KJL A;  5A23 A;  2XPZ A;  3TXM A;  4LUN U;  5KBA A;  3CK8 A;  1IQU A;  4KMO A;  3TWR A;  4U63 A;  5D66 A;  2ZGG A;  4GYO A;  1BD8 A;  3TG5 A;  3NAW A;  1NA0 A;  5CRU A;  2ZIS A;  2VTB A;  2UY1 A;  5CMW A;  1HO8 A;  3Q47 B;  4K5B A;  5ENO D;  5DBK A;  3RK6 A;  2DZN A;  3PZ4 A;  3JXJ A;  4FLB A;  5HKP A;  3UKU G;  3FUK A;  1D8E A;  1VDY A;  4BER A;  3KSL A;  3IHV A;  4LEU A;  2LXL A;  2ION A;  4WND A;  5EDS A;  1UOH A;  3FEY A;  3UT7 A;  2LNI A;  4E6H A;  3Q4A B;  3FU3 A;  1OT8 A;  4K5C A;  3AAA C;  3SGH A;  4I6G A;  3T5V A;  3SD5 A;  4FHJ A;  4DX5 D;  2P2C P;  4FUL A;  1TEZ A;  4UWK A;  3DSV A;  4AOF A;  4JB8 P;  3LJ3 A;  5JJ7 A;  3BQO A;  2WXO A;  1KPS B;  3Q73 A;  4UI9 C;  2KZT B;  5KJK A;  3D9H A;  1LTX A;  1PY1 A;  1PAQ A;  1LD7 A;  2GRL A;  3ASD A;  3PE4 A;  1HXI A;  3JYS A;  2KCV A;  3OXG A;  3EIQ C;  5G04 C;  4AJW A;  4BX9 A;  4I9C A;  3HG0 D;  4U0U A;  5FQ7 A;  4IRU A;  2HE0 A;  4V3I A;  4GTR A;  4APO A;  2BKG A;  3FFL A;  2MRI A;  4L7T A;  2XEE A;  2GRR B;  5AAO A;  3L6A A;  4I9E A;  3I4R B;  1N52 A;  3SHF A;  2R05 A;  1IQR A;  3G2W A;  1YYH A;  3C5R A;  1FVH A;  4ILH B;  1ZB1 A;  3EHQ A;  4I2W A;  3SNX A;  3QC1 A;  4BES A;  3L13 A;  5J90 A;  1BLX B;  1N11 A;  5E75 A;  4B0Z A;  3RRM B;  4LCT A;  2XGM A;  1Z6T A;  3FH5 A;  3G2T A;  3SY2 A;  2I9C A;  3QAQ A;  1H2V C;  1TNO A;  3PRE A;  3APC A;  3C3Q A;  2X3M A;  3DSU A;  4NQ0 A;  2WXF A;  3ASN E;  5EIL A;  1L5J A;  2WXQ A;  3NBN B;  3FUM A;  1HX8 A;  1OWO A;  2NC9 A;  1YCS B;  4P29 A;  1K8K G;  2EIM E;  4RG9 A;  3EHR A;  1JWG A;  1HF8 A;  3NQP A;  2WXI A;  5C2Y A;  4BTA A;  2V5F A;  1WDY A;  4GA1 A;  2QY7 A;  1Y6I A;  1MQS A;  3ZYQ A;  5JHA A;  2RKK A;  4GTV A;  1ZU2 A;  2VTB B;  4ME2 A;  2UY1 B;  2DZO A;  2XZD G;  3C3O A;  2PL2 A;  4HRN A;  4G2V A;  4L2L A;  3EHN A;  5KNH D;  3ZGQ A;  4HBD A;  3ULY A;  3Q5M A;  2XPI A;  4BET A;  4CYM D;  1DCQ A;  2BED A;  5T8I A;  4FAD A;  3S7B A;  4HVB A;  4C9B B;  3ZEF A;  5EID A;  1ELW A;  2ZU6 B;  4UUC A;  2IU1 A;  2P9S G;  3PNT B;  1B89 A;  4LRZ A;  3FUL A;  1MHQ A;  4G25 A;  3TGO A;  4TXR A;  1BI8 B;  4H7Y A;  2YQ8 A;  3RO2 A;  4OAV B;  1IXV A;  4G23 A;  3E4B A;  3ZIM A;  5FJY A;  3T5X A;  4A1G A;  2J09 A;  3ZPJ A;  5T4Y A;  1X5B A;  2PM6 A;  3FTV A;  3FHE A;  4HS2 A;  5CER B;  4ILI A;  2OCC E;  4LG6 A;  5CEC B;  3UPV A;  3CKC A;  3UM2 A;  1RZ4 A;  1HG2 A;  3ZYM A;  1U3D A;  2OVF A;  4A55 A;  3FUF A;  4HRM B;  5LX8 A;  3ESK A;  1TN8 A;  3OAW A;  2OOE A;  4BEP A;  5CEA A;  1UJK A;  3TJP A;  5EYL