1FT7A

Aap complexed with l-leucinephosphonic acid
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL LEUCYL AMINOPEPTIDASE
publication title Inhibition of the aminopeptidase from Aeromonas proteolytica by L-leucinephosphonic acid. Spectroscopic and crystallographic characterization of the transition state of peptide hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ft7A00
3KGQA 4A38A 3H8GA 4OIWA 4MHZA 3SI2A 3N5FA 3FEDA 3WT4A 3WABA 2V8VA 2HB6A 2PJ8A 2Q51A 4P4BA 3PEIA 3RBUA 3IWWA 3D7FA 4TNUA 3KHZA 3D67A 1YSJA 5ELYA 2Q43A 3PFEA 1TKFA 3TX8A 4X2TA 2AFMA 3L2NA 2F7VA 2QVPA 3S9MA 2BCOA 2ZELA 1Z8LA 2NYQA 2XEIA 4KSIA 4NGNA 3V7ZA 3IJ3A 1DE4C 6CPAA 2O4HA 3RAMA 5LRJA 1LCPA 4FUUA 4NGMA 4ZY1A 2OOTA 2C6GA 3D4UA 2O53A 3KQZA 3FJUA 3MRUA 3IO1A 5LRKA 3CDXA 3SI0A 3ISZA 5JH9A 2V8DA 3B3CA 1CPXA 2ABZA 4WJBA 4IHMA 4MHNA 2PJ6A 3HUVA 3CPAA 3CPXA 3S9LA 4OC4A 1ARMA 3PB9X 1KWMA 8CPAA 4F9VA 3B3SA 1ARLA 1Y0YA 2PJ5A 2PJ9A 2XEGA 1PCAA 4LQGA 4P4EA 1Y0RA 2ANPA 5LYIA 3LWUA 1AYEA 4X3RA 5CBMA 3PB4X 1YLOA 3JRUA 3NH5A 1HDQA 5J1QA 1AMPA 5JM6A 3KR5A 5THWA 1NSAA 4MCSA 4ZY2A 1XJOA 3D7DA 4JYWA 4EWTA 2IQ6A 5K8NA 4BD9A 1BAVA 3IIBA 2ZOFA 4UF4A 1YMEA 4Q7AA 4EFDA 2PJ2A 4ZX9A 4OC3A 4UEFA 5LYDA 2FVGA 4MHYA 4NGTA 3SJEA 5D29A 1CPSA 2AFZA 1TF9A 3PB7X 2PJ7A 4P10A 3FH4A 2ZEMA 4FAIA 2QYVA 3KR4A 2I3CA 2AFWA 2BO9A 2C6PA 3BHXA 1VIXA 3IEHA 2F8HA 5LRGA 5LYFA 4ONWA 3ISXA 4R7MA 2ZEFA 4DUKA 4TWEA 2PCUA 1BPMA 2GLFA 4PXDA 2AFXA 3B2YA 4NJRA 4YWYA 3FEEA 3BI1A 3KASA 2ZEGA 2ZENA 7CPAA 1GYTA 3K2KA 4P6YA 1EE3P 4ZX8A 4R8FA 4IK2A 2J9AA 3LMSA 3NH4A 4AXVA 2BOAA 2PVVA 4ZY0A 5K8MA 4B6ZA 2V77A 4O23A 5K8OA 5HVHA 2PRQA 4IAVA 2CTCA 2PJ3A 3FF3A 4P4JA 2PJ1A 4WWVA 3PBBA 2OR4A 5F09A 2ZOGA 1Z2LA 4K3NA 4MXUA 4NJQA 1PYTB 4DJLA 3CT9A 3VATA 2IJZA 4PXBA 4G1PA 3VH9A 1F2OA 1DTDA 3S9NA 2C6CA 4P45A 3NFZA 3FVLA 3DLJA 4GM5A 4P4DA 2ZEOA 4OKOA 2G9DA 1XRYA 3B35A 3PRTA 1XFOA 4OC2A 4MRIA 2ZEEA 1VGYA 1CP7A 3PB6X 1Q7LA 3T8WA 2GREA 1HEEA 4A37A 1IY7A 1CX8A 4P4FA 2JBKA 3PBEA 3QNVA 2EK8A 1BPNA 2XEJA 2AFSA 3H8EA 1CBXA 2PJ0A 2ZEHA 3PB8X 2CF4A 1YW4A 3PFOA 2V8HA 1Z5RA 2AFOA 1QMUA 4UIAA 3WC6A 5I4MA 4PXEA 1IGBA 4UEEA 1CP6A 4ZYQA 3NH8A 1RTQA 2PJ4A 5HVFA 4OC1A 2EK9A 3K9TA 1ELMP 2PJCA 1FNOA 3D7HA 3RZAA 3TC8A 2ZEPA 4W9YA 3VARA 3B3TA 3IC1A 4ZI6A 1Y7EA 1F2PA 4RUHA 4P4IA 1QQ9A 4PQAA 2WZNA 4FWUA 1TKJA 1R3NA 1BLLE 1TKHA 1LANA 2PJBA 4OP4A 3SJXA 2VL1A 2AFUA 3D7GA 3B3WA 1UWYA 3HLPA 3H8FA 3KQXA 2Q4ZA 3NA6A 4MCRA 1FT7A 2DEAA 5CPAA 3MN8A 5HXDA 3I1UA 3SJGA 2GU2A 2JEWA 4DYOA 3B3VA 4A39A 3DGVA 3FMCA 2IMOA 2PJAA 4NGQA 5LYLA 5K8PA 2XEFA 2ZEDA 1CG2A 1TF8A 4NGPA 4A94A 3IFEA 1ZG8A 4MCQA 3BXMA 1R43A 2JBJA 5IB9A 2QJ8A 4Z65A 1HDUA 4F8ZA 1ZLIA 4X8IA 4OC0A 4P44A 3B7IA 4H2KA 3FX6A 4CPAA 4UIBA 3GUXA 1ZG9A 5D8NA 1H8LA 5HVGA 1ZLHA 3FECA 4R6TA 2RB7A 2CTBA 1TXRA 5DS0A 2C1CA 4F9UA 1XMBA 3SI1A 3KL9A 1VHEA 4PXCA 2EWBA 3GLJA 1OBRA 4MHPA 1M4LA 4JZ0A 4UEZA 2RFHA 1LAPA 4FBEA 3WC7A 2PE3A 3D66A 1LOKA 3SJFA 4NGRA 2PIZA 3KHXA 1LFWA 2CIJA 4YU9A 2HC9A 4MCPA 2PIYA 3V38A 1LAMA 4R76A 4MMOA 4NGSA 4EMEA 3GB0A 1YW6A 3BI0A 1VHOA 1XBUA 4OC5A 2PVWA 1F57A 4NFRA 2POKA 4OIDA 2GLJA 1JQGA 3KI9A 2NSMA 5JGFA 2V8GA 2WYRA 1ELLP 1ZG7A 3WC5A 4PPZA 3KZWA 4OMEA 3D68A
chains in the Genus database with same CATH superfamily
1NMTA 1CJWA 1S3ZA 3KGQA 4A38A 3H8GA 3T90A 2B5GA 3F5BA 2PR1A 4OIWA 4MHZA 3SI2A 4PSXA 3N5FA 3FEDA 4KSAA 1IOFA 4KUAA 2JDCA 3WT4A 4YFJA 3WABA 2B3UA 2GFQA 2V8VA 4CGOA 5G21A 2HB6A 2Q04A 3K9UA 2PJ8A 5H86A 2Q51A 4P4BA 3PEIA 1P4NA 1ON0A 3RBUA 3PZJA 1QSMA 2WUUA 3D7FA 3IWWA 4Q36A 2C27A 3ZZIA 4C2XA 2YNEA 3MGDA 2Z10A 3D67A 1YSJA 3KHZA 4TNUA 4Y49B 1Y9WA 5ELYA 2H5MA 2Q43A 3PFEA 3R95A 3D8PA 2GE3A 5A27A 5HMNA 1TKFA 4CYNA 3TX8A 4X2TA 1MJBA 2AFMA 1Z4RA 4KUBA 3L2NA 5F46A 2F7VA 4MFLA 5C82A 3GKRA 4QBJA 2QVPA 4FD4A 2FS5A 3S9MA 2BCOA 3C26A 2ZELA 1Y7RA 3S6KA 1Z8LA 