1FT2A

Co-crystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FARNESYLTRANSFERASE
publication title Cocrystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ft2A00
4GTMA 1N94A 1LD8A 1N4RA 3HXDA 1KZOA 3PZ4A 1JCQA 3E32A 3Q78A 3E33A 4LNBA 1LD7A 1FT2A 3EU5A 1FPPA 3SFYA 3E30A 2H6HA 1TNZA 1X81A 3HXEA 3DSUA 1KZPA 4GTRA 4LNGA 3DSWA 2F0YA 3HXFA 1N4PA 1SA4A 1TNOA 2H6IA 3EUVA 4GTSA 3SFXA 1MZCA 3E34A 3KSQA 3HXBA 1TN7A 1NI1A 3DSSA 4GTPA 3Q7FA 4YDOA 1TNUA 4MBGA 2H6FA 2ZIRA 4GTTA 4GTVA 4L9PA 3Q7AA 1N4SA 1D8EA 1D8DA 3DRAA 3DSVA 2R2LA 2H6GA 1TN6A 3PZ1A 3DPYA 1TNYA 1FT1A 3C72A 3PZ2A 1O1TA 3HXCA 1N95A 1S64A 3Q79A 1JCSA 3PZ3A 1O5MA 1SA5A 1O1SA 1O1RA 1N4QA 1N9AA 4YDEA 1LTXA 4EHMA 1TN8A 1NL4A 1S63A 1DCEA 1JCRA 3E37A 2BEDA 3DSTA 4GTQA 3DSXA 3Q75A 2ZISA 1QBQA 3Q73A 2IEJA 3KSLA 4GTOA 1TNBA
chains in the Genus database with same CATH superfamily
4LSZE 3ULYA 1BLXB 1WDYA 2BKKB 3OXGA 4GMJA 4Q94A 2DYRE 2M63A 1IXVA 3DBSA 1IHBA 5ENQD 4GZ6A 1JWFA 1B89A 4M3OA 5FJYA 3G2WA 1E8WA 2I6HA 3NB2A 4UI9K 4WNFA 1H2VC 3HVEA 1P5QA 5AAOA 5CRVA 5BXOA 4J8SA 3LVQE 2HYZA 2WPVA 3PREA 4H7YA 3OXFA 3UKRG 2V4HC 5M72A 3C5RA 3FHEA 4A63B 4L23A 5FINA 1TNYA 4ANVA 3TWXA 1W3BA 2CHZA 3PZ2A 1IQRA 4U96D 1S64A 4UQYA 3ISMC 3T8MA 5DBKA 3JQ0A 4D10C 3IHYA 3WXXA 2AXZA 4GMRA 3E37A 1DC2A 3Q75A 1UW4B 3RIBA 1TYQG 3MA5A 5J90A 1OUVA 4AM9A 2A5EA 1N4RA 4YDYA 3LY7A 2XS1A 5EILA 1N11A 3MZLB 3CVVA 3PUJA 1Y6IA 5LCWJ 1FT2A 5HQ8A 4BTBA 4J7WA 3FWVA 5FT9A 3WG7E 1Z3YA 3QOUA 4UQXA 4GCOA 1H6KA 2PM6A 3CHSA 5E75A 2XGSA 2QC9A 4FJZA 2IQCA 2VJ8A 2LXMA 2J4BA 4RVBA 2VGEA 4U7EB 3JUEA 4J8FA 2OEWA 1G3NB 2I1JA 3TJPA 4B93B 1OCOE 1N4SA 1XGWA 4KZ0A 1D8DA 4UQZA 3FTUA 2H6GA 3HVEB 3PZ1A 3DPYA 2LAIA 4TUMA 3CSTA 3ENEA 1FT1A 2GRQB 3SO8A 4DI4A 3ZYMA 4EBAA 1IKND 1E8ZA 3Q79A 1O5MA 3PZ3A 4TV3A 2Y1LE 3Q4AB 4CT0A 1S63A 5AN8A 3PEUB 4I2ZA 4ZHBA 3OAWA 2IY0C 3JQ1A 5J08A 4HOSA 5ENSD 3KD7A 5BPPA 4HS2A 2V5FA 2P9PG 3X2QE 2PL2A 3I5PA 3EIQC 2AXUA 4R7LA 4ANXA 4I6JA 3JXJA 2X6HA 3PVLA 5EYLA 4URKA 2XRZA 3UPVA 2XGOA 3AS5A 2WXMA 3U64A 3MV2B 5FQ6A 4JL0A 1S0PA 2IU1A 4BX9A 4G2VA 4Z68A 2QZAA 1QZ2A 4GA2A 2WXIA 3OTNA 3C3RA 1NFIE 2L6JA 4BX8A 1INZA 1TNUA 4O6FA 2CG3A 4HB5A 4QFVA 2DZNA 5LOZA 1YCSB 1UJJA 3MEKA 2ZIRA 3UT7A 1UJKA 1BI7B 1FCHA 2V8SE 2WM9A 3PNLB 3CK9A 2GROB 4OVUA 5FZQA 3FUHA 3EU9A 3Q5MA 3F6QA 3NOCD 4W9RA 4HFGA 4N3BA 4Q96A 3HXCA 4N5CA 3LJ3A 3FUNA 1N4QA 3BQOA 2IO3C 3VTXA 1TN8A 3FEYA 4PS3A 5CMYA 5DIZA 4APFA 2AXVA 3FP3A 4ATZD 5HRYA 3Q49B 3EHNA 4HBDA 1MYOA 5KWDA 4HRNA 1MJ0A 1OY3D 3PS6A 3CVXA 4JB8P 3FUKA 3Q15A 3D9MA 2WXPA 3CVYA 4DX2A 2LUHA 3JCKC 2H6HA 4I1MA 2CFZA 2XPYA 3FU0A 4Q69A 2WXKA 4BFRA 5C1DA 1KZPA 5CBNA 3PEVB 2WMNA 3HYMB 4GCNA 2JLBA 3EUVA 4GPMA 3SFXA 2Q7FA 3KSQA 3UT4A 2ZU6B 1SZ9A 3CVQA 5JHBA 5HS0A 4YDOA 1FVFA 4IRUA 1KT0A 4GTTA 3D9IA 3UKUG 3C3QA 2GRNB 1EPUA 1N52A 1E7VA 3DRAA 3SGHA 1HE8A 3IKOB 5JHAA 4G8KA 3PE3A 5AQAA 2I1KA 2DIWA 5CECB 3GW4A 2B0OE 1JCSA 5KNGA 3ZHEB 4GA1A 1NL4A 3LDZA 3ZNGA 4L2YA 3C3OA 2F8YA 3TAXA 3R9MA 3UMVA 1LF8A 1KT1A 5FTPA 2ETBA 3JYSA 3FUJA 3MJWA 3FH8A 4GYYA 3EIJA 5AYWD 4N5QA 3ABME 3SBSA 4DUIA 5EYPF 3IBEA 1AWCB 5ARGA 4XKCA 2I9CA 3DEPA 5AQ9A 5EIBE 1EDUA 4UWLA 4GTRA 4AEZC 4GTSA 3ONLA 4BSXA 3APFA 4K03A 