A;  2HO1 A;  4NUR A;  1E90 A;  3C98 A;  5ENS D;  2LSU A;  5FWQ A;  4UI9 J;  3B7T A;  4CT0 A;  2PZI A;  2MHK A;  2CHX A;  2HR2 A;  2J8S D;  4HOQ A;  4DLO A;  1TYQ G;  5CBN A;  2IQC A;  3C3R A;  3FUD A;  3ZNG A;  3PNL B;  3QKY A;  3HXD A;  3QWV A;  4XKC A;  5ENQ D;  5G04 J;  2OEV A;  4GTT A;  3QOU A;  4EHM A;  2FEZ A;  4F1S A;  4WWN A;  1LF8 A;  4KZ0 A;  5HI7 A;  2DYS E;  1SQM A;  2C0M A;  5KWD A;  5LFA A;  3U66 A;  4HNA D;  4EBA G;  5BV0 A;  2ZIR A;  4O1P A;  4GB9 A;  4F1P A;  4LNG A;  4JD2 G;  2GRM A;  2E2E A;  4EZL A;  2CG2 A;  5CBO A;  3HHM A;  5G2N A;  3EUV A;  5HRY A;  5HS0 A;  3FP3 A;  4EEC A;  2Y3A A;  4WNE A;  4WUY A;  4RVB A;  1JWF A;  4MKT A;  2WQH A;  1TR4 A;  5G05 J;  3WXX A;  2F37 A;  3UT4 A;  4RQI A;  5CCL A;  1QYM A;  1NFI E;  3VLF A;  4XE0 A;  2VSN A;  3DBS A;  4UQX A;  2XHE A;  3W9F A;  5KJM A;  3S7F A;  3LEW A;  4JA9 A;  3FUJ A;  2XRY A;  4AEZ C;  5CED B;  5EIB E;  1O1T A;  3AG4 E;  5M72 A;  3ZVV A;  4HXI A;  2VSY A;  2WMN A;  4HOT A;  3AS5 A;  3HVE A;  1O5M A;  4GML A;  4XZ4 A;  3DXK G;  3T9K A;  2IOS A;  3ZHE A;  2EIJ E;  5A7D B;  5HQ8 A;  3CVW A;  2R03 A;  3UIO C;  1FVF A;  1N0Q A;  3V79 K;  5JJ6 A;  3GW4 A;  2IJG X;  3FTX A;  4N2S A;  4G24 A;  1N4R A;  5A6C A;  4Z68 A;  1N94 A;  2BUG A;  2KCK A;  2RD0 A;  1Y8M A;  2KXP C;  4O60 A;  3QB2 A;  4GZ6 A;  1Z5S C;  1Q2Z A;  4WAF A;  3RO3 A;  4GCN A;  4F6R D;  2P9I G;  3FDH A;  2XCB A;  4I6E A;  4JHK A;  4JA7 A;  2P9U G; 
#chains in the Genus database with same CATH homology
 1LD7 A;  1S63 A;  1SA4 A;  3C72 A;  1TNY A;  1O1R A;  4GTP A;  1N4P A;  4GTV A;  3EU5 A;  3E37 A;  1SA5 A;  4MBG A;  1LD8 A;  1MZC A;  1QBQ A;  3KSQ A;  4GTM A;  3HXF A;  1FPP A;  3DSW A;  1TN8 A;  3DST A;  4GTR A;  1N4Q A;  1TN7 A;  3SFY A;  3SFX A;  4YDE A;  1TNU A;  3HXB A;  3E32 A;  2ZIS A;  4GTS A;  1NI1 A;  1O1T A;  1JCQ A;  3Q79 A;  1TNB A;  3PZ1 A;  3Q75 A;  2H6G A;  3E30 A;  3PZ4 A;  3DPY A;  2F0Y A;  3HXD A;  2BED A;  1KZP A;  3Q7F A;  1D8E A;  1FT1 A;  3DSX A;  3KSL A;  1O5M A;  3PZ3 A;  1O1S A;  4GTT A;  1DCE A;  1JCR A;  4EHM A;  3DSS A;  4GTO A;  4L9P A;  3Q7A A;  3HXC A;  1TNO A;  1X81 A;  3E33 A;  1TN6 A;  2H6H A;  1S64 A;  1D8D A;  1N95 A;  2IEJ A;  1N4R A;  3DSU A;  2ZIR A;  4GTQ A;  1N9A A;  4LNG A;  3DRA A;  1LTX A;  1N94 A;  1FT2 A;  2H6F A;  1NL4 A;  3DSV A;  3Q78 A;  1TNZ A;  3E34 A;  3PZ2 A;  1JCS A;  4LNB A;  1KZO A;  3HXE A;  3Q73 A;  1N4S A;  4YDO A;  3EUV A;  2H6I A;  2R2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...