4F6AA 2NYQA 3S6HA 2XEIA 4KSIA 5BWAB 4NGNA 3V7ZA 3IJ3A 1DE4C 2P0WA 6CPAA 1M44A 1OZPA 1QSTA 2O4HA 3RAMA 3TE4A 5LRJA 1LCPA 4FUUA 1Z8XA 2PRBA 4NGMA 4R9MA 1M1DA 1YLEA 5HH1A 3WR7A 2OOTA 4KVOE 4UCNA 2C6GA 4CAVA 2REEA 2VZYA 3WC5A 1B87A 3D4UA 1A2ZA 4HNWB 2Z3MA 3TFYA 2K5TA 2P6EA 2O53A 3KQZA 1KUXA 3BJ8A 3FJUA 2Q4VA 3D3SA 4KZTA 1KUVA 2VQYA 1ZO0A 3IO1A 3MRUA 5LRKA 3F8KA 3CDXA 3SI0A 1YREA 4L89A 3ISZA 4J3GA 5JH9A 2BEIA 2V8DA 3B3CA 3FXTA 1CPXA 2ABZA 3GY9A 3LODA 4UCPA 4WJBA 4IHMA 4MHNA 2PJ6A 3EXNA 3HUVA 1Z8WA 2WSAA 4LQ6A 3CPAA 3CPXA 3S9LA 1S7FA 4C2YA 3RO0A 2CNSA 4OC4A 1ARMA 2I00A 3FBUA 3PB9X 4CGMA 4UBRA 4RN7A 3RNZA 3SHPA 1YVOA 1KWMA 4KVME 2BSWA 5KTCA 4I49A 8CPAA 4F9VA 3B3SA 1ARLA 1Y0YA 2PJ5A 2PJ9A 2XEGA 4FD6A 5JPHA 1PCAA 2R8VA 4LQGA 4P4EA 4CYOA 5GCNA 3GIUA 4H6ZA 1Y0RA 4NSQA 2ANPA 4UCMA 3H5ZA 5LYIA 3LWUA 1AYEA 4X3RA 2NMTA 2EBJA 5CBMA 3PB4X 3TCVA 4CAXA 1YLOA 2Z3OA 3JRUA 4LX9A 3FNCA 3I9SA 1S5KA 2EUIA 1HDQA 3NH5A 5J1QA 1AMPA 3BJ7A 3VWDA 5JM6A 1B6BA 3KR5A 1Q2YA 1XOVA 5THWA 1NSAA 4MCSA 4FD5A 4ZY2A 3R9EA 1XJOA 5IV0A 3NE7A 3D7DA 4JYWA 4EWTA 2ATRA 2IQ6A 4JXRA 5K8NA 1M4DA 2PSWA 2J8RA 3TO6A 4BD9A 1BAVA 2R1IA 2FIWA 4R57A 3IIBA 2ZOFA 2X7BA 4UF4A 1YMEA 4Q7AA 4RS2A 1XF8A 4EFDA 5G22A 3QAYA 4PK3A 4AG9A 2OB0A 1X12A 4ZBGA 2PJ2A 4ZX9A 4AVBA 4OC3A 4NF1A 2A4NA 1BO4A 3GYAA 4UEFA 1IB1E 4UWJA 4AG7A 5LYDA 2FVGA 4C7IA 4MHYA 4NGTA 3EFAA 3SJEA 3IWEA 5D29A 1M4IA 1CPSA 4CRZB 2AFZA 4KORA 1Z4EA 1TF9A 3PB7X 2PJ7A 4P10A 2GANA 3FH4A 4B5OA 1RO5A 4ZY1A 5AG7A 2ZEMA 4FAIA 2QYVA 3KR4A 3DDDA 2I3CA 2I79A 4A33A 2AFWA 3NE8A 5A28A 2BO9A 2C6PA 3BHXA 3S6FA 3SXNA 1S7NA 1MK4A 4JJXA 1VIXA 1MJ9A 2HUZA 2F8HA 3B8GA 3IEHA 5E96A 5LRGA 4MFKA 3UY5A 4B14A 4XPDB 2J8NA 4KVXA 4ONWA 5KTAA 3ISXA 4R7MA 4JWPA 4F0YA 5LYFA 4HKFA 4UFXA 2VBQA 2ZEFA 4DUKA 4TWEA 2PCUA 4QUSA 1BPMA 2F5IA 4CYPA 2GLFA 4PXDA 4AVCA 4CGPA 2PDOA 4M85A 2AFXA 3B2YA 4NJRA 4YWYA 4ORFA 3FEEA 2PQ8A 4XNHC 3BI1A 2P6FA 4KOSA 3KASA 2ZEGA 2ZENA 2QMLA 7CPAA 5JQ4A 5I0CA 1KZFA 1GYTA 3K2KA 4P6YA 2CNMA 3BLNA 4E2AA 1I12A 4PK2A 4MI4A 5AGEA 4MBUA 4K30A 1EE3P 2B5GB 4ZX8A 4R8FA 4NCZA 2OH1A 4IK2A 2J9AA 1IYLA 3LMSA 2ZPAA 3NH4A 5J8FA 1XIXA 4AXVA 3TOBA 2BOAA 1XMTA 2PVVA 4ZY0A 4CAWA 4KLVA 4DNCA 5K8MA 4B6ZA 2DPSA 3R9GA 2V77A 4O23A 4BINA 1CM0A 5K8OA 5HVHA 2PRQA 4YGOA 1RXTA 4IAVA 2CTCA 2PJ3A 3TO9A 3OWCA 3FF3A 4P4JA 3P2HA 1I1DA 2Z3LA 2PJ1A 4WWVA 2CNTA 3PBBA 4KS9A 2OR4A 2Q4YA 2QIRA 5F09A 2ODFA 2ZOGA 1Z2LA 3G8WA 4K3NA 4MXUA 4KOWA 4CRYB 2YGWA 4NJQA 3TO7A 1PYTB 2JDDA 4OLLA 4B5PA 4QVTA 4DJLA 3CT9A 5AG5A 3VATA 2IJZA 4PXBA 2B3VA 1Y9KA 4G1PA 2QECA 4JD6A 2Q0YA 1F2OA 1DTDA 3QB8A 5DWNA 2C6CA 3VH9A 3S9NA 4P45A 3NFZA 3FVLA 3DLJA 2ZW5A 4FD7A 2ZEOA 4GM5A 4OKOA 4P4DA 1SQHA 2G9DA 1XRYA 3B35A 3H4QA 4U9ZA 3PRTA 1XFOA 4OC2A 4A31A 4MRIA 2ZEEA 1VGYA 4L8AA 1CP7A 1Q2DA 2FT0A 1Q7LA 2CXAA 2Y0MA 3PB6X 3T8WA 2GREA 1HEEA 5EC4A 4A37A 1IY7A 1CX8A 4P4FA 2JBKA 4U5YA 2GIVA 3DR6A 2B4DA 3PBEA 3QNVA 2EK8A 4M6HA 1BPNA 2XEJA 3JUWA 4R3LA 2AFSA 2ZXVA 3H8EA 1JWQA 3IWGA 2CY2A 4CGNA 1CBXA 2PJ0A 2J8MA 2ZEHA 3JVNA 4CS0B 3PB8X 2CF4A 4UFWA 4JLYA 1YW4A 2ZW4A 3PFOA 2V8HA 1Z9UA 1Z5RA 1YQEA 2AFOA 1QMUA 2DPTA 2ZW6A 1WWZA 3IU2A 4UIAA 1AUGA 3WC6A 5I4MA 3V8IA 1Z8TA 4CAFA 2RC4A 3IU1A 2FIAA 4PXEA 3LACA 4LUAA 1IGBA 4C2ZA 3A9LA 1CP6A 3R1KA 1VHSA 2VZZA 4UEEA 4ZYQA 3NH8A 1XEBA 4RI1A 4X5KA 1RTQA 2PJ4A 5HVFA 4B10A 4OC1A 2EK9A 4KOXA 4QB9A 5G1ZA 3K9TA 1ELMP 2PJCA 5IB0A 1P0HA 1FNOA 3D7HA 4MJ8A 3D2MA 3RZAA 3I3GA 3TC8A 2ZEPA 4W9YA 3VARA 3W6SA 3B3TA 3IC1A 4UA3A 4ZI6A 1IYKA 2YNDA 4HPSA 1Y7EA 2G3TA 1F2PA 5AG4A 5IX3A 1IU8A 4RUHA 4P4IA 1QQ9A 4A32A 4C7HA 4PQAA 2WZNA 2ZW7A 3JTKA 1TKJA 4FWUA 1R3NA 4B13A 4MY3A 2Z3NA 3S6GA 4MFJA 1S60A 4NEXA 4MFQA 3W6XA 1BLLE 4Y49C 3CXSA 4F0XA 1TKHA 1LANA 2PJBA 3FRMA 4OP4A 3SJXA 2VL1A 2FE7A 2AFUA 3D7GA 3TT2A 3B3WA 1UWYA 1UFHA 3HLPA 4UWIA 3ZJ0A 3H8FA 3KQXA 4GS4A 2B4BA 2Q4ZA 