3ASFA 3ONKA 5AJDA 2R5SA 1TN7A 3ZU7B 2WXRA 3UINC 3QWPA 2J4DA 3NZSA 4U07A 3E4BA 2IJGX 4Y6CA 1GW6A 2AWIA 4G23A 2FF4A 3L54A 3ZUVB 3FUMA 4RQIA 2NYJA 5JA4D 2R2LA 2Y3AA 1O1TA 3G2SA 2FBNA 5ENNA 4GZDA 1PAQA 4EHMA 3AG1E 5KJNA 1DCEA 3CVPA 2EILE 3ZXPA 4JD2G 3LKUA 1DCQA 4F3VA 4ANUA 4UWHA 3KSLA 4JVSA 2GW1A 3T8KA 1FPPA 5FQ4A 4B8AA 4KYOB 4I6EA 3MV3B 3ABLE 1OCZE 3E33A 4LNBA 1LD7A 3EHMA 3EU5A 1PC2A 2PZIA 1BPOA 4F7AA 5B1BE 1MQSA 3AAAC 4WWNA 4FP7A 4EQFA 4CZ2D 3SZ7A 1YYHA 4G25A 1OXJA 4LG6A 3FTWA 3R9AB 2WXHA 1DVPA 4CYMD 3GYZA 4HLEA 4K5BA 2LAHA 2PQRA 3L22A 3U3WA 3MGBA 3HXBA 4FHKA 2GRLA 4U0ZA 2BUGA 4GTPA 4G26A 4MS6A 4BERA 3AU5A 5G04C 3B7SA 1Q2ZA 3DXMG 3EHRA 1E8XA 3ZIMA 3C98A 3AJIA 3HG0D 3UIOC 4PS8A 4ANWA 3UI2A 2XQ0A 3BU8A 3ZPJA 3CHMA 4JPSA 4CDNA 1HZ4A 2RFMA 2R59A 1N95A 3J5PA 4FLHA 1N0QA 1TJCA 4B0ZA 4WUYA 4XIFA 4CT4A 4AJWA 1YA0A 4WWOA 2ETAA 1QQEA 3CQGB 4KT6B 3SHFA 3Q47B 2ZISA 1HG5A 2IEJA 1JPLA 3GZ2A 3G2UA 4XE0A 3TL5A 3D9HA 3HXDA 5A6CA 2LXLA 3VTYA 4APOA 3UX4A 5EX0A 4I43A 3S7BA 3G2TA 4WNEA 4HXIA 2J9QA 3B7BA 3QWWA 5JJTA 5KCMA 4G11A 3B95A 4UI9C 1KLXA 4AY6A 5D66A 4A1GA 3ZRHA 3V30A 4LERA 4N2SA 2DCPA 3Q9NC 2FO1E 3TXMA 2VGYA 3ZYKA 2A5UA 4TXRA 3DEOA 3CVLA 5BV0A 2XZTG 3T9KA 5BXUA 4BESA 4B8CB 3V2OA 1D8EA 1HS6A 3I4GA 1WAO1 4BSZB 3L13A 4BT9A 2X3MA 4N3CA 3ASDA 5CBOA 5CHEE 2DZOA 3RAUA 4DJAA 4UUCA 1ELWA 4XI0A 1N9AA 5A7DB 4WNGA 4AV7A 3MCXA 3L16A 4HVBA 3EJNA 2MRIA 4L7TA 1V55E 3ASGA 4K5AB 4G1TA 4N3AA 2BF0X 5AENA 3I3NA 4HLLA 4NQ0A 1H0AA 1RZ4A 2L0IA 1SZAA 1ZB1A 4JA7A 3MX3A 3FTSA 3QK0A 2VTBA 3QAQA 3NQPA 2WXOA 2HE0A 3TGOA 3CVWA 1L5JA 4ILHB 1Z3XA 3TWSA 1X81A 2LSUA 4XI9A 3TWRA 3FU6A 1TNOA 3LY9A 3LXUX 2PQNA 1MZCA 3E34A 4N39A 4ATGA 4IN3B 3U66A 4DX7D 4KVMA 4GAAA 3B13A 2MOWA 4ABNA 3QKYA 3FEXA 3ZYQA 3ESKA 2J8SD 4O1PA 4LRZA 4GTVA 5BW8C 2LO6A 1PY1A 1ZU2A 5BUZA 3FH5A 3R7QA 5KJMA 3O48A 2C0LA 2WQ7A 3APCA 3IEGA 4JA9A 4V3IA 3SI5A 2GRPB 4U0SA 3T5XA 4U0UA 3QDNA 4A3TA 5G55A 4E6HA 3ZHEA 4KXKB 1LTXA 1U3DA 3AS8A 2KZTA 3ULQA 3RRMB 2KBXA 2KCVA 4BY6A 2VQ2A 3DSTA 3JUIA 4I9EA 2XZDG 3RU0A 5B1AE 5EIDA 2WB2A 2XGMA 4AXHA 4GTOA 1TNBA 3HRAA 5CERB 2NXPA 3TWQA 1E7UA 2VYIA 2X6KA 2J09A 2DYSE 4FU3A 3TWTA 4DPRA 2J07A 5KBAA 3D9LA 3O4ZA 2IO2C 3FDHA 3GZ1A 4I6GA 4J8YA 2JABA 1OCCE 2LSVA 3ML9A 4U63A 4YDWA 2R03A 3CGHA 2VSOE 5D0OD 3D9JA 1BD8A 1HXIA 4F1PA 2VTBB 2OCCE 4BETA 4IULA 4BTAA 1HFAA 2P9UG 3FFLA 3CVNA 3V2XA 2DVWA 4BEPA 4DLQA 2V0PA 5ANRA 5A23A 2WXLA 2P9SG 4GB9A 2LNIA 1TJFA 3CHQA 3APDA 2YQ8A 3HHMA 2MYOA 3FTZA 4OAVB 3CSFA 1K1AA 1SA5A 2YNQA 2Y4TA 3UIPC 5AJLA 5ENOD 1Y8MA 2Y69E 2J49A 4G24A 2UY1A 3DSXA 3L82A 4DRXE 4TUUA 4UWGA 4JEHA 3FUFA 4GPKA 3FY4A 1EF1C 5CEAA 3KS2A 4F1SA 2KZTB 3QJZA 3RO2A 3QNKA 3Q78A 2YHEA 2P9NG 2X38A 3MYVA 4DX5D 2DBAA 4JZYA 3L9TA 3E30A 2X6JA 3CHOA 2AVPA 1ELKA 4FHJA 3UXGA 2EQXA 1UOHA 2L9BA 2IOLA 2J08A 5EKQD 2HO1A 5HI7A 3ZYLA 1WG0A 1WM5A 2YINA 3L08A 1Z5SC 2ZGGA 4MKTA 4UWFA 4FA6A 3URZA 5G2NA 2UWJG 4AIFA 3PZDA 4K0RA 2BTDA 2JEKA 4PUCA 3Q7AA 1MX2A 4HOTA 4OVVA 2ONDA 3RKVA 3KEZA 3P2BA 3VLEA 3CVUA 3PE4A 5AQBA 3NF1A 1KPSB 1A5EA 3SFZA 3SD5A 1ELRA 3CIAA 3OXLA 2XENA 1O1SA 4B94A 3ULEG 3FU3A 2FO7A 4N2QA 5ARFA 2WXNA 1JCRA 4I17A 5EX3A 3QB2A 5HKPA 3HDXA 2V4LA 5FIOA 4GTQA 5FWQA 3BG1B 