1FT7A

Aap complexed with l-leucinephosphonic acid
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the aminopeptidase from Aeromonas proteolytica by L-leucinephosphonic acid. Spectroscopic and crystallographic characterization of the transition state of peptide hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BACTERIAL LEUCYL AMINOPEPTIDASE
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ft7A00
4A94A 4WWVA 2NSMA 2AFSA 2GLFA 2PJ9A 2JBKA 2C6PA 2O53A 5CBMA 1DE4C 3B35A 3K9TA 3WC6A 3QNVA 4GM5A 2ZEFA 2C6CA 4NJRA 2PJBA 3DGVA 1XFOA 4P4IA 3B3SA 2EK8A 1VHEA 3PBBA 4OIDA 4P6YA 2PVWA 5K8MA 1YW4A 1CBXA 1ZLIA 4Z65A 2ZEOA 2ABZA 3SI1A 4AXVA 3D7FA 1F2OA 3TC8A 3KHXA 3PB9X 4B6ZA 2PJ2A 3HLPA 4A39A 3NA6A 2PIYA 2ZEPA 4X8IA 3IJ3A 2OR4A 3WC7A 4NGMA 4ZY2A 4ZY0A 4OC1A 1FT7A 4A38A 1Y7EA 3BXMA 4X3RA 4YU9A 3HUVA 2ZELA 2EWBA 3MN8A 3KQZA 4OC0A 4PQAA 3LMSA 2V8VA 2IJZA 3FVLA 4MCSA 1ELMP 2Q4ZA 3FH4A 3BI1A 1PYTB 2PJCA 5ELYA 2ZEDA 5K8OA 2J9AA 4UEFA 3PB8X 4PXEA 1F57A 4TNUA 3MRUA 1VGYA 4OC5A 1CG2A 5I4MA 3IO1A 3KGQA 3PEIA 3GLJA 4LQGA 1NSAA 5D8NA 1CP7A 2CF4A 2WYRA 4F8ZA 2CTCA 1BAVA 3ISZA 4DUKA 2HC9A 4OC4A 2CIJA 4ZI6A 3H8GA 1AYEA 4UF4A 4MCRA 4PPZA 4FWUA 1VIXA 2PJ4A 3D66A 3FEEA 1HDQA 4FAIA 1TXRA 2V8DA 2PJ8A 2ZENA 2QVPA 4BD9A 4OC3A 1ARMA 3IEHA 5HVGA 2RFHA 5K8NA 1LOKA 3SJGA 3N5FA 1BPMA 4F9VA 2BO9A 2GLJA 4PXDA 2PJ3A 2AFZA 4F9UA 1QMUA 3H8FA 4K3NA 5LYFA 2PE3A 1HEEA 3D7HA 1YMEA 2ZEHA 3B3TA 4MRIA 2AFMA 3D4UA 4ZY1A 2O4HA 3V38A 2AFOA 1TKJA 4R76A 5LRGA 1YSJA 3SI2A 2V77A 3H8EA 4UEZA 2AFXA 3NFZA 4P4DA 5CPAA 2HB6A 4NGNA 1CPXA 3PB7X 1R3NA 4JZ0A 4MHYA 5JGFA 3D68A 3RZAA 1R43A 3SJEA 1TF8A 4TWEA 1XBUA 4DYOA 3B7IA 4KSIA 4ONWA 4NFRA 2AFUA 2QJ8A 4FBEA 7CPAA 1CPSA 1GYTA 1Z5RA 1F2PA 3WT4A 4MCQA 1YW6A 2JBJA 2ZOGA 3KL9A 4ZX9A 1IY7A 3L2NA 1XJOA 1ZG7A 3KQXA 4MHPA 2IMOA 3CT9A 1M4LA 4G1PA 4ZX8A 1ZG8A 2EK9A 5DS0A 3B3VA 2VL1A 2OOTA 2XEJA 1EE3P 1Z2LA 3JRUA 1DTDA 3K2KA 4OIWA 3S9MA 1HDUA 1XRYA 3CDXA 2CTBA 5HXDA 1AMPA 2WZNA 3KASA 2PJ7A 1QQ9A 4RUHA 1H8LA 4MHZA 2C6GA 3PFEA 3CPXA 2BCOA 3FECA 3VARA 4NGPA 3SJFA 2PJAA 2PJ1A 4R7MA 2XEFA 4NGQA 3D67A 3FJUA 3VATA 4FUUA 3B3WA 3WABA 4PXBA 8CPAA 1Y0YA 2I3CA 1ZLHA 1ZG9A 6CPAA 2PVVA 4O23A 3KZWA 1LCPA 2ZOFA 4MCPA 4R6TA 1Z8LA 1LFWA 2PIZA 4P44A 1YLOA 2DEAA 4YWYA 4MHNA 3CPAA 3NH4A 3SI0A 3IIBA 3PB6X 5LRJA 2F8HA 4JYWA 2ANPA 2ZEGA 3IFEA 4EWTA 4MMOA 1ELLP 3GB0A 2Q51A 1RTQA 3FMCA 2GU2A 2RB7A 3RAMA 3WC5A 1IGBA 2G9DA 2QYVA 4IAVA 4NGSA 4WJBA 2PCUA 1CP6A 5IB9A 4OC2A 3DLJA 3T8WA 3V7ZA 2FVGA 3I1UA 3PBEA 2ZEMA 3KI9A 1FNOA 4OKOA 1Y0RA 3NH5A 4ZYQA 4EFDA 4UIBA 2PJ6A 2XEIA 3B2YA 3PRTA 2AFWA 1BLLE 1TKHA 2PRQA 2XEGA 3KR5A 2V8HA 1TKFA 4H2KA 4Q7AA 1CX8A 3FF3A 3KR4A 2NYQA 4PXCA 5HVHA 4IHMA 1LAPA 3BI0A 5D29A 4CPAA 3FEDA 5F09A 3ISXA 5LYIA 4UEEA 2IQ6A 2BOAA 3D7GA 5JM6A 3S9NA 1LAMA 4OMEA 3B3CA 5HVFA 3PFOA 1VHOA 4MXUA 4P10A 1XMBA 2F7VA 4OP4A 4P4FA 2GREA 3GUXA 3FX6A 3KHZA 3BHXA 4P4BA 4P4JA 4NGTA 4DJLA 1TF9A 4NGRA 1ARLA 3RBUA 5LRKA 2POKA 3IWWA 4P4EA 4UIAA 3IC1A 2PJ5A 3TX8A 2Q43A 3D7DA 2C1CA 1UWYA 5LYDA 4X2TA 3SJXA 3VH9A 2PJ0A 4EMEA 1BPNA 4R8FA 2ZEEA 1JQGA 3LWUA 1OBRA 1PCAA 1KWMA 3S9LA 1LANA 5LYLA 2JEWA 3PB4X 1Q7LA 4W9YA 5THWA 4P45A 4NJQA 3NH8A 5JH9A 4A37A 5J1QA 2V8GA 5K8PA 4IK2A
chains in the Genus database with same CATH superfamily