2JLMA 3DNSA 3NA6A 2FCKA 4AVAA 5CNPA 4MCRA 1FT7A 2DEAA 3RYOA 5CPAA 3MN8A 5FVJA 1VKCA 1IOIA 5HXDA 3I1UA 4YRHA 1MJAA 3SJGA 2GU2A 4R3KA 2JEWA 2VI7A 3LD2A 1GHEA 4A30A 2Q7BA 2HV2A 3R96A 4DYOA 1S7KA 4PV6A 2ARHA 4A2ZA 3B3VA 4A39A 1QSOA 3DGVA 4Q38A 2IMOA 3FMCA 1QSNA 2PJAA 3SXOA 4ZGYB 4NGQA 5LYLA 5K8PA 4AB7A 4II9A 4XNHB 1XE4A 3W91A 4HNYB 1NE9A 4C68A 5J8CA 2XEFA 1PU9A 2IL4A 1LRZA 2Z0ZA 2ZEDA 1CG2A 1TF8A 2G0BA 4MFPA 5F49A 2JEVA 2Q44A 4NGPA 3KKWA 4R87A 4A94A 2OZHA 3IFEA 4B11A 1ZG8A 3CXQA 3PGPA 2O28A 1J4JA 2B58A 2WPWA 1R43A 2EO8A 2VEZA 3BXMA 4MCQA 3DR8A 2JBJA 5IB9A 2QJ8A 2REFA 3G3SA 1IICA 2R7HA 2D4PA 4XPLA 5F47A 4Z65A 4E0AA 1HDUA 4F8ZA 1ZLIA 2PC1A 4OC0A 4M6GA 4P44A 4X8IA 4IUSA 5DWMA 5F48A 3B7IA 4M3SA 3T9YA 4H2KA 1PUAA 3FX6A 2FSRA 2YNCA 4A95A 4CPAA 4IF5A 1U6MA 1YVKA 2BUEA 1X10A 4UIBA 2OZGA 4CGLA 4CYQA 2EVNA 2KCWA 3GUXA 4UFVA 1ZG9A 2HQYA 5D8NA 1H8LA 1YR0A 2P6GA 4KOYA 5HVGA 2DXQA 1ZLHA 1V0CA 3FECA 4R6TA 2RB7A 4BBHA 3CXPA 2CTBA 5AG6A 3FB3A 1TXRA 1YK3A 2BL1A 4JXQA 4MY0A 5DS0A 4PSWA 2YNCC 2C1CA 4F9UA 1XMBA 3SI1A 4EVYA 3KL9A 1VHEA 4QC6A 4PXCA 1NSLA 4E8OA 2EWBA 3GLJA 4BMHA 1OBRA 4MHPA 4MFZA 4GXHA 4ONUA 5ISVA 1M4LA 3TOAA 1Q2CA 4JZ0A 4UEZA 1IIDA 2RFHA 1I21A 1LAPA 3QAHA 4H89A 2FXFA 3WC7A 2PE3A 4FBEA 3D66A 2VXKA 1K4JA 1LOKA 3SJFA 4U9YA 4NGRA 4CAEA 3FYNA 5KTDA 4HNXB 2PIZA 2FL4A 2AJ6A 1LFWA 3KHXA 4B5PB 2CIJA 2PR8A 4YU9A 5G20A 1R57A 2HC9A 4MCPA 1N71A 4KOVA 2PIYA 3V38A 3P2FA 1L0CA 1BOBA 1LAMA 2AE6A 3PP9A 4H6UA 4KLWA 4KOUA 4MMOA 4NXYA 4R76A 1WK4A 4NGSA 4EMEA 5EMIA 3E0KA 1YW6A 3EC4A 3GB0A 3BI0A 4KSFA 1VHOA 1XBUA 2Z3PA 4OC5A 4B12A 3F0AA 3EO4A 2D4OA 3FIXA 2PVWA 1F57A 1FY7A 2OU2A 3R9FA 1YX0A 2OZUA 1QSRA 4NFRA 2POKA 3N7ZA 2Z11A 4XPKA 3IGRA 4OIDA 2GLJA 4MHDA 1JQGA 3CZXA 1TIQA 2Q7SA 3KI9A 5C88A 2NSMA 5EBVA 1M4GA 2Z3KA 5JGFA 2B4DB 2R98A 3VWEA 2V8GA 4OADA 2WPXA 2WYRA 4KOTA 3TTHA 1ELLP 1KUYA 1S7LA 1ZG7A 2DF5A 3D2PA 4XPDC 4PPZA 3KZWA 5H84A 1YGHA 4OAEA 3EY5A 4OMEA 3DSBA 3D68A 2G3AA 4M6IA
chains in the Genus database with same CATH topology
3KGQA 4A38A 3H8GA 4OIWA 4MHZA 3SI2A 3N5FA 3FEDA 3WT4A 3WABA 2V8VA 2HB6A 2PJ8A 2Q51A 4P4BA 3PEIA 3RBUA 3IWWA 3D7FA 4TNUA 3KHZA 3D67A 1YSJA 5ELYA 2Q43A 3PFEA 1TKFA 3TX8A 4X2TA 2AFMA 3L2NA 2F7VA 2QVPA 3S9MA 2BCOA 2ZELA 1Z8LA 2NYQA 2XEIA 4KSIA 4NGNA 3V7ZA 3IJ3A 1DE4C 6CPAA 2O4HA 3RAMA 5LRJA 1LCPA 4FUUA 4NGMA 4ZY1A 2OOTA 2C6GA 3D4UA 2O53A 3KQZA 3FJUA 3MRUA 3IO1A 5LRKA 3CDXA 3SI0A 3ISZA 5JH9A 2V8DA 3B3CA 1CPXA 2ABZA 4WJBA 4IHMA 4MHNA 2PJ6A 3HUVA 3CPAA 3CPXA 3S9LA 4OC4A 1ARMA 3PB9X 1KWMA 8CPAA 4F9VA 3B3SA 1ARLA 1Y0YA 2PJ5A 2PJ9A 2XEGA 1PCAA 4LQGA 4P4EA 1Y0RA 2ANPA 5LYIA 3LWUA 1AYEA 4X3RA 5CBMA 3PB4X 1YLOA 3JRUA 3NH5A 1HDQA 5J1QA 1AMPA 5JM6A 3KR5A 5THWA 1NSAA 4MCSA 4ZY2A 1XJOA 3D7DA 4JYWA 4EWTA 2IQ6A 5K8NA 4BD9A 1BAVA 3IIBA 2ZOFA 4UF4A 1YMEA 4Q7AA 4EFDA 2PJ2A 4ZX9A 4OC3A 4UEFA 5LYDA 2FVGA 4MHYA 4NGTA 3SJEA 5D29A 1CPSA 2AFZA 1TF9A 3PB7X 2PJ7A 4P10A 3FH4A 2ZEMA 4FAIA 2QYVA 3KR4A 2I3CA 2AFWA 2BO9A 2C6PA 3BHXA 1VIXA 3IEHA 2F8HA 5LRGA 5LYFA 4ONWA 3ISXA 4R7MA 2ZEFA 4DUKA 4TWEA 2PCUA 1BPMA 2GLFA 4PXDA 2AFXA 3B2YA 4NJRA 4YWYA 3FEEA 3BI1A 3KASA 2ZEGA 2ZENA 7CPAA 1GYTA 3K2KA 4P6YA 1EE3P 4ZX8A 4R8FA 4IK2A 2J9AA 3LMSA 3NH4A 4AXVA 2BOAA 2PVVA 4ZY0A 5K8MA 4B6ZA 2V77A 4O23A 5K8OA 5HVHA 2PRQA 4IAVA 2CTCA 2PJ3A 3FF3A 4P4JA 2PJ1A 4WWVA 3PBBA 2OR4A 5F09A 2ZOGA 1Z2LA 4K3NA 4MXUA 4NJQA 1PYTB 4DJLA 3CT9A 3VATA 2IJZA 4PXBA 4G1PA 3VH9A 1F2OA 1DTDA 3S9NA 2C6CA 4P45A 3NFZA 3FVLA 3DLJA 4GM5A 4P4DA 2ZEOA 4OKOA 2G9DA 1XRYA 3B35A 3PRTA 1XFOA 4OC2A 4MRIA 2ZEEA 1VGYA 1CP7A 3PB6X 1Q7LA 3T8WA 2GREA 1HEEA 4A37A 1IY7A 1CX8A 4P4FA 2JBKA 3PBEA 3QNVA 2EK8A 1BPNA 2XEJA 2AFSA 3H8EA 1CBXA 2PJ0A 2ZEHA 3PB8X 2CF4A 1YW4A 3PFOA 2V8HA 1Z5RA 2AFOA 1QMUA 4UIAA 3WC6A 5I4MA 4PXEA 1IGBA 4UEEA 1CP6A 4ZYQA 3NH8A 1RTQA 2PJ4A 5HVFA 4OC1A 2EK9A 3K9TA 1ELMP 