4P29A 4LNUD 2QYUA 5BV1A 2RG8A 4HRMB 4C0EA 5AIJA 2P58C 3K9IA 4XZ4A 2AW6A 2OVBA 5FQ7A 3DXKG 2C0MA 3QC1A 4U8VD 2XCBA 4I1OB 3GZSA 2UY1B 2VSYA 4J8EA 2ETCA 5T8IA 4RSYA 1H19A 1N4PA 3V79K 4HORA 4PH4B 3IXEA 3PRZA 2R17C 5FZSA 4C9BB 4DI3A 2WVIA 1FVHA 1H2UA 4GYWA 1K8KG 3FULA 3UM3A 3PH0C 2CFUA 1OT8A 4L9PA 1NZNA 5G05C 4NURA 2BKGA 4JHKA 4O1OA 4TXQA 4EZKA 4KMOA 3DSVA 1UN8A 1TN6A 3SNXA 5G04J 2X6FA 3CQCB 2P9LG 4JW1A 3B7UX 3PUKA 2GRMA 3FTVA 2F8XK 3BG0B 4CDMA 4F53A 3LVRE 4XEIG 3FUDA 3UTMA 1DNPA 2XCCA 4WNDA 3UUXA 3P1UA 4JC8A 4EECA 3U4TA 5D0QD 4KZCA 1JUQA 1QYMA 4NACA 4HOQA 1HU3A 3TWVA 3PZ4A 4MRUA 3MKRA 4EZLA 1EYHA 2KCKA 3I4RB 3NAWA 1TNZA 3RRNB 2KM4A 5BNWA 2P2CP 2E2EA 3FU5A 5FZRA 3DSUA 3PNTB 4DX6D 3G2VA 4LNGA 2F0YA 3CR3A 2WQHA 1MX4A 5JJ6A 2B6CA 4UI9J 1UN9A 2P9IG 3FUIA 4F6RD 3AG4E 4UWKA 2X6IA 3ZW3A 4ZFHA 2XEEA 3L6AA 1NP7A 4I1AA 3S7JA 4BWRA 4A3VA 3D9KA 1OCRE 3B7RL 3FTYA 2EIKE 2KATA 5ANLA 1BU9A 4ACKA 4MLPA 2DWZA 3SF4A 4QQIA 4FJYA 3UM0A 4FULA 2CHXA 3D9OA 4CEMA 1E96B 3SQVA 3D9NA 2CHWA 3QARA 4GU5A 2OOEA 4YVOA 4AOFA 4GYOA 3UT8A 3RSEG 2WXGA 4EPZA 3IHVA 2XEHA 2IOSA 1N54A 2P9KG 2KXPC 5LCWC 4TRQA 1IHGA 1H6PA 1TEZA 4XX5A 4Y6WA 4A55A 3S7DA 4GZCA 2OEVA 3T5VA 2KC7A 2CG2A 2R05A 4CCAA 1E8YA 3RO3A 2WQ6A 1S70B 3DWLG 2EIME 1AP7A 2OVFA 4FADA 2XPZA 2H6IA 2KCLA 5LP0A 3AG2E 1TR4A 2ZGDA 5LFAA 3CV0A 1NI1A 4PS7A 4G8LA 2HM8A 3TXNA 1H2TC 1OWMA 3ZGQA 1MX6A 3CK8A 3ZEFA 4M7CA 2FI7A 3NZUA 5ITZF 1HH8A 3S2AA 5JJ7A 2MHKA 4NIKA 3N71A 2VGXA 3ASNE 1OWPA 3Q9UC 1D9SA 4ME2A 3UM1A 3TWWA 2Y0BG 2WXFA 4GMLA 3AG3E 4X8QA 3TWUA 5BT1A 5CEDB 2WXQA 2QYJA 4JHJA 4AY5A 2E0IA 3SY2A 4B89A 1A17A 3LS8A 4GTMA 1N94A 4OAUC 3LY8A 2QFCA 3CKCA 1JCQA 1HX8A 3E32A 3VLFA 1IYGA 4NRHB 3W9GA 2RD0A 4DK5A 1NA0A 3RRUA 4AVXA 1OWNA 2PNNA 2WXJA 4U95D 2IFUA 3HXEA 3LJNA 3KAEA 4ILIA 3CHPA 3DSWA 3U9WA 3HXFA 3LCAA 1HO8A 1SA4A 3BUAA 3ZXSA 1U2VG 3JXIA 1BI8B 5CCMA 1SQMA 2AJAA 2ZXWE 4EBAG 4J6IA 2HR2A 1HF8A 3J5QB 2H6FA 2GRRB 3RJVA 4GA0A 3EHQA 2IONA 2VSXE 5LX8A 1ZBPA 3LYAA 3RK6A 3S7FA 1K3ZD 3CLJA 3QWVA 4HI9A 2L0TB 3D3MA 1O1RA 4YDEA 1U3CA 5C2YA 5EDSA 2NSZA 4JXTA 2PM7A 4J8DA 5KJKA 4I9CA 2BEDA 3LPZA 3LEWA 3ASOE 3KEAA 4C48B 2VGXB 3TG4A 2IF4A 4K5CA 4L2LA 3Q73A 5T3RA 3V31A 5ENRD 3SBTB 2I2OA 1X5BA 3ASHA 2WMOA 2ILRA 5H7PA 4KBQA 2FULA 3FH7A 1K1BA 3SFYA 3TG5A 2Y4UA 3HIZA 1JWGA 4U8HA 1SW6A 3ZKJA 3FTXA 3ZN3A 2RFAA 3UM2A 4WWPA 4YVQC 4A1SA 4ACLA 3CHRA 5FQ8A 1IQUA 1YMPA 2GGFA 4GZ5A 3ZVVA 4LUNU 3Q7FA 4U8YD 5KJLA 3IV0A 4MBGA 4FC8A 4YNDA 4IYPA 4EZJA 4AP2A 2XRYA 5JMND 4RLYA 3MKQA 5ENTD 3BEEA 3ABKE 3C72A 5T4YA 3CK7A 1E90A 4TXPA 1VDYA 5CRUA 4DLOA 2L6BA 4FLBA 3UQ3A 1HG2A 4KVOA 2NC9A 1Z6TA 3W9FA 1N0RA 3DPDA 3NOGD 2R02A 3AU4A 4XKBA 5AARA 4H7XA 4HOUA 1UG3A 3ESLA 1XNFA 5D2MC 1LD8A 1OWOA 4J0UA 1KZOA 1OWLA 2YHCA 5E76A 2XHEA 4L1BA 4OYSA 4HI8A 4PDXA 3R7RA 4CDRA 5AQ7A 2VSNA 2EINE 4C0MA 5EN5D 2F37A 5KNHD 1NA3A 4U04A 3AS4A 4JEUA 4CGWA 4HNAD 4GZ3A 2XPIA 5ENPD 2A4ZA 3CEQA 4RG6A 2V5QC 2XS8A 4RG9A 3B7TA 2XEVA 3DSSA 1V54E 2EIJE 3L17A 5B3SE 3D9PA 3EDTB 4CGVA 4HQDA 2FEZA 1SVXA 3FUEA 4LEUA 5CMWA 1H6OA 5G05J 2C2LA 5CCLA 4DX1A 5IY5E 4ILGA 2QY7A 1QNFA 4BT8A 4WAFA 3VLDA 3PDNA 1RW2A 3NBNB 2RKKA 4E85A 2OV8A 4LCTA 4CRWA 3MKQB 1WY6A 3ZFWA 4HRLA 1MHQA 3ML8A 1QBQA 4I2WA 4O60A 3CKBA 4JHRA