1S7LA 4UA3A 1KZFA 4A94A 1K4JA 4WWVA 2NSMA 1V0CA 2AFSA 2GLFA 2PJ9A 2VBQA 2JBKA 2BUEA 2C6PA 2FXFA 2O53A 4MJ8A 5CBMA 4QUSA 2ZW4A 1DE4C 3B35A 3K9TA 4KSAA 2QECA 4AG9A 3BJ8A 2WPWA 3WC6A 3ZZIA 3QNVA 4GM5A 5HH1A 2ZEFA 4CGNA 2C6CA 3PP9A 4NJRA 1IIDA 2PJBA 1Q2CA 3DGVA 1XFOA 3I3GA 4P4IA 3B3SA 1CJWA 3RYOA 5F49A 2EK8A 3D2MA 2FE7A 1Z9UA 4MY3A 1A2ZA 1Y9KA 2B5GA 4E2AA 1VHEA 2I79A 4OAEA 3F0AA 4ORFA 4UFXA 2R1IA 4J3GA 3PBBA 4IF5A 2PR1A 2VEZA 4OIDA 4XPDC 3P2HA 5IX3A 4P6YA 1Y7RA 2Z0ZA 4CS0B 2PVWA 3G8WA 5K8MA 1YW4A 1CBXA 3DR8A 1L0CA 3IU1A 1S7NA 1ZLIA 4U9YA 4Z65A 2ZEOA 2ABZA 3SI1A 4AXVA 4BBHA 3D7FA 1F2OA 3FBUA 2CNMA 1BO4A 2FSRA 4Y49B 3KHXA 3TC8A 3PB9X 4B6ZA 2PJ2A 3D3SA 4B11A 3HLPA 4A39A 3NA6A 3UY5A 2OZGA 2PIYA 2ZEPA 4R3LA 4X8IA 4CAXA 4KS9A 3FIXA 3IJ3A 2FCKA 2OR4A 3FXTA 4NGMA 4ZY2A 4H6UA 4I49A 3WC7A 4ZY0A 2JDCA 4OC1A 2Q4YA 1FT7A 3BLNA 3R9EA 2HV2A 4A38A 1S3ZA 1Y7EA 3BXMA 1Z4RA 4X3RA 4YU9A 3HUVA 4KOUA 4UWIA 2ZELA 2EWBA 3MN8A 4R87A 1XEBA 3KQZA 4OC0A 4PQAA 1NMTA 3LMSA 2V8VA 3DSBA 2B58A 4FD6A 4MFZA 4X5KA 4CGMA 2NMTA 2B3UA 2IJZA 2REFA 1Y9WA 3C26A 4JXRA 4UFWA 2R98A 3FVLA 1S5KA 2KCWA 4JLYA 4MCSA 4RN7A 4PK3A 5EMIA 2DXQA 1ELMP 3DNSA 4KZTA 2Q4ZA 2Z11A 3FH4A 4B12A 3BI1A 2YNDA 5CNPA 1PYTB 3V8IA 3VWDA 2PJCA 1XOVA 5ELYA 2ZEDA 4IUSA 4AVBA 4BMHA 1XMTA 5K8OA 2J9AA 1QSTA 4NXYA 4UEFA 1S60A 3PB8X 5A28A 4PXEA 1F57A 3W6XA 4F0XA 4EVYA 4R57A 2REEA 4TNUA 3MRUA 1QSOA 2AE6A 4QB9A 2EBJA 4L8AA 1M1DA 1VGYA 4YRHA 5FVJA 1CG2A 4OC5A 5I4MA 3IO1A 3KGQA 3PEIA 3GLJA 4LQGA 4RI1A 1FY7A 4KOVA 2K5TA 3S6KA 1NSAA 1NE9A 5D8NA 3CXSA 4KLWA 1CP7A 2CF4A 3CXPA 2WYRA 3KKWA 1IYKA 3W91A 4A31A 4CYNA 4C7HA 1Z4EA 4F8ZA 3T90A 5JQ4A 4UBRA 3LODA 2CTCA 3SHPA 1Z8WA 2BL1A 1BAVA 2OH1A 3ISZA 4DUKA 1PUAA 2HC9A 5F47A 4OC4A 2CIJA 1XE4A 4ZI6A 5EC4A 4II9A 3H8GA 4KOWA 2Q44A 1PU9A 4CYOA 4KLVA 4MY0A 1AYEA 1XIXA 4UF4A 4MCRA 4PPZA 2G3AA 4FWUA 1VIXA 2PJ4A 2R8VA 3D66A 3FEEA 5IB0A 1HDQA 2OZHA 4FAIA 1TXRA 1WWZA 2Q7BA 2V8DA 2PJ8A 3IU2A 3IGRA 2ZENA 2QVPA 4BD9A 4OC3A 1ARMA 1BOBA 4KSFA 4M6HA 5AG7A 4AB7A 4C2ZA 2CNTA 2DPTA 3IEHA 5HVGA 1MJ9A 2RFHA 5K8NA 1LOKA 3SJGA 3N5FA 2DPSA 1BPMA 4F9VA 2BO9A 3S6FA 2GLJA 4PXDA 4HNYB 1IOIA 3S6HA 1Q2DA 2PJ3A 3TO7A 1M4DA 2AFZA 3K9UA 4F9UA 5G20A 1QMUA 1IYLA 2IL4A 3H8FA 2OU2A 2AJ6A 2FL4A 4K3NA 4DNCA 5LYFA 2PE3A 4ZGYB 1HEEA 1IICA 1YMEA 3D7HA 2ZEHA 3B3TA 4MRIA 3TT2A 3NE8A 4KOSA 2R7HA 4CGLA 5G1ZA 2AFMA 4UCNA 3R9GA 4NEXA 3D4UA 4CAFA 4ZY1A 2Y0MA 4KUBA 2O4HA 3V38A 2AFOA 1KUYA 1TKJA 4R76A 4A33A 5LRGA 1I1DA 2HUZA 4JD6A 1YSJA 3SI2A 4MFKA 4MFLA 2V77A 3A9LA 2Q7SA 3H8EA 4UEZA 4UCPA 2AFXA 4L89A 3GIUA 3LACA 1Z8XA 3NFZA 2QMLA 4P4DA 5CPAA 4QVTA 2HB6A 4NGNA 1CPXA 3EO4A 3PB7X 2QIRA 1R3NA 4JZ0A 1IB1E 4MHYA 5JGFA 3D68A 5JPHA 2ZW5A 3RZAA 5E96A 1R43A 1SQHA 3SJEA 1YREA 2VQYA 4FD4A 3MGDA 1M4IA 2J8RA 1Z8TA 1TF8A 4UWJA 4LUAA 4TWEA 1XBUA 4DYOA 4A30A 3B7IA 4KSIA 3B8GA 2CY2A 2AFUA 4NFRA 4ONWA 4YFJA 2QJ8A 4C2YA 2YNCA 4FBEA 2PDOA 1VKCA 7CPAA 4ZBGA 5AG6A 4C7IA 4OLLA 1CPSA 1GYTA 2G0BA 1Z5RA 1F2PA 3G3SA 4C2XA 1TIQA 4MCQA 1YW6A 3WT4A 4F0YA 4U5YA 2RC4A 3JTKA 3EY5A 2JBJA 2ZOGA 3KL9A 4ZX9A 4H89A 1IY7A 2ARHA 1XF8A 3L2NA 1CM0A 5AG4A 1XJOA 4AVAA 2Q4VA 3RO0A 5C88A 1ZG7A 3TCVA 2Q0YA 3KQXA 4MHPA 2IMOA 3R1KA 3CT9A 1M4LA 4G1PA 4ZX8A 1ZG8A 2EK9A 4A2ZA 1KUXA 2YNCC 5DS0A 3TFYA 3EXNA 3B3VA 2PR8A 4MHDA 2VL1A 4UCMA 2XEJA 2OOTA 3CZXA 1EE3P 2JEVA 1Z2LA 2ZPAA 3JUWA 2CNSA 4MFPA 3JRUA 1P4NA 5G22A 2GFQA 2FT0A 4LQ6A 4R3KA 1DTDA 2Z3OA 3K2KA 3I9SA 4OIWA 2ODFA 3S9MA 3FYNA 2O28A 1WK4A 2Z3LA 3R95A 1I21A 2OB0A 3PGPA 1JWQA 2GIVA 3TO6A 2A4NA 1HDUA 1RO5A 4A95A 2BSWA 4XPLA 1XRYA 2Q04A 3CDXA 4PSWA 2PC1A 3PZJA 2FIWA 4CGOA 3H5ZA 2EVNA 2CTBA 4KOXA 1J4JA 3N7ZA 2ZW6A 5H84A 1AMPA 2WZNA 3KASA 5HXDA 4CYPA 5J8FA 2PJ7A 1QQ9A 3R96A 1R57A 4RUHA 1H8LA 4Q38A 4MHZA 4E8OA 2C6GA 5A27A 4GXHA 4LX9A 2BEIA 3S6GA 3PFEA 3CPXA 1B6BA 1S7FA 3SXNA 2BCOA 2D4OA 2Z3MA 4XNHC 5AGEA 3FECA 5AG5A 4NGPA 3SJFA 3EFAA 3VARA 4BINA 4A32A 2PJAA 2PJ1A 3F8KA 4R7MA 5DWNA 3FNCA 2Z3NA 4CRZB 3TO9A 2XEFA 4NGQA 3D67A 3FJUA 4GS4A 4FUUA 4Q36A 3VATA 3ZJ0A 2VI7A 4E0AA 3B3WA 3BJ7A 1X10A 4JXQA 4FD5A 4KUAA 3SXOA 3WABA 4PXBA 1QSRA 8CPAA 1Y0YA 2I3CA 4PSXA 1ZLHA 1ZG9A 2JLMA 2EUIA 6CPAA 2PVVA 4O23A 2FS5A 1YVKA 3KZWA 1LCPA 1YGHA 4NCZA 4Y49C 2I00A 2Z10A 2Z3PA 4B5PB 2ZOFA 1Q2YA 3H4QA 2GANA 4MCPA 1QSMA 4R6TA 1Z8LA 2PQ8A 2YGWA 4CAVA 2B5GB 1LFWA 2C27A 2PIZA 2P0WA 4P44A 4RS2A 1I12A 1YLOA 2DEAA 4PK2A 3DDDA 1X12A 