2PJCA 1FNOA 3D7HA 3RZAA 3TC8A 2ZEPA 4W9YA 3VARA 3B3TA 3IC1A 4ZI6A 1Y7EA 1F2PA 4RUHA 4P4IA 1QQ9A 4PQAA 2WZNA 4FWUA 1TKJA 1R3NA 1BLLE 1TKHA 1LANA 2PJBA 4OP4A 3SJXA 2VL1A 2AFUA 3D7GA 3B3WA 1UWYA 3HLPA 3H8FA 3KQXA 2Q4ZA 3NA6A 4MCRA 1FT7A 2DEAA 5CPAA 3MN8A 5HXDA 3I1UA 3SJGA 2GU2A 2JEWA 4DYOA 3B3VA 4A39A 3DGVA 3FMCA 2IMOA 2PJAA 4NGQA 5LYLA 5K8PA 2XEFA 2ZEDA 1CG2A 1TF8A 4NGPA 4A94A 3IFEA 1ZG8A 4MCQA 3BXMA 1R43A 2JBJA 5IB9A 2QJ8A 4Z65A 1HDUA 4F8ZA 1ZLIA 4X8IA 4OC0A 4P44A 3B7IA 4H2KA 3FX6A 4CPAA 4UIBA 3GUXA 1ZG9A 5D8NA 1H8LA 5HVGA 1ZLHA 3FECA 4R6TA 2RB7A 2CTBA 1TXRA 5DS0A 2C1CA 4F9UA 1XMBA 3SI1A 3KL9A 1VHEA 4PXCA 2EWBA 3GLJA 1OBRA 4MHPA 1M4LA 4JZ0A 4UEZA 2RFHA 1LAPA 4FBEA 3WC7A 2PE3A 3D66A 1LOKA 3SJFA 4NGRA 2PIZA 3KHXA 1LFWA 2CIJA 4YU9A 2HC9A 4MCPA 2PIYA 3V38A 1LAMA 4R76A 4MMOA 4NGSA 4EMEA 3GB0A 1YW6A 3BI0A 1VHOA 1XBUA 4OC5A 2PVWA 1F57A 4NFRA 2POKA 4OIDA 2GLJA 1JQGA 3KI9A 2NSMA 5JGFA 2V8GA 2WYRA 1ELLP 1ZG7A 3WC5A 4PPZA 3KZWA 4OMEA 3D68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KGQ A;  4A38 A;  3H8G A;  4OIW A;  4MHZ A;  3SI2 A;  3N5F A;  3FED A;  3WT4 A;  3WAB A;  2V8V A;  2HB6 A;  2PJ8 A;  2Q51 A;  4P4B A;  3PEI A;  3RBU A;  3IWW A;  3D7F A;  4TNU A;  3KHZ A;  3D67 A;  1YSJ A;  5ELY A;  2Q43 A;  3PFE A;  1TKF A;  3TX8 A;  4X2T A;  2AFM A;  3L2N A;  2F7V A;  2QVP A;  3S9M A;  2BCO A;  2ZEL A;  1Z8L A;  2NYQ A;  2XEI A;  4KSI A;  4NGN A;  3V7Z A;  3IJ3 A;  1DE4 C;  6CPA A;  2O4H A;  3RAM A;  5LRJ A;  1LCP A;  4FUU A;  4NGM A;  4ZY1 A;  2OOT A;  2C6G A;  3D4U A;  2O53 A;  3KQZ A;  3FJU A;  3MRU A;  3IO1 A;  5LRK A;  3CDX A;  3SI0 A;  3ISZ A;  5JH9 A;  2V8D A;  3B3C A;  1CPX A;  2ABZ A;  4WJB A;  4IHM A;  4MHN A;  2PJ6 A;  3HUV A;  3CPA A;  3CPX A;  3S9L A;  4OC4 A;  1ARM A;  3PB9 X;  1KWM A;  8CPA A;  4F9V A;  3B3S A;  1ARL A;  1Y0Y A;  2PJ5 A;  2PJ9 A;  2XEG A;  1PCA A;  4LQG A;  4P4E A;  1Y0R A;  2ANP A;  5LYI A;  3LWU A;  1AYE A;  4X3R A;  5CBM A;  3PB4 X;  1YLO A;  3JRU A;  3NH5 A;  1HDQ A;  5J1Q A;  1AMP A;  5JM6 A;  3KR5 A;  5THW A;  1NSA A;  4MCS A;  4ZY2 A;  1XJO A;  3D7D A;  4JYW A;  4EWT A;  2IQ6 A;  5K8N A;  4BD9 A;  1BAV A;  3IIB A;  2ZOF A;  4UF4 A;  1YME A;  4Q7A A;  4EFD A;  2PJ2 A;  4ZX9 A;  4OC3 A;  4UEF A;  5LYD A;  2FVG A;  4MHY A;  4NGT A;  3SJE A;  5D29 A;  1CPS A;  2AFZ A;  1TF9 A;  3PB7 X;  2PJ7 A;  4P10 A;  3FH4 A;  2ZEM A;  4FAI A;  2QYV A;  3KR4 A;  2I3C A;  2AFW A;  2BO9 A;  2C6P A;  3BHX A;  1VIX A;  3IEH A;  2F8H A;  5LRG A;  5LYF A;  4ONW A;  3ISX A;  4R7M A;  2ZEF A;  4DUK A;  4TWE A;  2PCU A;  1BPM A;  2GLF A;  4PXD A;  2AFX A;  3B2Y A;  4NJR A;  4YWY A;  3FEE A;  3BI1 A;  3KAS A;  2ZEG A;  2ZEN A;  7CPA A;  1GYT A;  3K2K A;  4P6Y A;  1EE3 P;  4ZX8 A;  4R8F A;  4IK2 A;  2J9A A;  3LMS A;  3NH4 A;  4AXV A;  2BOA A;  2PVV A;  4ZY0 A;  5K8M A;  4B6Z A;  2V77 A;  4O23 A;  5K8O A;  5HVH A;  2PRQ A;  4IAV A;  2CTC A;  2PJ3 A;  3FF3 A;  4P4J A;  2PJ1 A;  4WWV A;  3PBB A;  2OR4 A;  5F09 A;  2ZOG A;  1Z2L A;  4K3N A;  4MXU A;  4NJQ A;  1PYT B;  4DJL A;  3CT9 A;  3VAT A;  2IJZ A;  4PXB A;  4G1P A;  3VH9 A;  1F2O A;  1DTD A;  3S9N A;  2C6C A;  4P45 A;  3NFZ A;  3FVL A;  3DLJ A;  4GM5 A;  4P4D A;  2ZEO A;  4OKO A;  2G9D A;  1XRY A;  3B35 A;  3PRT A;  1XFO A;  4OC2 A;  4MRI A;  2ZEE A;  1VGY A;  1CP7 A;  3PB6 X;  1Q7L A;  3T8W A;  2GRE A;  1HEE A;  4A37 A;  1IY7 A;  1CX8 A;  4P4F A;  2JBK A;  3PBE A;  3QNV A;  2EK8 A;  1BPN A;  2XEJ A;  2AFS A;  3H8E A;  1CBX A;  2PJ0 A;  2ZEH A;  3PB8 X;  2CF4 A;  1YW4 A;  3PFO A;  2V8H A;  1Z5R A;  2AFO A;  1QMU A;  4UIA A;  3WC6 A;  5I4M A;  4PXE A;  1IGB A;  4UEE A;  1CP6 A;  4ZYQ A;  3NH8 A;  1RTQ A;  2PJ4 A;  5HVF A;  4OC1 A;  2EK9 A;  3K9T A;  1ELM P;  2PJC A;  1FNO A;  3D7H A;  3RZA A;  3TC8 A;  2ZEP A;  4W9Y A;  3VAR A;  3B3T