chains in the Genus database with same CATH topology
4GTMA 1N94A 1LD8A 1N4RA 3HXDA 1KZOA 3PZ4A 1JCQA 3E32A 3Q78A 3E33A 4LNBA 1LD7A 1FT2A 3EU5A 1FPPA 3SFYA 3E30A 2H6HA 1TNZA 1X81A 3HXEA 3DSUA 1KZPA 4GTRA 4LNGA 3DSWA 2F0YA 3HXFA 1N4PA 1SA4A 1TNOA 2H6IA 3EUVA 4GTSA 3SFXA 1MZCA 3E34A 3KSQA 3HXBA 1TN7A 1NI1A 3DSSA 4GTPA 3Q7FA 4YDOA 1TNUA 4MBGA 2H6FA 2ZIRA 4GTTA 4GTVA 4L9PA 3Q7AA 1N4SA 1D8EA 1D8DA 3DRAA 3DSVA 2R2LA 2H6GA 1TN6A 3PZ1A 3DPYA 1TNYA 1FT1A 3C72A 3PZ2A 1O1TA 3HXCA 1N95A 1S64A 3Q79A 1JCSA 3PZ3A 1O5MA 1SA5A 1O1SA 1O1RA 1N4QA 1N9AA 4YDEA 1LTXA 4EHMA 1TN8A 1NL4A 1S63A 1DCEA 1JCRA 3E37A 2BEDA 3DSTA 4GTQA 3DSXA 3Q75A 2ZISA 1QBQA 3Q73A 2IEJA 3KSLA 4GTOA 1TNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTM A;  1N94 A;  1LD8 A;  1N4R A;  3HXD A;  1KZO A;  3PZ4 A;  1JCQ A;  3E32 A;  3Q78 A;  3E33 A;  4LNB A;  1LD7 A;  1FT2 A;  3EU5 A;  1FPP A;  3SFY A;  3E30 A;  2H6H A;  1TNZ A;  1X81 A;  3HXE A;  3DSU A;  1KZP A;  4GTR A;  4LNG A;  3DSW A;  2F0Y A;  3HXF A;  1N4P A;  1SA4 A;  1TNO A;  2H6I A;  3EUV A;  4GTS A;  3SFX A;  1MZC A;  3E34 A;  3KSQ A;  3HXB A;  1TN7 A;  1NI1 A;  3DSS A;  4GTP A;  3Q7F A;  4YDO A;  1TNU A;  4MBG A;  2H6F A;  2ZIR A;  4GTT A;  4GTV A;  4L9P A;  3Q7A A;  1N4S A;  1D8E A;  1D8D A;  3DRA A;  3DSV A;  2R2L A;  2H6G A;  1TN6 A;  3PZ1 A;  3DPY A;  1TNY A;  1FT1 A;  3C72 A;  3PZ2 A;  1O1T A;  3HXC A;  1N95 A;  1S64 A;  3Q79 A;  1JCS A;  3PZ3 A;  1O5M A;  1SA5 A;  1O1S A;  1O1R A;  1N4Q A;  1N9A A;  4YDE A;  1LTX A;  4EHM A;  1TN8 A;  1NL4 A;  1S63 A;  1DCE A;  1JCR A;  3E37 A;  2BED A;  3DST A;  4GTQ A;  3DSX A;  3Q75 A;  2ZIS A;  1QBQ A;  3Q73 A;  2IEJ A;  3KSL A;  4GTO A;  1TNB A; 
#chains in the Genus database with same CATH topology
 4LSZ E;  3ULY A;  1BLX B;  1WDY A;  2BKK B;  3OXG A;  4GMJ A;  4Q94 A;  2DYR E;  2M63 A;  1IXV A;  3DBS A;  1IHB A;  5ENQ D;  4GZ6 A;  1JWF A;  1B89 A;  4M3O A;  5FJY A;  3G2W A;  1E8W A;  2I6H A;  3NB2 A;  4UI9 K;  4WNF A;  1H2V C;  3HVE A;  1P5Q A;  5AAO A;  5CRV A;  5BXO A;  4J8S A;  3LVQ E;  2HYZ A;  2WPV A;  3PRE A;  4H7Y A;  3OXF A;  3UKR G;  2V4H C;  5M72 A;  3C5R A;  3FHE A;  4A63 B;  4L23 A;  5FIN A;  1TNY A;  4ANV A;  3TWX A;  1W3B A;  2CHZ A;  3PZ2 A;  1IQR A;  4U96 D;  1S64 A;  4UQY A;  3ISM C;  3T8M A;  5DBK A;  3JQ0 A;  4D10 C;  3IHY A;  3WXX A;  2AXZ A;  4GMR A;  3E37 A;  1DC2 A;  3Q75 A;  1UW4 B;  3RIB A;  1TYQ G;  3MA5 A;  5J90 A;  1OUV A;  4AM9 A;  2A5E A;  1N4R A;  4YDY A;  3LY7 A;  2XS1 A;  5EIL A;  1N11 A;  3MZL B;  3CVV A;  3PUJ A;  1Y6I A;  5LCW J;  1FT2 A;  5HQ8 A;  4BTB A;  4J7W A;  3FWV A;  5FT9 A;  3WG7 E;  1Z3Y A;  3QOU A;  4UQX A;  4GCO A;  1H6K A;  2PM6 A;  3CHS A;  5E75 A;  2XGS A;  2QC9 A;  4FJZ A;  2IQC A;  2VJ8 A;  2LXM A;  2J4B A;  4RVB A;  2VGE A;  4U7E B;  3JUE A;  4J8F A;  2OEW A;  1G3N B;  2I1J A;  3TJP A;  4B93 B;  1OCO E;  1N4S A;  1XGW A;  4KZ0 A;  1D8D A;  4UQZ A;  3FTU A;  2H6G A;  3HVE B;  3PZ1 A;  3DPY A;  2LAI A;  4TUM A;  3CST A;  3ENE A;  1FT1 A;  2GRQ B;  3SO8 A;  4DI4 A;  3ZYM A;  4EBA A;  1IKN D;  1E8Z A;  3Q79 A;  1O5M A;  3PZ3 A;  4TV3 A;  2Y1L E;  3Q4A B;  