4XPDB 1IU8A 4YWYA 4MHNA 3CPAA 3NH4A 3SI0A 3IIBA 2X7BA 2YNEA 3PB6X 1S7KA 4OADA 5LRJA 4PV6A 1RXTA 3T9YA 2F8HA 4JYWA 2ANPA 2ZEGA 3IFEA 4EWTA 3P2FA 4MMOA 1ELLP 3D2PA 1B87A 3IWEA 3OWCA 3CXQA 3GB0A 1VHSA 3IWGA 1YVOA 2Q51A 1RTQA 3FMCA 4QC6A 3TTHA 2GU2A 1YQEA 2RB7A 4KORA 4B5OA 3RAMA 3WC5A 1IGBA 1IOFA 2G9DA 5F46A 4MFJA 2QYVA 2GE3A 3NE7A 4H6ZA 4IAVA 2FIAA 4NGSA 4K30A 2VXKA 4C68A 4QBJA 4WJBA 5KTAA 1YK3A 2PRBA 2PCUA 1CP6A 5IB9A 4OC2A 5J8CA 3DLJA 1OZPA 3T8WA 3V7ZA 2FVGA 1MJBA 2WPXA 4M6IA 3I1UA 4ONUA 3RNZA 3PBEA 2ZEMA 3KI9A 4HNWB 3TOBA 2HQYA 1NSLA 1FNOA 4OKOA 1Y0RA 4CAEA 3NH5A 4M6GA 3E0KA 5F48A 4ZYQA 4EFDA 4UIBA 3W6SA 2JDDA 2PJ6A 2XEIA 2D4PA 4F6AA 3B2YA 3EC4A 3PRTA 4XPKA 2AFWA 2DF5A 2H5MA 1BLLE 1TKHA 2PRQA 3F5BA 3GY9A 4YGOA 4AG7A 4CYQA 5C82A 2XEGA 4HPSA 2ZXVA 4M3SA 3KR5A 5I0CA 5IV0A 2V8HA 1TKFA 2ATRA 3QAHA 4H2KA 4KOYA 4HNXB 4Q7AA 1CX8A 3FB3A 4UFVA 5GCNA 1M4GA 3FF3A 3KR4A 2NYQA 4PXCA 5HVHA 1MK4A 4IHMA 1M44A 1LAPA 2J8MA 3BI0A 4B5PA 5D29A 4CPAA 3FEDA 2B4BA 3JVNA 5F09A 3ISXA 5LYIA 4B14A 2B4DB 4UEEA 5ISVA 4CGPA 2B3VA 1MJAA 2IQ6A 4U9ZA 2G3TA 2BOAA 4B10A 4B13A 4NSQA 3D7GA 2P6FA 4M85A 5JM6A 3S9NA 1LAMA 1GHEA 4KVOE 1U6MA 4OMEA 3B3CA 5HVFA 4HKFA 2PSWA 5DWMA 3PFOA 1YX0A 1VHOA 4MXUA 4P10A 1XMBA 2F7VA 4AVCA 4OP4A 4P4FA 3WR7A 1ON0A 2GREA 1P0HA 2F5IA 3DR6A 3GUXA 1ZO0A 3FX6A 3TOAA 3LD2A 3KHZA 3BHXA 4JJXA 3QAYA 1KUVA 4P4BA 1YR0A 4P4JA 5HMNA 1AUGA 3QB8A 1QSNA 4NGTA 2CXAA 1TF9A 4DJLA 4NGRA 1YLEA 1ARLA 4XNHB 3RBUA 2POKA 3IWWA 5LRKA 3TE4A 4P4EA 3VWEA 2OZUA 3FRMA 4UIAA 3IC1A 2PJ5A 1N71A 3TX8A 2Q43A 3D7DA 5G21A 2C1CA 4FD7A 5H86A 2EO8A 2J8NA 2WUUA 3D8PA 1UWYA 2B4DA 2P6EA 2VZZA 2Z3KA 5LYDA 4X2TA 3GKRA 3SJXA 4CRYB 3VH9A 4KOTA 4CAWA 5KTCA 2PJ0A 4EMEA 1BPNA 4R8FA 2ZEEA 1JQGA 2WSAA 3LWUA 1OBRA 1UFHA 2ZW7A 3GYAA 4KVME 2P6GA 4MFQA 4MI4A 1PCAA 1KWMA 5KTDA 2VZYA 3S9LA 1LANA 5LYLA 2JEWA 3PB4X 1Q7LA 4NF1A 4W9YA 4KVXA 4P45A 5THWA 4NJQA 3R9FA 3NH8A 4MBUA 5EBVA 5JH9A 1LRZA 4A37A 5BWAB 4R9MA 5J1QA 4JWPA 2V8GA 5K8PA 4IK2A
chains in the Genus database with same CATH topology
4A94A 4WWVA 2NSMA 2AFSA 2GLFA 2PJ9A 2JBKA 2C6PA 2O53A 5CBMA 1DE4C 3B35A 3K9TA 3WC6A 3QNVA 4GM5A 2ZEFA 2C6CA 4NJRA 2PJBA 3DGVA 1XFOA 4P4IA 3B3SA 2EK8A 1VHEA 3PBBA 4OIDA 4P6YA 2PVWA 5K8MA 1YW4A 1CBXA 1ZLIA 4Z65A 2ZEOA 2ABZA 3SI1A 4AXVA 3D7FA 1F2OA 3TC8A 3KHXA 3PB9X 4B6ZA 2PJ2A 3HLPA 4A39A 3NA6A 2PIYA 2ZEPA 4X8IA 3IJ3A 2OR4A 3WC7A 4NGMA 4ZY2A 4ZY0A 4OC1A 1FT7A 4A38A 1Y7EA 3BXMA 4X3RA 4YU9A 3HUVA 2ZELA 2EWBA 3MN8A 3KQZA 4OC0A 4PQAA 3LMSA 2V8VA 2IJZA 3FVLA 4MCSA 1ELMP 2Q4ZA 3FH4A 3BI1A 1PYTB 2PJCA 5ELYA 2ZEDA 5K8OA 2J9AA 4UEFA 3PB8X 4PXEA 1F57A 4TNUA 3MRUA 1VGYA 4OC5A 1CG2A 5I4MA 3IO1A 3KGQA 3PEIA 3GLJA 4LQGA 1NSAA 5D8NA 1CP7A 2CF4A 2WYRA 4F8ZA 2CTCA 1BAVA 3ISZA 4DUKA 2HC9A 4OC4A 2CIJA 4ZI6A 3H8GA 1AYEA 4UF4A 4MCRA 4PPZA 4FWUA 1VIXA 2PJ4A 3D66A 3FEEA 1HDQA 4FAIA 1TXRA 2V8DA 2PJ8A 2ZENA 2QVPA 4BD9A 4OC3A 1ARMA 3IEHA 5HVGA 2RFHA 5K8NA 1LOKA 3SJGA 3N5FA 1BPMA 4F9VA 2BO9A 2GLJA 4PXDA 2PJ3A 2AFZA 4F9UA 1QMUA 3H8FA 4K3NA 5LYFA 2PE3A 1HEEA 3D7HA 1YMEA 2ZEHA 3B3TA 4MRIA 2AFMA 3D4UA 4ZY1A 2O4HA 3V38A 2AFOA 1TKJA 4R76A 5LRGA 1YSJA 3SI2A 2V77A 3H8EA 4UEZA 2AFXA 3NFZA 4P4DA 5CPAA 2HB6A 4NGNA 1CPXA 3PB7X 1R3NA 4JZ0A 4MHYA 5JGFA 3D68A 3RZAA 1R43A 3SJEA 1TF8A 4TWEA 1XBUA 4DYOA 3B7IA 4KSIA 4ONWA 4NFRA 2AFUA 2QJ8A 4FBEA 7CPAA 1CPSA 1GYTA 1Z5RA 1F2PA 3WT4A 4MCQA 1YW6A 2JBJA 2ZOGA 3KL9A 4ZX9A 1IY7A 3L2NA 1XJOA 1ZG7A 3KQXA 4MHPA 2IMOA 3CT9A 1M4LA 4G1PA 4ZX8A 1ZG8A 2EK9A 5DS0A 3B3VA 2VL1A 2OOTA 2XEJA 1EE3P 1Z2LA 3JRUA 1DTDA 3K2KA 4OIWA 3S9MA 1HDUA 1XRYA 3CDXA 2CTBA 5HXDA 1AMPA 2WZNA 3KASA 2PJ7A 1QQ9A 4RUHA 1H8LA 4MHZA 2C6GA 3PFEA 3CPXA 2BCOA 3FECA 3VARA 4NGPA 3SJFA 2PJAA 2PJ1A 4R7MA 2XEFA 4NGQA 3D67A 3FJUA 3VATA 4FUUA 3B3WA 3WABA 4PXBA 8CPAA 1Y0YA 2I3CA 1ZLHA 1ZG9A 6CPAA 2PVVA 4O23A 3KZWA 1LCPA 2ZOFA 