A;  3IC1 A;  4ZI6 A;  1Y7E A;  1F2P A;  4RUH A;  4P4I A;  1QQ9 A;  4PQA A;  2WZN A;  4FWU A;  1TKJ A;  1R3N A;  1BLL E;  1TKH A;  1LAN A;  2PJB A;  4OP4 A;  3SJX A;  2VL1 A;  2AFU A;  3D7G A;  3B3W A;  1UWY A;  3HLP A;  3H8F A;  3KQX A;  2Q4Z A;  3NA6 A;  4MCR A;  1FT7 A;  2DEA A;  5CPA A;  3MN8 A;  5HXD A;  3I1U A;  3SJG A;  2GU2 A;  2JEW A;  4DYO A;  3B3V A;  4A39 A;  3DGV A;  3FMC A;  2IMO A;  2PJA A;  4NGQ A;  5LYL A;  5K8P A;  2XEF A;  2ZED A;  1CG2 A;  1TF8 A;  4NGP A;  4A94 A;  3IFE A;  1ZG8 A;  4MCQ A;  3BXM A;  1R43 A;  2JBJ A;  5IB9 A;  2QJ8 A;  4Z65 A;  1HDU A;  4F8Z A;  1ZLI A;  4X8I A;  4OC0 A;  4P44 A;  3B7I A;  4H2K A;  3FX6 A;  4CPA A;  4UIB A;  3GUX A;  1ZG9 A;  5D8N A;  1H8L A;  5HVG A;  1ZLH A;  3FEC A;  4R6T A;  2RB7 A;  2CTB A;  1TXR A;  5DS0 A;  2C1C A;  4F9U A;  1XMB A;  3SI1 A;  3KL9 A;  1VHE A;  4PXC A;  2EWB A;  3GLJ A;  1OBR A;  4MHP A;  1M4L A;  4JZ0 A;  4UEZ A;  2RFH A;  1LAP A;  4FBE A;  3WC7 A;  2PE3 A;  3D66 A;  1LOK A;  3SJF A;  4NGR A;  2PIZ A;  3KHX A;  1LFW A;  2CIJ A;  4YU9 A;  2HC9 A;  4MCP A;  2PIY A;  3V38 A;  1LAM A;  4R76 A;  4MMO A;  4NGS A;  4EME A;  3GB0 A;  1YW6 A;  3BI0 A;  1VHO A;  1XBU A;  4OC5 A;  2PVW A;  1F57 A;  4NFR A;  2POK A;  4OID A;  2GLJ A;  1JQG A;  3KI9 A;  2NSM A;  5JGF A;  2V8G A;  2WYR A;  1ELL P;  1ZG7 A;  3WC5 A;  4PPZ A;  3KZW A;  4OME A;  3D68 A; 
#chains in the Genus database with same CATH topology
 1NMT A;  1CJW A;  1S3Z A;  3KGQ A;  4A38 A;  3H8G A;  3T90 A;  2B5G A;  3F5B A;  2PR1 A;  4OIW A;  4MHZ A;  3SI2 A;  4PSX A;  3N5F A;  3FED A;  4KSA A;  1IOF A;  4KUA A;  2JDC A;  3WT4 A;  4YFJ A;  3WAB A;  2B3U A;  2GFQ A;  2V8V A;  4CGO A;  5G21 A;  2HB6 A;  2Q04 A;  3K9U A;  2PJ8 A;  5H86 A;  2Q51 A;  4P4B A;  3PEI A;  1P4N A;  1ON0 A;  3RBU A;  3PZJ A;  1QSM A;  2WUU A;  3D7F A;  3IWW A;  4Q36 A;  2C27 A;  3ZZI A;  4C2X A;  2YNE A;  3MGD A;  2Z10 A;  3D67 A;  1YSJ A;  3KHZ A;  4TNU A;  4Y49 B;  1Y9W A;  5ELY A;  2H5M A;  2Q43 A;  3PFE A;  3R95 A;  3D8P A;  2GE3 A;  5A27 A;  5HMN A;  1TKF A;  4CYN A;  3TX8 A;  4X2T A;  1MJB A;  2AFM A;  1Z4R A;  4KUB A;  3L2N A;  5F46 A;  2F7V A;  4MFL A;  5C82 A;  3GKR A;  4QBJ A;  2QVP A;  4FD4 A;  2FS5 A;  3S9M A;  2BCO A;  3C26 A;  2ZEL A;  1Y7R A;  3S6K A;  1Z8L A;  4F6A A;  2NYQ A;  3S6H A;  2XEI A;  4KSI A;  5BWA B;  4NGN A;  3V7Z A;  3IJ3 A;  1DE4 C;  2P0W A;  6CPA A;  1M44 A;  1OZP A;  1QST A;  2O4H A;  3RAM A;  3TE4 A;  5LRJ A;  1LCP A;  4FUU A;  1Z8X A;  2PRB A;  4NGM A;  4R9M A;  1M1D A;  1YLE A;  5HH1 A;  3WR7 A;  2OOT A;  4KVO E;  4UCN A;  2C6G A;  4CAV A;  2REE A;  2VZY A;  3WC5 A;  1B87 A;  3D4U A;  1A2Z A;  4HNW B;  2Z3M A;  3TFY A;  2K5T A;  2P6E A;  2O53 A;  3KQZ A;  1KUX A;  3BJ8 A;  3FJU A;  2Q4V A;  3D3S A;  4KZT A;  1KUV A;  2VQY A;  1ZO0 A;  3IO1 A;  3MRU A;  5LRK A;  3F8K A;  3CDX A;  3SI0 A;  1YRE A;  4L89 A;  3ISZ A;  4J3G A;  5JH9 A;  2BEI A;  2V8D A;  3B3C A;  3FXT A;  1CPX A;  2ABZ A;  3GY9 A;  3LOD A;  4UCP A;  4WJB A;  4IHM A;  4MHN A;  2PJ6 A;  3EXN A;  3HUV A;  1Z8W A;  2WSA A;  4LQ6 A;  3CPA A;  3CPX A;  3S9L A;  1S7F A;  4C2Y A;  3RO0 A;  2CNS A;  4OC4 A;  1ARM A;  2I00 A;  3FBU A;  3PB9 X;  4CGM A;  4UBR A;  4RN7 A;  3RNZ A;  3SHP A;  1YVO A;  1KWM A;  4KVM E;  2BSW A;  5KTC A;  4I49 A;  8CPA A;  4F9V A;  3B3S A;  1ARL A;  1Y0Y A;  2PJ5 A;  2PJ9 A;  2XEG A;  4FD6 A;  5JPH A;  1PCA A;  2R8V A;  4LQG A;  4P4E A;  4CYO A;  5GCN A;  3GIU A;  4H6Z A;  1Y0R A;  4NSQ A;  2ANP A;  4UCM A;  3H5Z A;  5LYI A;  3LWU A;  1AYE A;  4X3R A;  2NMT A;  2EBJ A;  5CBM A;  3PB4 X;  3TCV A;  4CAX A;  1YLO A;  2Z3O A;  3JRU A;  4LX9 A;  3FNC A;  3I9S A;  1S5K A;  2EUI A;  1HDQ A;  3NH5 A;  5J1Q A;  1AMP A;  3BJ7 A;  3VWD A;  5JM6 A;  1B6B A;  3KR5 A;  1Q2Y A;  1XOV A;  5THW