4CT0 A;  1S63 A;  5AN8 A;  3PEU B;  4I2Z A;  4ZHB A;  3OAW A;  2IY0 C;  3JQ1 A;  5J08 A;  4HOS A;  5ENS D;  3KD7 A;  5BPP A;  4HS2 A;  2V5F A;  2P9P G;  3X2Q E;  2PL2 A;  3I5P A;  3EIQ C;  2AXU A;  4R7L A;  4ANX A;  4I6J A;  3JXJ A;  2X6H A;  3PVL A;  5EYL A;  4URK A;  2XRZ A;  3UPV A;  2XGO A;  3AS5 A;  2WXM A;  3U64 A;  3MV2 B;  5FQ6 A;  4JL0 A;  1S0P A;  2IU1 A;  4BX9 A;  4G2V A;  4Z68 A;  2QZA A;  1QZ2 A;  4GA2 A;  2WXI A;  3OTN A;  3C3R A;  1NFI E;  2L6J A;  4BX8 A;  1INZ A;  1TNU A;  4O6F A;  2CG3 A;  4HB5 A;  4QFV A;  2DZN A;  5LOZ A;  1YCS B;  1UJJ A;  3MEK A;  2ZIR A;  3UT7 A;  1UJK A;  1BI7 B;  1FCH A;  2V8S E;  2WM9 A;  3PNL B;  3CK9 A;  2GRO B;  4OVU A;  5FZQ A;  3FUH A;  3EU9 A;  3Q5M A;  3F6Q A;  3NOC D;  4W9R A;  4HFG A;  4N3B A;  4Q96 A;  3HXC A;  4N5C A;  3LJ3 A;  3FUN A;  1N4Q A;  3BQO A;  2IO3 C;  3VTX A;  1TN8 A;  3FEY A;  4PS3 A;  5CMY A;  5DIZ A;  4APF A;  2AXV A;  3FP3 A;  4ATZ D;  5HRY A;  3Q49 B;  3EHN A;  4HBD A;  1MYO A;  5KWD A;  4HRN A;  1MJ0 A;  1OY3 D;  3PS6 A;  3CVX A;  4JB8 P;  3FUK A;  3Q15 A;  3D9M A;  2WXP A;  3CVY A;  4DX2 A;  2LUH A;  3JCK C;  2H6H A;  4I1M A;  2CFZ A;  2XPY A;  3FU0 A;  4Q69 A;  2WXK A;  4BFR A;  5C1D A;  1KZP A;  5CBN A;  3PEV B;  2WMN A;  3HYM B;  4GCN A;  2JLB A;  3EUV A;  4GPM A;  3SFX A;  2Q7F A;  3KSQ A;  3UT4 A;  2ZU6 B;  1SZ9 A;  3CVQ A;  5JHB A;  5HS0 A;  4YDO A;  1FVF A;  4IRU A;  1KT0 A;  4GTT A;  3D9I A;  3UKU G;  3C3Q A;  2GRN B;  1EPU A;  1N52 A;  1E7V A;  3DRA A;  3SGH A;  1HE8 A;  3IKO B;  5JHA A;  4G8K A;  3PE3 A;  5AQA A;  2I1K A;  2DIW A;  5CEC B;  3GW4 A;  2B0O E;  1JCS A;  5KNG A;  3ZHE B;  4GA1 A;  1NL4 A;  3LDZ A;  3ZNG A;  4L2Y A;  3C3O A;  2F8Y A;  3TAX A;  3R9M A;  3UMV A;  1LF8 A;  1KT1 A;  5FTP A;  2ETB A;  3JYS A;  3FUJ A;  3MJW A;  3FH8 A;  4GYY A;  3EIJ A;  5AYW D;  4N5Q A;  3ABM E;  3SBS A;  4DUI A;  5EYP F;  3IBE A;  1AWC B;  5ARG A;  4XKC A;  2I9C A;  3DEP A;  5AQ9 A;  5EIB E;  1EDU A;  4UWL A;  4GTR A;  4AEZ C;  4GTS A;  3ONL A;  4BSX A;  3APF A;  4K03 A;  3ASF A;  3ONK A;  5AJD A;  2R5S A;  1TN7 A;  3ZU7 B;  2WXR A;  3UIN C;  3QWP A;  2J4D A;  3NZS A;  4U07 A;  3E4B A;  2IJG X;  4Y6C A;  1GW6 A;  2AWI A;  4G23 A;  2FF4 A;  3L54 A;  3ZUV B;  3FUM A;  4RQI A;  2NYJ A;  5JA4 D;  2R2L A;  2Y3A A;  1O1T A;  3G2S A;  2FBN A;  5ENN A;  4GZD A;  1PAQ A;  4EHM A;  3AG1 E;  5KJN A;  1DCE A;  3CVP A;  2EIL E;  3ZXP A;  4JD2 G;  3LKU A;  1DCQ A;  4F3V A;  4ANU A;  4UWH A;  3KSL A;  4JVS A;  2GW1 A;  3T8K A;  1FPP A;  5FQ4 A;  4B8A A;  4KYO B;  4I6E A;  3MV3 B;  3ABL E;  1OCZ E;  3E33 A;  4LNB A;  1LD7 A;  3EHM A;  3EU5 A;  1PC2 A;  2PZI A;  1BPO A;  4F7A A;  5B1B E;  1MQS A;  3AAA C;  4WWN A;  4FP7 A;  4EQF A;  4CZ2 D;  3SZ7 A;  1YYH A;  4G25 A;  1OXJ A;  4LG6 A;  3FTW A;  3R9A B;  2WXH A;  1DVP A;  4CYM D;  3GYZ A;  4HLE A;  4K5B A;  2LAH A;  2PQR A;  3L22 A;  3U3W A;  3MGB A;  3HXB A;  4FHK A;  2GRL A;  4U0Z A;  2BUG A;  4GTP A;  4G26 A;  4MS6 A;  4BER A;  3AU5 A;  5G04 C;  3B7S A;  1Q2Z A;  3DXM G;  3EHR A;  1E8X A;  3ZIM A;  3C98 A;  3AJI A;  3HG0 D;  3UIO C;  4PS8 A;  4ANW A;  3UI2 A;  2XQ0 A;  3BU8 A;  3ZPJ A;  