4MCPA 4R6TA 1Z8LA 1LFWA 2PIZA 4P44A 1YLOA 2DEAA 4YWYA 4MHNA 3CPAA 3NH4A 3SI0A 3IIBA 3PB6X 5LRJA 2F8HA 4JYWA 2ANPA 2ZEGA 3IFEA 4EWTA 4MMOA 1ELLP 3GB0A 2Q51A 1RTQA 3FMCA 2GU2A 2RB7A 3RAMA 3WC5A 1IGBA 2G9DA 2QYVA 4IAVA 4NGSA 4WJBA 2PCUA 1CP6A 5IB9A 4OC2A 3DLJA 3T8WA 3V7ZA 2FVGA 3I1UA 3PBEA 2ZEMA 3KI9A 1FNOA 4OKOA 1Y0RA 3NH5A 4ZYQA 4EFDA 4UIBA 2PJ6A 2XEIA 3B2YA 3PRTA 2AFWA 1BLLE 1TKHA 2PRQA 2XEGA 3KR5A 2V8HA 1TKFA 4H2KA 4Q7AA 1CX8A 3FF3A 3KR4A 2NYQA 4PXCA 5HVHA 4IHMA 1LAPA 3BI0A 5D29A 4CPAA 3FEDA 5F09A 3ISXA 5LYIA 4UEEA 2IQ6A 2BOAA 3D7GA 5JM6A 3S9NA 1LAMA 4OMEA 3B3CA 5HVFA 3PFOA 1VHOA 4MXUA 4P10A 1XMBA 2F7VA 4OP4A 4P4FA 2GREA 3GUXA 3FX6A 3KHZA 3BHXA 4P4BA 4P4JA 4NGTA 4DJLA 1TF9A 4NGRA 1ARLA 3RBUA 5LRKA 2POKA 3IWWA 4P4EA 4UIAA 3IC1A 2PJ5A 3TX8A 2Q43A 3D7DA 2C1CA 1UWYA 5LYDA 4X2TA 3SJXA 3VH9A 2PJ0A 4EMEA 1BPNA 4R8FA 2ZEEA 1JQGA 3LWUA 1OBRA 1PCAA 1KWMA 3S9LA 1LANA 5LYLA 2JEWA 3PB4X 1Q7LA 4W9YA 5THWA 4P45A 4NJQA 3NH8A 5JH9A 4A37A 5J1QA 2V8GA 5K8PA 4IK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A94 A;  4WWV A;  2NSM A;  2AFS A;  2GLF A;  2PJ9 A;  2JBK A;  2C6P A;  2O53 A;  5CBM A;  1DE4 C;  3B35 A;  3K9T A;  3WC6 A;  3QNV A;  4GM5 A;  2ZEF A;  2C6C A;  4NJR A;  2PJB A;  3DGV A;  1XFO A;  4P4I A;  3B3S A;  2EK8 A;  1VHE A;  3PBB A;  4OID A;  4P6Y A;  2PVW A;  5K8M A;  1YW4 A;  1CBX A;  1ZLI A;  4Z65 A;  2ZEO A;  2ABZ A;  3SI1 A;  4AXV A;  3D7F A;  1F2O A;  3TC8 A;  3KHX A;  3PB9 X;  4B6Z A;  2PJ2 A;  3HLP A;  4A39 A;  3NA6 A;  2PIY A;  2ZEP A;  4X8I A;  3IJ3 A;  2OR4 A;  3WC7 A;  4NGM A;  4ZY2 A;  4ZY0 A;  4OC1 A;  1FT7 A;  4A38 A;  1Y7E A;  3BXM A;  4X3R A;  4YU9 A;  3HUV A;  2ZEL A;  2EWB A;  3MN8 A;  3KQZ A;  4OC0 A;  4PQA A;  3LMS A;  2V8V A;  2IJZ A;  3FVL A;  4MCS A;  1ELM P;  2Q4Z A;  3FH4 A;  3BI1 A;  1PYT B;  2PJC A;  5ELY A;  2ZED A;  5K8O A;  2J9A A;  4UEF A;  3PB8 X;  4PXE A;  1F57 A;  4TNU A;  3MRU A;  1VGY A;  4OC5 A;  1CG2 A;  5I4M A;  3IO1 A;  3KGQ A;  3PEI A;  3GLJ A;  4LQG A;  1NSA A;  5D8N A;  1CP7 A;  2CF4 A;  2WYR A;  4F8Z A;  2CTC A;  1BAV A;  3ISZ A;  4DUK A;  2HC9 A;  4OC4 A;  2CIJ A;  4ZI6 A;  3H8G A;  1AYE A;  4UF4 A;  4MCR A;  4PPZ A;  4FWU A;  1VIX A;  2PJ4 A;  3D66 A;  3FEE A;  1HDQ A;  4FAI A;  1TXR A;  2V8D A;  2PJ8 A;  2ZEN A;  2QVP A;  4BD9 A;  4OC3 A;  1ARM A;  3IEH A;  5HVG A;  2RFH A;  5K8N A;  1LOK A;  3SJG A;  3N5F A;  1BPM A;  4F9V A;  2BO9 A;  2GLJ A;  4PXD A;  2PJ3 A;  2AFZ A;  4F9U A;  1QMU A;  3H8F A;  4K3N A;  5LYF A;  2PE3 A;  1HEE A;  3D7H A;  1YME A;  2ZEH A;  3B3T A;  4MRI A;  2AFM A;  3D4U A;  4ZY1 A;  2O4H A;  3V38 A;  2AFO A;  1TKJ A;  4R76 A;  5LRG A;  1YSJ A;  3SI2 A;  2V77 A;  3H8E A;  4UEZ A;  2AFX A;  3NFZ A;  4P4D A;  5CPA A;  2HB6 A;  4NGN A;  1CPX A;  3PB7 X;  1R3N A;  4JZ0 A;  4MHY A;  5JGF A;  3D68 A;  3RZA A;  1R43 A;  3SJE A;  1TF8 A;  4TWE A;  1XBU A;  4DYO A;  3B7I A;  4KSI A;  4ONW A;  4NFR A;  2AFU A;  2QJ8 A;  4FBE A;  7CPA A;  1CPS A;  1GYT A;  1Z5R A;  1F2P A;  3WT4 A;  4MCQ A;  1YW6 A;  2JBJ A;  2ZOG A;  3KL9 A;  4ZX9 A;  1IY7 A;  3L2N A;  1XJO A;  1ZG7 A;  3KQX A;  4MHP A;  2IMO A;  3CT9 A;  1M4L A;  4G1P A;  4ZX8 A;  1ZG8 A;  2EK9 A;  5DS0 A;  3B3V A;  2VL1 A;  2OOT A;  2XEJ A;  1EE3 P;  1Z2L A;  3JRU A;  1DTD A;  3K2K A;  4OIW A;  3S9M A;  1HDU A;  1XRY A;  3CDX A;  2CTB A;  5HXD A;  1AMP A;  2WZN A;  3KAS A;  2PJ7 A;  1QQ9 A;  4RUH A;  1H8L A;  4MHZ A;  2C6G A;  3PFE A;  3CPX A;  2BCO A;  3FEC A;  3VAR A;  4NGP A;  3SJF A;  2PJA A;  2PJ1 A;  4R7M A;  2XEF A;  4NGQ A;  3D67 A;  3FJU A;  3VAT A;  4FUU A;  3B3W A;  3WAB A;  4PXB A;  8CPA A;  1Y0Y A;  2I3C A;  1ZLH A;  1ZG9 A;  6CPA A;  2PVV A;  4O23 A;  3KZW A;  1LCP A;  2ZOF A;  4MCP A;  4R6T A;  1Z8L A;  1LFW A;  2PIZ A;  4P44 A;  1YLO A;  2DEA A;  4YWY A;  4MHN A;  