A;  1NSA A;  4MCS A;  4FD5 A;  4ZY2 A;  3R9E A;  1XJO A;  5IV0 A;  3NE7 A;  3D7D A;  4JYW A;  4EWT A;  2ATR A;  2IQ6 A;  4JXR A;  5K8N A;  1M4D A;  2PSW A;  2J8R A;  3TO6 A;  4BD9 A;  1BAV A;  2R1I A;  2FIW A;  4R57 A;  3IIB A;  2ZOF A;  2X7B A;  4UF4 A;  1YME A;  4Q7A A;  4RS2 A;  1XF8 A;  4EFD A;  5G22 A;  3QAY A;  4PK3 A;  4AG9 A;  2OB0 A;  1X12 A;  4ZBG A;  2PJ2 A;  4ZX9 A;  4AVB A;  4OC3 A;  4NF1 A;  2A4N A;  1BO4 A;  3GYA A;  4UEF A;  1IB1 E;  4UWJ A;  4AG7 A;  5LYD A;  2FVG A;  4C7I A;  4MHY A;  4NGT A;  3EFA A;  3SJE A;  3IWE A;  5D29 A;  1M4I A;  1CPS A;  4CRZ B;  2AFZ A;  4KOR A;  1Z4E A;  1TF9 A;  3PB7 X;  2PJ7 A;  4P10 A;  2GAN A;  3FH4 A;  4B5O A;  1RO5 A;  4ZY1 A;  5AG7 A;  2ZEM A;  4FAI A;  2QYV A;  3KR4 A;  3DDD A;  2I3C A;  2I79 A;  4A33 A;  2AFW A;  3NE8 A;  5A28 A;  2BO9 A;  2C6P A;  3BHX A;  3S6F A;  3SXN A;  1S7N A;  1MK4 A;  4JJX A;  1VIX A;  1MJ9 A;  2HUZ A;  2F8H A;  3B8G A;  3IEH A;  5E96 A;  5LRG A;  4MFK A;  3UY5 A;  4B14 A;  4XPD B;  2J8N A;  4KVX A;  4ONW A;  5KTA A;  3ISX A;  4R7M A;  4JWP A;  4F0Y A;  5LYF A;  4HKF A;  4UFX A;  2VBQ A;  2ZEF A;  4DUK A;  4TWE A;  2PCU A;  4QUS A;  1BPM A;  2F5I A;  4CYP A;  2GLF A;  4PXD A;  4AVC A;  4CGP A;  2PDO A;  4M85 A;  2AFX A;  3B2Y A;  4NJR A;  4YWY A;  4ORF A;  3FEE A;  2PQ8 A;  4XNH C;  3BI1 A;  2P6F A;  4KOS A;  3KAS A;  2ZEG A;  2ZEN A;  2QML A;  7CPA A;  5JQ4 A;  5I0C A;  1KZF A;  1GYT A;  3K2K A;  4P6Y A;  2CNM A;  3BLN A;  4E2A A;  1I12 A;  4PK2 A;  4MI4 A;  5AGE A;  4MBU A;  4K30 A;  1EE3 P;  2B5G B;  4ZX8 A;  4R8F A;  4NCZ A;  2OH1 A;  4IK2 A;  2J9A A;  1IYL A;  3LMS A;  2ZPA A;  3NH4 A;  5J8F A;  1XIX A;  4AXV A;  3TOB A;  2BOA A;  1XMT A;  2PVV A;  4ZY0 A;  4CAW A;  4KLV A;  4DNC A;  5K8M A;  4B6Z A;  2DPS A;  3R9G A;  2V77 A;  4O23 A;  4BIN A;  1CM0 A;  5K8O A;  5HVH A;  2PRQ A;  4YGO A;  1RXT A;  4IAV A;  2CTC A;  2PJ3 A;  3TO9 A;  3OWC A;  3FF3 A;  4P4J A;  3P2H A;  1I1D A;  2Z3L A;  2PJ1 A;  4WWV A;  2CNT A;  3PBB A;  4KS9 A;  2OR4 A;  2Q4Y A;  2QIR A;  5F09 A;  2ODF A;  2ZOG A;  1Z2L A;  3G8W A;  4K3N A;  4MXU A;  4KOW A;  4CRY B;  2YGW A;  4NJQ A;  3TO7 A;  1PYT B;  2JDD A;  4OLL A;  4B5P A;  4QVT A;  4DJL A;  3CT9 A;  5AG5 A;  3VAT A;  2IJZ A;  4PXB A;  2B3V A;  1Y9K A;  4G1P A;  2QEC A;  4JD6 A;  2Q0Y A;  1F2O A;  1DTD A;  3QB8 A;  5DWN A;  2C6C A;  3VH9 A;  3S9N A;  4P45 A;  3NFZ A;  3FVL A;  3DLJ A;  2ZW5 A;  4FD7 A;  2ZEO A;  4GM5 A;  4OKO A;  4P4D A;  1SQH A;  2G9D A;  1XRY A;  3B35 A;  3H4Q A;  4U9Z A;  3PRT A;  1XFO A;  4OC2 A;  4A31 A;  4MRI A;  2ZEE A;  1VGY A;  4L8A A;  1CP7 A;  1Q2D A;  2FT0 A;  1Q7L A;  2CXA A;  2Y0M A;  3PB6 X;  3T8W A;  2GRE A;  1HEE A;  5EC4 A;  4A37 A;  1IY7 A;  1CX8 A;  4P4F A;  2JBK A;  4U5Y A;  2GIV A;  3DR6 A;  2B4D A;  3PBE A;  3QNV A;  2EK8 A;  4M6H A;  1BPN A;  2XEJ A;  3JUW A;  4R3L A;  2AFS A;  2ZXV A;  3H8E A;  1JWQ A;  3IWG A;  2CY2 A;  4CGN A;  1CBX A;  2PJ0 A;  2J8M A;  2ZEH A;  3JVN A;  4CS0 B;  3PB8 X;  2CF4 A;  4UFW A;  4JLY A;  1YW4 A;  2ZW4 A;  3PFO A;  2V8H A;  1Z9U A;  1Z5R A;  1YQE A;  2AFO A;  1QMU A;  2DPT A;  2ZW6 A;  1WWZ A;  3IU2 A;  4UIA A;  1AUG A;  3WC6 A;  5I4M A;  3V8I A;  1Z8T A;  4CAF A;  2RC4 A;  3IU1 A;  2FIA A;  4PXE A;  3LAC A;  4LUA A;  1IGB A;  4C2Z A;  3A9L A;  1CP6 A;  3R1K A;  1VHS A;  2VZZ A;  4UEE A;  4ZYQ A;  3NH8 A;  1XEB A;  4RI1 A;  4X5K A;  1RTQ A;  2PJ4 A;  5HVF A;  4B10 A;  4OC1 A;  2EK9 A;  4KOX A;  4QB9 A;  5G1Z A;  3K9T A;  1ELM P;  2PJC A;  5IB0 A;  1P0H A;  1FNO A;  3D7H A;  4MJ8 A;  3D2M A;  3RZA A;  3I3G A;  3TC8 A;  2ZEP A;  4W9Y A;  3VAR A;  3W6S A;  3B3T A;  3IC1 A;  4UA3 A;  4ZI6 A;  1IYK A;  2YND A;  4HPS A;  1Y7E A;  2G3T A;  1F2P A;  5AG4 A;  5IX3 A;  1IU8 A;  4RUH A;  4P4I A;  1QQ9 A;  4A32 A;  