3CHM A;  4JPS A;  4CDN A;  1HZ4 A;  2RFM A;  2R59 A;  1N95 A;  3J5P A;  4FLH A;  1N0Q A;  1TJC A;  4B0Z A;  4WUY A;  4XIF A;  4CT4 A;  4AJW A;  1YA0 A;  4WWO A;  2ETA A;  1QQE A;  3CQG B;  4KT6 B;  3SHF A;  3Q47 B;  2ZIS A;  1HG5 A;  2IEJ A;  1JPL A;  3GZ2 A;  3G2U A;  4XE0 A;  3TL5 A;  3D9H A;  3HXD A;  5A6C A;  2LXL A;  3VTY A;  4APO A;  3UX4 A;  5EX0 A;  4I43 A;  3S7B A;  3G2T A;  4WNE A;  4HXI A;  2J9Q A;  3B7B A;  3QWW A;  5JJT A;  5KCM A;  4G11 A;  3B95 A;  4UI9 C;  1KLX A;  4AY6 A;  5D66 A;  4A1G A;  3ZRH A;  3V30 A;  4LER A;  4N2S A;  2DCP A;  3Q9N C;  2FO1 E;  3TXM A;  2VGY A;  3ZYK A;  2A5U A;  4TXR A;  3DEO A;  3CVL A;  5BV0 A;  2XZT G;  3T9K A;  5BXU A;  4BES A;  4B8C B;  3V2O A;  1D8E A;  1HS6 A;  3I4G A;  1WAO 1;  4BSZ B;  3L13 A;  4BT9 A;  2X3M A;  4N3C A;  3ASD A;  5CBO A;  5CHE E;  2DZO A;  3RAU A;  4DJA A;  4UUC A;  1ELW A;  4XI0 A;  1N9A A;  5A7D B;  4WNG A;  4AV7 A;  3MCX A;  3L16 A;  4HVB A;  3EJN A;  2MRI A;  4L7T A;  1V55 E;  3ASG A;  4K5A B;  4G1T A;  4N3A A;  2BF0 X;  5AEN A;  3I3N A;  4HLL A;  4NQ0 A;  1H0A A;  1RZ4 A;  2L0I A;  1SZA A;  1ZB1 A;  4JA7 A;  3MX3 A;  3FTS A;  3QK0 A;  2VTB A;  3QAQ A;  3NQP A;  2WXO A;  2HE0 A;  3TGO A;  3CVW A;  1L5J A;  4ILH B;  1Z3X A;  3TWS A;  1X81 A;  2LSU A;  4XI9 A;  3TWR A;  3FU6 A;  1TNO A;  3LY9 A;  3LXU X;  2PQN A;  1MZC A;  3E34 A;  4N39 A;  4ATG A;  4IN3 B;  3U66 A;  4DX7 D;  4KVM A;  4GAA A;  3B13 A;  2MOW A;  4ABN A;  3QKY A;  3FEX A;  3ZYQ A;  3ESK A;  2J8S D;  4O1P A;  4LRZ A;  4GTV A;  5BW8 C;  2LO6 A;  1PY1 A;  1ZU2 A;  5BUZ A;  3FH5 A;  3R7Q A;  5KJM A;  3O48 A;  2C0L A;  2WQ7 A;  3APC A;  3IEG A;  4JA9 A;  4V3I A;  3SI5 A;  2GRP B;  4U0S A;  3T5X A;  4U0U A;  3QDN A;  4A3T A;  5G55 A;  4E6H A;  3ZHE A;  4KXK B;  1LTX A;  1U3D A;  3AS8 A;  2KZT A;  3ULQ A;  3RRM B;  2KBX A;  2KCV A;  4BY6 A;  2VQ2 A;  3DST A;  3JUI A;  4I9E A;  2XZD G;  3RU0 A;  5B1A E;  5EID A;  2WB2 A;  2XGM A;  4AXH A;  4GTO A;  1TNB A;  3HRA A;  5CER B;  2NXP A;  3TWQ A;  1E7U A;  2VYI A;  2X6K A;  2J09 A;  2DYS E;  4FU3 A;  3TWT A;  4DPR A;  2J07 A;  5KBA A;  3D9L A;  3O4Z A;  2IO2 C;  3FDH A;  3GZ1 A;  4I6G A;  4J8Y A;  2JAB A;  1OCC E;  2LSV A;  3ML9 A;  4U63 A;  4YDW A;  2R03 A;  3CGH A;  2VSO E;  5D0O D;  3D9J A;  1BD8 A;  1HXI A;  4F1P A;  2VTB B;  2OCC E;  4BET A;  4IUL A;  4BTA A;  1HFA A;  2P9U G;  3FFL A;  3CVN A;  3V2X A;  2DVW A;  4BEP A;  4DLQ A;  2V0P A;  5ANR A;  5A23 A;  2WXL A;  2P9S G;  4GB9 A;  2LNI A;  1TJF A;  3CHQ A;  3APD A;  2YQ8 A;  3HHM A;  2MYO A;  3FTZ A;  4OAV B;  3CSF A;  1K1A A;  1SA5 A;  2YNQ A;  2Y4T A;  3UIP C;  5AJL A;  5ENO D;  1Y8M A;  2Y69 E;  2J49 A;  4G24 A;  2UY1 A;  3DSX A;  3L82 A;  4DRX E;  4TUU A;  4UWG A;  4JEH A;  3FUF A;  4GPK A;  3FY4 A;  1EF1 C;  5CEA A;  3KS2 A;  4F1S A;  2KZT B;  3QJZ A;  3RO2 A;  3QNK A;  3Q78 A;  2YHE A;  2P9N G;  2X38 A;  3MYV A;  4DX5 D;  2DBA A;  4JZY A;  3L9T A;  3E30 A;  2X6J A;  3CHO A;  2AVP A;  1ELK A;  4FHJ A;  3UXG A;  2EQX A;  1UOH A;  2L9B A;  2IOL A;  2J08 A;  5EKQ D;  2HO1 A;  5HI7 A;  3ZYL A;  1WG0 A;  1WM5 A;  2YIN A;  3L08 A;  1Z5S C;  2ZGG A;  4MKT A;  4UWF A;  