3CPA A;  3NH4 A;  3SI0 A;  3IIB A;  3PB6 X;  5LRJ A;  2F8H A;  4JYW A;  2ANP A;  2ZEG A;  3IFE A;  4EWT A;  4MMO A;  1ELL P;  3GB0 A;  2Q51 A;  1RTQ A;  3FMC A;  2GU2 A;  2RB7 A;  3RAM A;  3WC5 A;  1IGB A;  2G9D A;  2QYV A;  4IAV A;  4NGS A;  4WJB A;  2PCU A;  1CP6 A;  5IB9 A;  4OC2 A;  3DLJ A;  3T8W A;  3V7Z A;  2FVG A;  3I1U A;  3PBE A;  2ZEM A;  3KI9 A;  1FNO A;  4OKO A;  1Y0R A;  3NH5 A;  4ZYQ A;  4EFD A;  4UIB A;  2PJ6 A;  2XEI A;  3B2Y A;  3PRT A;  2AFW A;  1BLL E;  1TKH A;  2PRQ A;  2XEG A;  3KR5 A;  2V8H A;  1TKF A;  4H2K A;  4Q7A A;  1CX8 A;  3FF3 A;  3KR4 A;  2NYQ A;  4PXC A;  5HVH A;  4IHM A;  1LAP A;  3BI0 A;  5D29 A;  4CPA A;  3FED A;  5F09 A;  3ISX A;  5LYI A;  4UEE A;  2IQ6 A;  2BOA A;  3D7G A;  5JM6 A;  3S9N A;  1LAM A;  4OME A;  3B3C A;  5HVF A;  3PFO A;  1VHO A;  4MXU A;  4P10 A;  1XMB A;  2F7V A;  4OP4 A;  4P4F A;  2GRE A;  3GUX A;  3FX6 A;  3KHZ A;  3BHX A;  4P4B A;  4P4J A;  4NGT A;  4DJL A;  1TF9 A;  4NGR A;  1ARL A;  3RBU A;  5LRK A;  2POK A;  3IWW A;  4P4E A;  4UIA A;  3IC1 A;  2PJ5 A;  3TX8 A;  2Q43 A;  3D7D A;  2C1C A;  1UWY A;  5LYD A;  4X2T A;  3SJX A;  3VH9 A;  2PJ0 A;  4EME A;  1BPN A;  4R8F A;  2ZEE A;  1JQG A;  3LWU A;  1OBR A;  1PCA A;  1KWM A;  3S9L A;  1LAN A;  5LYL A;  2JEW A;  3PB4 X;  1Q7L A;  4W9Y A;  5THW A;  4P45 A;  4NJQ A;  3NH8 A;  5JH9 A;  4A37 A;  5J1Q A;  2V8G A;  5K8P A;  4IK2 A; 
#chains in the Genus database with same CATH topology
 1S7L A;  4UA3 A;  1KZF A;  4A94 A;  1K4J A;  4WWV A;  2NSM A;  1V0C A;  2AFS A;  2GLF A;  2PJ9 A;  2VBQ A;  2JBK A;  2BUE A;  2C6P A;  2FXF A;  2O53 A;  4MJ8 A;  5CBM A;  4QUS A;  2ZW4 A;  1DE4 C;  3B35 A;  3K9T A;  4KSA A;  2QEC A;  4AG9 A;  3BJ8 A;  2WPW A;  3WC6 A;  3ZZI A;  3QNV A;  4GM5 A;  5HH1 A;  2ZEF A;  4CGN A;  2C6C A;  3PP9 A;  4NJR A;  1IID A;  2PJB A;  1Q2C A;  3DGV A;  1XFO A;  3I3G A;  4P4I A;  3B3S A;  1CJW A;  3RYO A;  5F49 A;  2EK8 A;  3D2M A;  2FE7 A;  1Z9U A;  4MY3 A;  1A2Z A;  1Y9K A;  2B5G A;  4E2A A;  1VHE A;  2I79 A;  4OAE A;  3F0A A;  4ORF A;  4UFX A;  2R1I A;  4J3G A;  3PBB A;  4IF5 A;  2PR1 A;  2VEZ A;  4OID A;  4XPD C;  3P2H A;  5IX3 A;  4P6Y A;  1Y7R A;  2Z0Z A;  4CS0 B;  2PVW A;  3G8W A;  5K8M A;  1YW4 A;  1CBX A;  3DR8 A;  1L0C A;  3IU1 A;  1S7N A;  1ZLI A;  4U9Y A;  4Z65 A;  2ZEO A;  2ABZ A;  3SI1 A;  4AXV A;  4BBH A;  3D7F A;  1F2O A;  3FBU A;  2CNM A;  1BO4 A;  2FSR A;  4Y49 B;  3KHX A;  3TC8 A;  3PB9 X;  4B6Z A;  2PJ2 A;  3D3S A;  4B11 A;  3HLP A;  4A39 A;  3NA6 A;  3UY5 A;  2OZG A;  2PIY A;  2ZEP A;  4R3L A;  4X8I A;  4CAX A;  4KS9 A;  3FIX A;  3IJ3 A;  2FCK A;  2OR4 A;  3FXT A;  4NGM A;  4ZY2 A;  4H6U A;  4I49 A;  3WC7 A;  4ZY0 A;  2JDC A;  4OC1 A;  2Q4Y A;  1FT7 A;  3BLN A;  3R9E A;  2HV2 A;  4A38 A;  1S3Z A;  1Y7E A;  3BXM A;  1Z4R A;  4X3R A;  4YU9 A;  3HUV A;  4KOU A;  4UWI A;  2ZEL A;  2EWB A;  3MN8 A;  4R87 A;  1XEB A;  3KQZ A;  4OC0 A;  4PQA A;  1NMT A;  3LMS A;  2V8V A;  3DSB A;  2B58 A;  4FD6 A;  4MFZ A;  4X5K A;  4CGM A;  2NMT A;  2B3U A;  2IJZ A;  2REF A;  1Y9W A;  3C26 A;  4JXR A;  4UFW A;  2R98 A;  3FVL A;  1S5K A;  2KCW A;  4JLY A;  4MCS A;  4RN7 A;  4PK3 A;  5EMI A;  2DXQ A;  1ELM P;  3DNS A;  4KZT A;  2Q4Z A;  2Z11 A;  3FH4 A;  4B12 A;  3BI1 A;  2YND A;  5CNP A;  1PYT B;  3V8I A;  3VWD A;  2PJC A;  1XOV A;  5ELY A;  2ZED A;  4IUS A;  4AVB A;  4BMH A;  1XMT A;  5K8O A;  2J9A A;  1QST A;  4NXY A;  4UEF A;  1S60 A;  3PB8 X;  5A28 A;  4PXE A;  1F57 A;  3W6X A;  4F0X A;  4EVY A;  4R57 A;  2REE A;  4TNU A;  3MRU A;  1QSO A;  2AE6 A;  4QB9 A;  2EBJ A;  4L8A A;  1M1D A;  1VGY A;  4YRH A;  5FVJ A;  1CG2 A;  4OC5 A;  5I4M A;  3IO1 A;  3KGQ A;  3PEI A;  3GLJ A;  4LQG A;  4RI1 A;  1FY7 A;  4KOV A;  2K5T A;  3S6K A;  1NSA A;  1NE9 A;  5D8N A;  3CXS A;  4KLW A;  1CP7 A;  