4C7H A;  4PQA A;  2WZN A;  2ZW7 A;  3JTK A;  1TKJ A;  4FWU A;  1R3N A;  4B13 A;  4MY3 A;  2Z3N A;  3S6G A;  4MFJ A;  1S60 A;  4NEX A;  4MFQ A;  3W6X A;  1BLL E;  4Y49 C;  3CXS A;  4F0X A;  1TKH A;  1LAN A;  2PJB A;  3FRM A;  4OP4 A;  3SJX A;  2VL1 A;  2FE7 A;  2AFU A;  3D7G A;  3TT2 A;  3B3W A;  1UWY A;  1UFH A;  3HLP A;  4UWI A;  3ZJ0 A;  3H8F A;  3KQX A;  4GS4 A;  2B4B A;  2Q4Z A;  2JLM A;  3DNS A;  3NA6 A;  2FCK A;  4AVA A;  5CNP A;  4MCR A;  1FT7 A;  2DEA A;  3RYO A;  5CPA A;  3MN8 A;  5FVJ A;  1VKC A;  1IOI A;  5HXD A;  3I1U A;  4YRH A;  1MJA A;  3SJG A;  2GU2 A;  4R3K A;  2JEW A;  2VI7 A;  3LD2 A;  1GHE A;  4A30 A;  2Q7B A;  2HV2 A;  3R96 A;  4DYO A;  1S7K A;  4PV6 A;  2ARH A;  4A2Z A;  3B3V A;  4A39 A;  1QSO A;  3DGV A;  4Q38 A;  2IMO A;  3FMC A;  1QSN A;  2PJA A;  3SXO A;  4ZGY B;  4NGQ A;  5LYL A;  5K8P A;  4AB7 A;  4II9 A;  4XNH B;  1XE4 A;  3W91 A;  4HNY B;  1NE9 A;  4C68 A;  5J8C A;  2XEF A;  1PU9 A;  2IL4 A;  1LRZ A;  2Z0Z A;  2ZED A;  1CG2 A;  1TF8 A;  2G0B A;  4MFP A;  5F49 A;  2JEV A;  2Q44 A;  4NGP A;  3KKW A;  4R87 A;  4A94 A;  2OZH A;  3IFE A;  4B11 A;  1ZG8 A;  3CXQ A;  3PGP A;  2O28 A;  1J4J A;  2B58 A;  2WPW A;  1R43 A;  2EO8 A;  2VEZ A;  3BXM A;  4MCQ A;  3DR8 A;  2JBJ A;  5IB9 A;  2QJ8 A;  2REF A;  3G3S A;  1IIC A;  2R7H A;  2D4P A;  4XPL A;  5F47 A;  4Z65 A;  4E0A A;  1HDU A;  4F8Z A;  1ZLI A;  2PC1 A;  4OC0 A;  4M6G A;  4P44 A;  4X8I A;  4IUS A;  5DWM A;  5F48 A;  3B7I A;  4M3S A;  3T9Y A;  4H2K A;  1PUA A;  3FX6 A;  2FSR A;  2YNC A;  4A95 A;  4CPA A;  4IF5 A;  1U6M A;  1YVK A;  2BUE A;  1X10 A;  4UIB A;  2OZG A;  4CGL A;  4CYQ A;  2EVN A;  2KCW A;  3GUX A;  4UFV A;  1ZG9 A;  2HQY A;  5D8N A;  1H8L A;  1YR0 A;  2P6G A;  4KOY A;  5HVG A;  2DXQ A;  1ZLH A;  1V0C A;  3FEC A;  4R6T A;  2RB7 A;  4BBH A;  3CXP A;  2CTB A;  5AG6 A;  3FB3 A;  1TXR A;  1YK3 A;  2BL1 A;  4JXQ A;  4MY0 A;  5DS0 A;  4PSW A;  2YNC C;  2C1C A;  4F9U A;  1XMB A;  3SI1 A;  4EVY A;  3KL9 A;  1VHE A;  4QC6 A;  4PXC A;  1NSL A;  4E8O A;  2EWB A;  3GLJ A;  4BMH A;  1OBR A;  4MHP A;  4MFZ A;  4GXH A;  4ONU A;  5ISV A;  1M4L A;  3TOA A;  1Q2C A;  4JZ0 A;  4UEZ A;  1IID A;  2RFH A;  1I21 A;  1LAP A;  3QAH A;  4H89 A;  2FXF A;  3WC7 A;  2PE3 A;  4FBE A;  3D66 A;  2VXK A;  1K4J A;  1LOK A;  3SJF A;  4U9Y A;  4NGR A;  4CAE A;  3FYN A;  5KTD A;  4HNX B;  2PIZ A;  2FL4 A;  2AJ6 A;  1LFW A;  3KHX A;  4B5P B;  2CIJ A;  2PR8 A;  4YU9 A;  5G20 A;  1R57 A;  2HC9 A;  4MCP A;  1N71 A;  4KOV A;  2PIY A;  3V38 A;  3P2F A;  1L0C A;  1BOB A;  1LAM A;  2AE6 A;  3PP9 A;  4H6U A;  4KLW A;  4KOU A;  4MMO A;  4NXY A;  4R76 A;  1WK4 A;  4NGS A;  4EME A;  5EMI A;  3E0K A;  1YW6 A;  3EC4 A;  3GB0 A;  3BI0 A;  4KSF A;  1VHO A;  1XBU A;  2Z3P A;  4OC5 A;  4B12 A;  3F0A A;  3EO4 A;  2D4O A;  3FIX A;  2PVW A;  1F57 A;  1FY7 A;  2OU2 A;  3R9F A;  1YX0 A;  2OZU A;  1QSR A;  4NFR A;  2POK A;  3N7Z A;  2Z11 A;  4XPK A;  3IGR A;  4OID A;  2GLJ A;  4MHD A;  1JQG A;  3CZX A;  1TIQ A;  2Q7S A;  3KI9 A;  5C88 A;  2NSM A;  5EBV A;  1M4G A;  2Z3K A;  5JGF A;  2B4D B;  2R98 A;  3VWE A;  2V8G A;  4OAD A;  2WPX A;  2WYR A;  4KOT A;  3TTH A;  1ELL P;  1KUY A;  1S7L A;  1ZG7 A;  2DF5 A;  3D2P A;  4XPD C;  4PPZ A;  3KZW A;  5H84 A;  1YGH A;  4OAE A;  3EY5 A;  4OME A;  3DSB A;  3D68 A;  2G3A A;  4M6I A; 
#chains in the Genus database with same CATH homology