4FA6 A;  3URZ A;  5G2N A;  2UWJ G;  4AIF A;  3PZD A;  4K0R A;  2BTD A;  2JEK A;  4PUC A;  3Q7A A;  1MX2 A;  4HOT A;  4OVV A;  2OND A;  3RKV A;  3KEZ A;  3P2B A;  3VLE A;  3CVU A;  3PE4 A;  5AQB A;  3NF1 A;  1KPS B;  1A5E A;  3SFZ A;  3SD5 A;  1ELR A;  3CIA A;  3OXL A;  2XEN A;  1O1S A;  4B94 A;  3ULE G;  3FU3 A;  2FO7 A;  4N2Q A;  5ARF A;  2WXN A;  1JCR A;  4I17 A;  5EX3 A;  3QB2 A;  5HKP A;  3HDX A;  2V4L A;  5FIO A;  4GTQ A;  5FWQ A;  3BG1 B;  4P29 A;  4LNU D;  2QYU A;  5BV1 A;  2RG8 A;  4HRM B;  4C0E A;  5AIJ A;  2P58 C;  3K9I A;  4XZ4 A;  2AW6 A;  2OVB A;  5FQ7 A;  3DXK G;  2C0M A;  3QC1 A;  4U8V D;  2XCB A;  4I1O B;  3GZS A;  2UY1 B;  2VSY A;  4J8E A;  2ETC A;  5T8I A;  4RSY A;  1H19 A;  1N4P A;  3V79 K;  4HOR A;  4PH4 B;  3IXE A;  3PRZ A;  2R17 C;  5FZS A;  4C9B B;  4DI3 A;  2WVI A;  1FVH A;  1H2U A;  4GYW A;  1K8K G;  3FUL A;  3UM3 A;  3PH0 C;  2CFU A;  1OT8 A;  4L9P A;  1NZN A;  5G05 C;  4NUR A;  2BKG A;  4JHK A;  4O1O A;  4TXQ A;  4EZK A;  4KMO A;  3DSV A;  1UN8 A;  1TN6 A;  3SNX A;  5G04 J;  2X6F A;  3CQC B;  2P9L G;  4JW1 A;  3B7U X;  3PUK A;  2GRM A;  3FTV A;  2F8X K;  3BG0 B;  4CDM A;  4F53 A;  3LVR E;  4XEI G;  3FUD A;  3UTM A;  1DNP A;  2XCC A;  4WND A;  3UUX A;  3P1U A;  4JC8 A;  4EEC A;  3U4T A;  5D0Q D;  4KZC A;  1JUQ A;  1QYM A;  4NAC A;  4HOQ A;  1HU3 A;  3TWV A;  3PZ4 A;  4MRU A;  3MKR A;  4EZL A;  1EYH A;  2KCK A;  3I4R B;  3NAW A;  1TNZ A;  3RRN B;  2KM4 A;  5BNW A;  2P2C P;  2E2E A;  3FU5 A;  5FZR A;  3DSU A;  3PNT B;  4DX6 D;  3G2V A;  4LNG A;  2F0Y A;  3CR3 A;  2WQH A;  1MX4 A;  5JJ6 A;  2B6C A;  4UI9 J;  1UN9 A;  2P9I G;  3FUI A;  4F6R D;  3AG4 E;  4UWK A;  2X6I A;  3ZW3 A;  4ZFH A;  2XEE A;  3L6A A;  1NP7 A;  4I1A A;  3S7J A;  4BWR A;  4A3V A;  3D9K A;  1OCR E;  3B7R L;  3FTY A;  2EIK E;  2KAT A;  5ANL A;  1BU9 A;  4ACK A;  4MLP A;  2DWZ A;  3SF4 A;  4QQI A;  4FJY A;  3UM0 A;  4FUL A;  2CHX A;  3D9O A;  4CEM A;  1E96 B;  3SQV A;  3D9N A;  2CHW A;  3QAR A;  4GU5 A;  2OOE A;  4YVO A;  4AOF A;  4GYO A;  3UT8 A;  3RSE G;  2WXG A;  4EPZ A;  3IHV A;  2XEH A;  2IOS A;  1N54 A;  2P9K G;  2KXP C;  5LCW C;  4TRQ A;  1IHG A;  1H6P A;  1TEZ A;  4XX5 A;  4Y6W A;  4A55 A;  3S7D A;  4GZC A;  2OEV A;  3T5V A;  2KC7 A;  2CG2 A;  2R05 A;  4CCA A;  1E8Y A;  3RO3 A;  2WQ6 A;  1S70 B;  3DWL G;  2EIM E;  1AP7 A;  2OVF A;  4FAD A;  2XPZ A;  2H6I A;  2KCL A;  5LP0 A;  3AG2 E;  1TR4 A;  2ZGD A;  5LFA A;  3CV0 A;  1NI1 A;  4PS7 A;  4G8L A;  2HM8 A;  3TXN A;  1H2T C;  1OWM A;  3ZGQ A;  1MX6 A;  3CK8 A;  3ZEF A;  4M7C A;  2FI7 A;  3NZU A;  5ITZ F;  1HH8 A;  3S2A A;  5JJ7 A;  2MHK A;  4NIK A;  3N71 A;  2VGX A;  3ASN E;  1OWP A;  3Q9U C;  1D9S A;  4ME2 A;  3UM1 A;  3TWW A;  2Y0B G;  2WXF A;  4GML A;  3AG3 E;  4X8Q A;  3TWU A;  5BT1 A;  5CED B;  2WXQ A;  2QYJ A;  4JHJ A;  4AY5 A;  2E0I A;  3SY2 A;  4B89 A;  1A17 A;  3LS8 A;  4GTM A;  1N94 A;  4OAU C;  3LY8 A;  2QFC A;  3CKC A;  1JCQ A;  1HX8 A;  3E32 A;  3VLF A;  1IYG A;  4NRH B;  3W9G A;  2RD0 A;  4DK5 A;  1NA0 A;  3RRU A;  4AVX A;  1OWN A;  2PNN A;  2WXJ A;  4U95 D;  2IFU A;  3HXE A;  3LJN A;  3KAE A;  4ILI A;  3CHP A;  3DSW A;  3U9W A;  3HXF