2CF4 A;  3CXP A;  2WYR A;  3KKW A;  1IYK A;  3W91 A;  4A31 A;  4CYN A;  4C7H A;  1Z4E A;  4F8Z A;  3T90 A;  5JQ4 A;  4UBR A;  3LOD A;  2CTC A;  3SHP A;  1Z8W A;  2BL1 A;  1BAV A;  2OH1 A;  3ISZ A;  4DUK A;  1PUA A;  2HC9 A;  5F47 A;  4OC4 A;  2CIJ A;  1XE4 A;  4ZI6 A;  5EC4 A;  4II9 A;  3H8G A;  4KOW A;  2Q44 A;  1PU9 A;  4CYO A;  4KLV A;  4MY0 A;  1AYE A;  1XIX A;  4UF4 A;  4MCR A;  4PPZ A;  2G3A A;  4FWU A;  1VIX A;  2PJ4 A;  2R8V A;  3D66 A;  3FEE A;  5IB0 A;  1HDQ A;  2OZH A;  4FAI A;  1TXR A;  1WWZ A;  2Q7B A;  2V8D A;  2PJ8 A;  3IU2 A;  3IGR A;  2ZEN A;  2QVP A;  4BD9 A;  4OC3 A;  1ARM A;  1BOB A;  4KSF A;  4M6H A;  5AG7 A;  4AB7 A;  4C2Z A;  2CNT A;  2DPT A;  3IEH A;  5HVG A;  1MJ9 A;  2RFH A;  5K8N A;  1LOK A;  3SJG A;  3N5F A;  2DPS A;  1BPM A;  4F9V A;  2BO9 A;  3S6F A;  2GLJ A;  4PXD A;  4HNY B;  1IOI A;  3S6H A;  1Q2D A;  2PJ3 A;  3TO7 A;  1M4D A;  2AFZ A;  3K9U A;  4F9U A;  5G20 A;  1QMU A;  1IYL A;  2IL4 A;  3H8F A;  2OU2 A;  2AJ6 A;  2FL4 A;  4K3N A;  4DNC A;  5LYF A;  2PE3 A;  4ZGY B;  1HEE A;  1IIC A;  1YME A;  3D7H A;  2ZEH A;  3B3T A;  4MRI A;  3TT2 A;  3NE8 A;  4KOS A;  2R7H A;  4CGL A;  5G1Z A;  2AFM A;  4UCN A;  3R9G A;  4NEX A;  3D4U A;  4CAF A;  4ZY1 A;  2Y0M A;  4KUB A;  2O4H A;  3V38 A;  2AFO A;  1KUY A;  1TKJ A;  4R76 A;  4A33 A;  5LRG A;  1I1D A;  2HUZ A;  4JD6 A;  1YSJ A;  3SI2 A;  4MFK A;  4MFL A;  2V77 A;  3A9L A;  2Q7S A;  3H8E A;  4UEZ A;  4UCP A;  2AFX A;  4L89 A;  3GIU A;  3LAC A;  1Z8X A;  3NFZ A;  2QML A;  4P4D A;  5CPA A;  4QVT A;  2HB6 A;  4NGN A;  1CPX A;  3EO4 A;  3PB7 X;  2QIR A;  1R3N A;  4JZ0 A;  1IB1 E;  4MHY A;  5JGF A;  3D68 A;  5JPH A;  2ZW5 A;  3RZA A;  5E96 A;  1R43 A;  1SQH A;  3SJE A;  1YRE A;  2VQY A;  4FD4 A;  3MGD A;  1M4I A;  2J8R A;  1Z8T A;  1TF8 A;  4UWJ A;  4LUA A;  4TWE A;  1XBU A;  4DYO A;  4A30 A;  3B7I A;  4KSI A;  3B8G A;  2CY2 A;  2AFU A;  4NFR A;  4ONW A;  4YFJ A;  2QJ8 A;  4C2Y A;  2YNC A;  4FBE A;  2PDO A;  1VKC A;  7CPA A;  4ZBG A;  5AG6 A;  4C7I A;  4OLL A;  1CPS A;  1GYT A;  2G0B A;  1Z5R A;  1F2P A;  3G3S A;  4C2X A;  1TIQ A;  4MCQ A;  1YW6 A;  3WT4 A;  4F0Y A;  4U5Y A;  2RC4 A;  3JTK A;  3EY5 A;  2JBJ A;  2ZOG A;  3KL9 A;  4ZX9 A;  4H89 A;  1IY7 A;  2ARH A;  1XF8 A;  3L2N A;  1CM0 A;  5AG4 A;  1XJO A;  4AVA A;  2Q4V A;  3RO0 A;  5C88 A;  1ZG7 A;  3TCV A;  2Q0Y A;  3KQX A;  4MHP A;  2IMO A;  3R1K A;  3CT9 A;  1M4L A;  4G1P A;  4ZX8 A;  1ZG8 A;  2EK9 A;  4A2Z A;  1KUX A;  2YNC C;  5DS0 A;  3TFY A;  3EXN A;  3B3V A;  2PR8 A;  4MHD A;  2VL1 A;  4UCM A;  2XEJ A;  2OOT A;  3CZX A;  1EE3 P;  2JEV A;  1Z2L A;  2ZPA A;  3JUW A;  2CNS A;  4MFP A;  3JRU A;  1P4N A;  5G22 A;  2GFQ A;  2FT0 A;  4LQ6 A;  4R3K A;  1DTD A;  2Z3O A;  3K2K A;  3I9S A;  4OIW A;  2ODF A;  3S9M A;  3FYN A;  2O28 A;  1WK4 A;  2Z3L A;  3R95 A;  1I21 A;  2OB0 A;  3PGP A;  1JWQ A;  2GIV A;  3TO6 A;  2A4N A;  1HDU A;  1RO5 A;  4A95 A;  2BSW A;  4XPL A;  1XRY A;  2Q04 A;  3CDX A;  4PSW A;  2PC1 A;  3PZJ A;  2FIW A;  4CGO A;  3H5Z A;  2EVN A;  2CTB A;  4KOX A;  1J4J A;  3N7Z A;  2ZW6 A;  5H84 A;  1AMP A;  2WZN A;  3KAS A;  5HXD A;  4CYP A;  5J8F A;  2PJ7 A;  1QQ9 A;  3R96 A;  1R57 A;  4RUH A;  1H8L A;  4Q38 A;  4MHZ A;  4E8O A;  2C6G A;  5A27 A;  4GXH A;  4LX9 A;  2BEI A;  3S6G A;  3PFE A;  3CPX A;  1B6B A;  1S7F A;  3SXN A;  2BCO A;  2D4O A;  2Z3M A;  4XNH C;  5AGE A;  3FEC A;  5AG5 A;  4NGP A;  3SJF A;  3EFA A;  3VAR A;  4BIN A;  4A32 A;  2PJA A;  2PJ1 A;  3F8K A;  4R7M A;  5DWN A;  3FNC A;  2Z3N A;  4CRZ B;  3TO9 A;  2XEF A;  4NGQ A;  3D67 A;  3FJU A;  4GS4 A;  4FUU A;  4Q36 A;  3VAT A;  3ZJ0 A;  2VI7 A;  4E0A A;  3B3W A;  3BJ7 A;  1X10 A;  4JXQ A;  4FD5 A;  4KUA A;  3SXO A;  3WAB A;  4PXB A;  1QSR A;  8CPA A;  1Y0Y A;  2I3C A;  4PSX A;  1ZLH A;  1ZG9 A;  