 3KGQ A;  4A38 A;  3H8G A;  4OIW A;  4MHZ A;  3SI2 A;  3N5F A;  3FED A;  3WT4 A;  3WAB A;  2V8V A;  2HB6 A;  2PJ8 A;  2Q51 A;  4P4B A;  3PEI A;  3RBU A;  3IWW A;  3D7F A;  4TNU A;  3KHZ A;  3D67 A;  1YSJ A;  5ELY A;  2Q43 A;  3PFE A;  1TKF A;  3TX8 A;  4X2T A;  2AFM A;  3L2N A;  2F7V A;  2QVP A;  3S9M A;  2BCO A;  2ZEL A;  1Z8L A;  2NYQ A;  2XEI A;  4KSI A;  4NGN A;  3V7Z A;  3IJ3 A;  1DE4 C;  6CPA A;  2O4H A;  3RAM A;  5LRJ A;  1LCP A;  4FUU A;  4NGM A;  4ZY1 A;  2OOT A;  2C6G A;  3D4U A;  2O53 A;  3KQZ A;  3FJU A;  3MRU A;  3IO1 A;  5LRK A;  3CDX A;  3SI0 A;  3ISZ A;  5JH9 A;  2V8D A;  3B3C A;  1CPX A;  2ABZ A;  4WJB A;  4IHM A;  4MHN A;  2PJ6 A;  3HUV A;  3CPA A;  3CPX A;  3S9L A;  4OC4 A;  1ARM A;  3PB9 X;  1KWM A;  8CPA A;  4F9V A;  3B3S A;  1ARL A;  1Y0Y A;  2PJ5 A;  2PJ9 A;  2XEG A;  1PCA A;  4LQG A;  4P4E A;  1Y0R A;  2ANP A;  5LYI A;  3LWU A;  1AYE A;  4X3R A;  5CBM A;  3PB4 X;  1YLO A;  3JRU A;  3NH5 A;  1HDQ A;  5J1Q A;  1AMP A;  5JM6 A;  3KR5 A;  5THW A;  1NSA A;  4MCS A;  4ZY2 A;  1XJO A;  3D7D A;  4JYW A;  4EWT A;  2IQ6 A;  5K8N A;  4BD9 A;  1BAV A;  3IIB A;  2ZOF A;  4UF4 A;  1YME A;  4Q7A A;  4EFD A;  2PJ2 A;  4ZX9 A;  4OC3 A;  4UEF A;  5LYD A;  2FVG A;  4MHY A;  4NGT A;  3SJE A;  5D29 A;  1CPS A;  2AFZ A;  1TF9 A;  3PB7 X;  2PJ7 A;  4P10 A;  3FH4 A;  2ZEM A;  4FAI A;  2QYV A;  3KR4 A;  2I3C A;  2AFW A;  2BO9 A;  2C6P A;  3BHX A;  1VIX A;  3IEH A;  2F8H A;  5LRG A;  5LYF A;  4ONW A;  3ISX A;  4R7M A;  2ZEF A;  4DUK A;  4TWE A;  2PCU A;  1BPM A;  2GLF A;  4PXD A;  2AFX A;  3B2Y A;  4NJR A;  4YWY A;  3FEE A;  3BI1 A;  3KAS A;  2ZEG A;  2ZEN A;  7CPA A;  1GYT A;  3K2K A;  4P6Y A;  1EE3 P;  4ZX8 A;  4R8F A;  4IK2 A;  2J9A A;  3LMS A;  3NH4 A;  4AXV A;  2BOA A;  2PVV A;  4ZY0 A;  5K8M A;  4B6Z A;  2V77 A;  4O23 A;  5K8O A;  5HVH A;  2PRQ A;  4IAV A;  2CTC A;  2PJ3 A;  3FF3 A;  4P4J A;  2PJ1 A;  4WWV A;  3PBB A;  2OR4 A;  5F09 A;  2ZOG A;  1Z2L A;  4K3N A;  4MXU A;  4NJQ A;  1PYT B;  4DJL A;  3CT9 A;  3VAT A;  2IJZ A;  4PXB A;  4G1P A;  3VH9 A;  1F2O A;  1DTD A;  3S9N A;  2C6C A;  4P45 A;  3NFZ A;  3FVL A;  3DLJ A;  4GM5 A;  4P4D A;  2ZEO A;  4OKO A;  2G9D A;  1XRY A;  3B35 A;  3PRT A;  1XFO A;  4OC2 A;  4MRI A;  2ZEE A;  1VGY A;  1CP7 A;  3PB6 X;  1Q7L A;  3T8W A;  2GRE A;  1HEE A;  4A37 A;  1IY7 A;  1CX8 A;  4P4F A;  2JBK A;  3PBE A;  3QNV A;  2EK8 A;  1BPN A;  2XEJ A;  2AFS A;  3H8E A;  1CBX A;  2PJ0 A;  2ZEH A;  3PB8 X;  2CF4 A;  1YW4 A;  3PFO A;  2V8H A;  1Z5R A;  2AFO A;  1QMU A;  4UIA A;  3WC6 A;  5I4M A;  4PXE A;  1IGB A;  4UEE A;  1CP6 A;  4ZYQ A;  3NH8 A;  1RTQ A;  2PJ4 A;  5HVF A;  4OC1 A;  2EK9 A;  3K9T A;  1ELM P;  2PJC A;  1FNO A;  3D7H A;  3RZA A;  3TC8 A;  2ZEP A;  4W9Y A;  3VAR A;  3B3T A;  3IC1 A;  4ZI6 A;  1Y7E A;  1F2P A;  4RUH A;  4P4I A;  1QQ9 A;  4PQA A;  2WZN A;  4FWU A;  1TKJ A;  1R3N A;  1BLL E;  1TKH A;  1LAN A;  2PJB A;  4OP4 A;  3SJX A;  2VL1 A;  2AFU A;  3D7G A;  3B3W A;  1UWY A;  3HLP A;  3H8F A;  3KQX A;  2Q4Z A;  3NA6 A;  4MCR A;  1FT7 A;  2DEA A;  5CPA A;  3MN8 A;  5HXD A;  3I1U A;  3SJG A;  2GU2 A;  2JEW A;  4DYO A;  3B3V A;  4A39 A;  3DGV A;  3FMC A;  2IMO A;  2PJA A;  4NGQ A;  5LYL A;  5K8P A;  2XEF A;  2ZED A;  1CG2 A;  1TF8 A;  4NGP A;  4A94 A;  3IFE A;  1ZG8 A;  4MCQ A;  3BXM A;  1R43 A;  2JBJ A;  5IB9 A;  2QJ8 A;  4Z65 A;  1HDU A;  4F8Z A;  1ZLI A;  4X8I A;  4OC0 A;  4P44 A;  3B7I A;  4H2K A;  3FX6 A;  4CPA A;  4UIB A;  3GUX A;  1ZG9 A;  5D8N A;  1H8L A;  5HVG A;  1ZLH A;  3FEC A;  4R6T A;  2RB7 A;  2CTB A;  1TXR A;  5DS0 A;  2C1C A;  4F9U A;  1XMB A;  3SI1 A;  3KL9 A;  1VHE A;  4PXC A;  2EWB A;  3GLJ A;  1OBR A;  4MHP A;  1M4L A;  4JZ0 A;  4UEZ A;  2RFH A;  1LAP A;  4FBE A;  3WC7 A;  2PE3 A;  3D66 A;  1LOK A;  3SJF A;  4NGR A;  2PIZ A;  3KHX A;  1LFW A;  2CIJ A;  4YU9 A;  2HC9 A;  4MCP A;  2PIY A;  3V38 A;  1LAM A;  4R76 A;  4MMO A;  4NGS A;  4EME A;  3GB0 A;  1YW6 A;  3BI0 A;  1VHO A;  1XBU A;  4OC5 A;  2PVW A;  1F57 A;  4NFR A;  2POK A;  4OID A;  2GLJ A;  1JQG A;  3KI9 A;  2NSM A;  5JGF A;  2V8G A;  2WYR A;  1ELL P;  1ZG7 A;  3WC5 A;  4PPZ A;  3KZW A;  4OME A;  3D68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...