A;  3LCA A;  1HO8 A;  1SA4 A;  3BUA A;  3ZXS A;  1U2V G;  3JXI A;  1BI8 B;  5CCM A;  1SQM A;  2AJA A;  2ZXW E;  4EBA G;  4J6I A;  2HR2 A;  1HF8 A;  3J5Q B;  2H6F A;  2GRR B;  3RJV A;  4GA0 A;  3EHQ A;  2ION A;  2VSX E;  5LX8 A;  1ZBP A;  3LYA A;  3RK6 A;  3S7F A;  1K3Z D;  3CLJ A;  3QWV A;  4HI9 A;  2L0T B;  3D3M A;  1O1R A;  4YDE A;  1U3C A;  5C2Y A;  5EDS A;  2NSZ A;  4JXT A;  2PM7 A;  4J8D A;  5KJK A;  4I9C A;  2BED A;  3LPZ A;  3LEW A;  3ASO E;  3KEA A;  4C48 B;  2VGX B;  3TG4 A;  2IF4 A;  4K5C A;  4L2L A;  3Q73 A;  5T3R A;  3V31 A;  5ENR D;  3SBT B;  2I2O A;  1X5B A;  3ASH A;  2WMO A;  2ILR A;  5H7P A;  4KBQ A;  2FUL A;  3FH7 A;  1K1B A;  3SFY A;  3TG5 A;  2Y4U A;  3HIZ A;  1JWG A;  4U8H A;  1SW6 A;  3ZKJ A;  3FTX A;  3ZN3 A;  2RFA A;  3UM2 A;  4WWP A;  4YVQ C;  4A1S A;  4ACL A;  3CHR A;  5FQ8 A;  1IQU A;  1YMP A;  2GGF A;  4GZ5 A;  3ZVV A;  4LUN U;  3Q7F A;  4U8Y D;  5KJL A;  3IV0 A;  4MBG A;  4FC8 A;  4YND A;  4IYP A;  4EZJ A;  4AP2 A;  2XRY A;  5JMN D;  4RLY A;  3MKQ A;  5ENT D;  3BEE A;  3ABK E;  3C72 A;  5T4Y A;  3CK7 A;  1E90 A;  4TXP A;  1VDY A;  5CRU A;  4DLO A;  2L6B A;  4FLB A;  3UQ3 A;  1HG2 A;  4KVO A;  2NC9 A;  1Z6T A;  3W9F A;  1N0R A;  3DPD A;  3NOG D;  2R02 A;  3AU4 A;  4XKB A;  5AAR A;  4H7X A;  4HOU A;  1UG3 A;  3ESL A;  1XNF A;  5D2M C;  1LD8 A;  1OWO A;  4J0U A;  1KZO A;  1OWL A;  2YHC A;  5E76 A;  2XHE A;  4L1B A;  4OYS A;  4HI8 A;  4PDX A;  3R7R A;  4CDR A;  5AQ7 A;  2VSN A;  2EIN E;  4C0M A;  5EN5 D;  2F37 A;  5KNH D;  1NA3 A;  4U04 A;  3AS4 A;  4JEU A;  4CGW A;  4HNA D;  4GZ3 A;  2XPI A;  5ENP D;  2A4Z A;  3CEQ A;  4RG6 A;  2V5Q C;  2XS8 A;  4RG9 A;  3B7T A;  2XEV A;  3DSS A;  1V54 E;  2EIJ E;  3L17 A;  5B3S E;  3D9P A;  3EDT B;  4CGV A;  4HQD A;  2FEZ A;  1SVX A;  3FUE A;  4LEU A;  5CMW A;  1H6O A;  5G05 J;  2C2L A;  5CCL A;  4DX1 A;  5IY5 E;  4ILG A;  2QY7 A;  1QNF A;  4BT8 A;  4WAF A;  3VLD A;  3PDN A;  1RW2 A;  3NBN B;  2RKK A;  4E85 A;  2OV8 A;  4LCT A;  4CRW A;  3MKQ B;  1WY6 A;  3ZFW A;  4HRL A;  1MHQ A;  3ML8 A;  1QBQ A;  4I2W A;  4O60 A;  3CKB A;  4JHR A; 
#chains in the Genus database with same CATH homology
 4GTM A;  1N94 A;  1LD8 A;  1N4R A;  3HXD A;  1KZO A;  3PZ4 A;  1JCQ A;  3E32 A;  3Q78 A;  3E33 A;  4LNB A;  1LD7 A;  1FT2 A;  3EU5 A;  1FPP A;  3SFY A;  3E30 A;  2H6H A;  1TNZ A;  1X81 A;  3HXE A;  3DSU A;  1KZP A;  4GTR A;  4LNG A;  3DSW A;  2F0Y A;  3HXF A;  1N4P A;  1SA4 A;  1TNO A;  2H6I A;  3EUV A;  4GTS A;  3SFX A;  1MZC A;  3E34 A;  3KSQ A;  3HXB A;  1TN7 A;  1NI1 A;  3DSS A;  4GTP A;  3Q7F A;  4YDO A;  1TNU A;  4MBG A;  2H6F A;  2ZIR A;  4GTT A;  4GTV A;  4L9P A;  3Q7A A;  1N4S A;  1D8E A;  1D8D A;  3DRA A;  3DSV A;  2R2L A;  2H6G A;  1TN6 A;  3PZ1 A;  3DPY A;  1TNY A;  1FT1 A;  3C72 A;  3PZ2 A;  1O1T A;  3HXC A;  1N95 A;  1S64 A;  3Q79 A;  1JCS A;  3PZ3 A;  1O5M A;  1SA5 A;  1O1S A;  1O1R A;  1N4Q A;  1N9A A;  4YDE A;  1LTX A;  4EHM A;  1TN8 A;  1NL4 A;  1S63 A;  1DCE A;  1JCR A;  3E37 A;  2BED A;  3DST A;  4GTQ A;  3DSX A;  3Q75 A;  2ZIS A;  1QBQ A;  3Q73 A;  2IEJ A;  3KSL A;  4GTO A;  1TNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...