2JLM A;  2EUI A;  6CPA A;  2PVV A;  4O23 A;  2FS5 A;  1YVK A;  3KZW A;  1LCP A;  1YGH A;  4NCZ A;  4Y49 C;  2I00 A;  2Z10 A;  2Z3P A;  4B5P B;  2ZOF A;  1Q2Y A;  3H4Q A;  2GAN A;  4MCP A;  1QSM A;  4R6T A;  1Z8L A;  2PQ8 A;  2YGW A;  4CAV A;  2B5G B;  1LFW A;  2C27 A;  2PIZ A;  2P0W A;  4P44 A;  4RS2 A;  1I12 A;  1YLO A;  2DEA A;  4PK2 A;  3DDD A;  1X12 A;  4XPD B;  1IU8 A;  4YWY A;  4MHN A;  3CPA A;  3NH4 A;  3SI0 A;  3IIB A;  2X7B A;  2YNE A;  3PB6 X;  1S7K A;  4OAD A;  5LRJ A;  4PV6 A;  1RXT A;  3T9Y A;  2F8H A;  4JYW A;  2ANP A;  2ZEG A;  3IFE A;  4EWT A;  3P2F A;  4MMO A;  1ELL P;  3D2P A;  1B87 A;  3IWE A;  3OWC A;  3CXQ A;  3GB0 A;  1VHS A;  3IWG A;  1YVO A;  2Q51 A;  1RTQ A;  3FMC A;  4QC6 A;  3TTH A;  2GU2 A;  1YQE A;  2RB7 A;  4KOR A;  4B5O A;  3RAM A;  3WC5 A;  1IGB A;  1IOF A;  2G9D A;  5F46 A;  4MFJ A;  2QYV A;  2GE3 A;  3NE7 A;  4H6Z A;  4IAV A;  2FIA A;  4NGS A;  4K30 A;  2VXK A;  4C68 A;  4QBJ A;  4WJB A;  5KTA A;  1YK3 A;  2PRB A;  2PCU A;  1CP6 A;  5IB9 A;  4OC2 A;  5J8C A;  3DLJ A;  1OZP A;  3T8W A;  3V7Z A;  2FVG A;  1MJB A;  2WPX A;  4M6I A;  3I1U A;  4ONU A;  3RNZ A;  3PBE A;  2ZEM A;  3KI9 A;  4HNW B;  3TOB A;  2HQY A;  1NSL A;  1FNO A;  4OKO A;  1Y0R A;  4CAE A;  3NH5 A;  4M6G A;  3E0K A;  5F48 A;  4ZYQ A;  4EFD A;  4UIB A;  3W6S A;  2JDD A;  2PJ6 A;  2XEI A;  2D4P A;  4F6A A;  3B2Y A;  3EC4 A;  3PRT A;  4XPK A;  2AFW A;  2DF5 A;  2H5M A;  1BLL E;  1TKH A;  2PRQ A;  3F5B A;  3GY9 A;  4YGO A;  4AG7 A;  4CYQ A;  5C82 A;  2XEG A;  4HPS A;  2ZXV A;  4M3S A;  3KR5 A;  5I0C A;  5IV0 A;  2V8H A;  1TKF A;  2ATR A;  3QAH A;  4H2K A;  4KOY A;  4HNX B;  4Q7A A;  1CX8 A;  3FB3 A;  4UFV A;  5GCN A;  1M4G A;  3FF3 A;  3KR4 A;  2NYQ A;  4PXC A;  5HVH A;  1MK4 A;  4IHM A;  1M44 A;  1LAP A;  2J8M A;  3BI0 A;  4B5P A;  5D29 A;  4CPA A;  3FED A;  2B4B A;  3JVN A;  5F09 A;  3ISX A;  5LYI A;  4B14 A;  2B4D B;  4UEE A;  5ISV A;  4CGP A;  2B3V A;  1MJA A;  2IQ6 A;  4U9Z A;  2G3T A;  2BOA A;  4B10 A;  4B13 A;  4NSQ A;  3D7G A;  2P6F A;  4M85 A;  5JM6 A;  3S9N A;  1LAM A;  1GHE A;  4KVO E;  1U6M A;  4OME A;  3B3C A;  5HVF A;  4HKF A;  2PSW A;  5DWM A;  3PFO A;  1YX0 A;  1VHO A;  4MXU A;  4P10 A;  1XMB A;  2F7V A;  4AVC A;  4OP4 A;  4P4F A;  3WR7 A;  1ON0 A;  2GRE A;  1P0H A;  2F5I A;  3DR6 A;  3GUX A;  1ZO0 A;  3FX6 A;  3TOA A;  3LD2 A;  3KHZ A;  3BHX A;  4JJX A;  3QAY A;  1KUV A;  4P4B A;  1YR0 A;  4P4J A;  5HMN A;  1AUG A;  3QB8 A;  1QSN A;  4NGT A;  2CXA A;  1TF9 A;  4DJL A;  4NGR A;  1YLE A;  1ARL A;  4XNH B;  3RBU A;  2POK A;  3IWW A;  5LRK A;  3TE4 A;  4P4E A;  3VWE A;  2OZU A;  3FRM A;  4UIA A;  3IC1 A;  2PJ5 A;  1N71 A;  3TX8 A;  2Q43 A;  3D7D A;  5G21 A;  2C1C A;  4FD7 A;  5H86 A;  2EO8 A;  2J8N A;  2WUU A;  3D8P A;  1UWY A;  2B4D A;  2P6E A;  2VZZ A;  2Z3K A;  5LYD A;  4X2T A;  3GKR A;  3SJX A;  4CRY B;  3VH9 A;  4KOT A;  4CAW A;  5KTC A;  2PJ0 A;  4EME A;  1BPN A;  4R8F A;  2ZEE A;  1JQG A;  2WSA A;  3LWU A;  1OBR A;  1UFH A;  2ZW7 A;  3GYA A;  4KVM E;  2P6G A;  4MFQ A;  4MI4 A;  1PCA A;  1KWM A;  5KTD A;  2VZY A;  3S9L A;  1LAN A;  5LYL A;  2JEW A;  3PB4 X;  1Q7L A;  4NF1 A;  4W9Y A;  4KVX A;  4P45 A;  5THW A;  4NJQ A;  3R9F A;  3NH8 A;  4MBU A;  5EBV A;  5JH9 A;  1LRZ A;  4A37 A;  5BWA B;  4R9M A;  5J1Q A;  4JWP A;  2V8G A;  5K8P A;  4IK2 A; 
#chains in the Genus database with same CATH homology
 4A94 A;  4WWV A;  2NSM A;  2AFS A;  2GLF A;  2PJ9 A;  2JBK A;  2C6P A;  2O53 A;  5CBM A;  1DE4 C;  3B35 A;  3K9T A;  3WC6 A;  3QNV A;  4GM5 A;  2ZEF A;  2C6C A;  4NJR A;  2PJB A;  3DGV A;  1XFO A;  4P4I A;  3B3S A;  2EK8 A;  1VHE A;  3PBB A;  4OID A;  4P6Y A;  2PVW A;  5K8M A;  1YW4 A;  1CBX A;  1ZLI A;  4Z65 A;  2ZEO A;  2ABZ A;  3SI1 A;  4AXV A;  3D7F A;  1F2O A;  3TC8 A;  3KHX A;  3PB9 X;  4B6Z A;  2PJ2 A;  3HLP A;  4A39 A;  3NA6 A;  2PIY A;  2ZEP A;  4X8I A;  3IJ3 A;  2OR4 A;  3WC7 A;  4NGM A;  4ZY2 A;  4ZY0 A;  4OC1 A;  1FT7 A;  4A38 A;  1Y7E A;  3BXM A;  4X3R A;  4YU9 A;  3HUV A;  2ZEL A;  2EWB A;  3MN8 A;  3KQZ A;  4OC0 A;  4PQA A;  3LMS A;  2V8V A;  2IJZ A;  3FVL A;  4MCS A;  1ELM P;  2Q4Z A;  3FH4 A;  3BI1 A;  1PYT B;  2PJC A;  5ELY A;  2ZED A;  5K8O A;  2J9A A;  4UEF A;  3PB8 X;  4PXE A;  1F57 A;  4TNU A;  3MRU A;  1VGY A;  4OC5 A;  1CG2 A;  5I4M A;  3IO1 A;  3KGQ A;  3PEI A;  3GLJ A;  4LQG A;  1NSA A;  5D8N A;  1CP7 A;  2CF4 A;  2WYR A;  4F8Z A;  2CTC A;  1BAV A;  3ISZ A;  4DUK A;  2HC9 A;  4OC4 A;  2CIJ A;  4ZI6 A;  3H8G A;  1AYE A;  4UF4 A;  4MCR A;  4PPZ A;  4FWU A;  1VIX A;  2PJ4 A;  3D66 A;  3FEE A;  1HDQ A;  4FAI A;  1TXR A;  2V8D A;  2PJ8 A;  2ZEN A;  2QVP A;  4BD9 A;  4OC3 A;  1ARM A;  3IEH A;  5HVG A;  2RFH A;  5K8N A;  1LOK A;  3SJG A;  3N5F A;  1BPM A;  4F9V A;  2BO9 A;  2GLJ A;  4PXD A;  2PJ3 A;  2AFZ A;  4F9U A;  1QMU A;  3H8F A;  4K3N A;  5LYF A;  2PE3 A;  1HEE A;  3D7H A;  1YME A;  2ZEH A;  3B3T A;  4MRI A;  2AFM A;  3D4U A;  4ZY1 A;  2O4H A;  3V38 A;  2AFO A;  1TKJ A;  4R76 A;  5LRG A;  1YSJ A;  3SI2 A;  2V77 A;  3H8E A;  4UEZ A;  2AFX A;  3NFZ A;  4P4D A;  5CPA A;  2HB6 A;  4NGN A;  1CPX A;  3PB7 X;  1R3N A;  4JZ0 A;  4MHY A;  5JGF A;  3D68 A;  3RZA A;  1R43 A;  3SJE A;  1TF8 A;  4TWE A;  1XBU A;  4DYO A;  3B7I A;  4KSI A;  4ONW A;  4NFR A;  2AFU A;  2QJ8 A;  4FBE A;  7CPA A;  1CPS A;  1GYT A;  1Z5R A;  1F2P A;  3WT4 A;  4MCQ A;  1YW6 A;  2JBJ A;  2ZOG A;  3KL9 A;  4ZX9 A;  1IY7 A;  3L2N A;  1XJO A;  1ZG7 A;  3KQX A;  4MHP A;  2IMO A;  3CT9 A;  1M4L A;  4G1P A;  4ZX8 A;  1ZG8 A;  2EK9 A;  5DS0 A;  3B3V A;  2VL1 A;  2OOT A;  2XEJ A;  1EE3 P;  1Z2L A;  3JRU A;  1DTD A;  3K2K A;  4OIW A;  3S9M A;  1HDU A;  1XRY A;  3CDX A;  2CTB A;  5HXD A;  1AMP A;  2WZN A;  3KAS A;  2PJ7 A;  1QQ9 A;  4RUH A;  1H8L A;  4MHZ A;  2C6G A;  3PFE A;  3CPX A;  2BCO A;  3FEC A;  3VAR A;  4NGP A;  3SJF A;  2PJA A;  2PJ1 A;  4R7M A;  2XEF A;  4NGQ A;  3D67 A;  3FJU A;  3VAT A;  4FUU A;  3B3W A;  3WAB A;  4PXB A;  8CPA A;  1Y0Y A;  2I3C A;  1ZLH A;  1ZG9 A;  6CPA A;  2PVV A;  4O23 A;  3KZW A;  1LCP A;  2ZOF A;  4MCP A;  4R6T A;  1Z8L A;  1LFW A;  2PIZ A;  4P44 A;  1YLO A;  2DEA A;  4YWY A;  4MHN A;  3CPA A;  3NH4 A;  3SI0 A;  3IIB A;  3PB6 X;  5LRJ A;  2F8H A;  4JYW A;  2ANP A;  2ZEG A;  3IFE A;  4EWT A;  4MMO A;  1ELL P;  3GB0 A;  2Q51 A;  1RTQ A;  3FMC A;  2GU2 A;  2RB7 A;  3RAM A;  3WC5 A;  1IGB A;  2G9D A;  2QYV A;  4IAV A;  4NGS A;  4WJB A;  2PCU A;  1CP6 A;  5IB9 A;  4OC2 A;  3DLJ A;  3T8W A;  3V7Z A;  2FVG A;  3I1U A;  3PBE A;  2ZEM A;  3KI9 A;  1FNO A;  4OKO A;  1Y0R A;  3NH5 A;  4ZYQ A;  4EFD A;  4UIB A;  2PJ6 A;  2XEI A;  3B2Y A;  3PRT A;  2AFW A;  1BLL E;  1TKH A;  2PRQ A;  2XEG A;  3KR5 A;  2V8H A;  1TKF A;  4H2K A;  4Q7A A;  1CX8 A;  3FF3 A;  3KR4 A;  2NYQ A;  4PXC A;  5HVH A;  4IHM A;  1LAP A;  3BI0 A;  5D29 A;  4CPA A;  3FED A;  5F09 A;  3ISX A;  5LYI A;  4UEE A;  2IQ6 A;  2BOA A;  3D7G A;  5JM6 A;  3S9N A;  1LAM A;  4OME A;  3B3C A;  5HVF A;  3PFO A;  1VHO A;  4MXU A;  4P10 A;  1XMB A;  2F7V A;  4OP4 A;  4P4F A;  2GRE A;  3GUX A;  3FX6 A;  3KHZ A;  3BHX A;  4P4B A;  4P4J A;  4NGT A;  4DJL A;  1TF9 A;  4NGR A;  1ARL A;  3RBU A;  5LRK A;  2POK A;  3IWW A;  4P4E A;  4UIA A;  3IC1 A;  2PJ5 A;  3TX8 A;  2Q43 A;  3D7D A;  2C1C A;  1UWY A;  5LYD A;  4X2T A;  3SJX A;  3VH9 A;  2PJ0 A;  4EME A;  1BPN A;  4R8F A;  2ZEE A;  1JQG A;  3LWU A;  1OBR A;  1PCA A;  1KWM A;  3S9L A;  1LAN A;  5LYL A;  2JEW A;  3PB4 X;  1Q7L A;  4W9Y A;  5THW A;  4P45 A;  4NJQ A;  3NH8 A;  5JH9 A;  4A37 A;  5J1Q A;  2V8G A;  5K8P A;  4IK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...