1FT7A

Aap complexed with l-leucinephosphonic acid
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL LEUCYL AMINOPEPTIDASE
publication title Inhibition of the aminopeptidase from Aeromonas proteolytica by L-leucinephosphonic acid. Spectroscopic and crystallographic characterization of the transition state of peptide hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ft7A00
3D7GA 1Z8LA 2PJ9A 4P10A 4EWTA 2AFUA 4PXBA 2POKA 3KASA 1RTQA 4BD9A 1IGBA 4R7MA 2CTBA 4FAIA 4NJQA 5LRKA 4P4DA 2J9AA 4NGSA 2GU2A 3PB7X 1TKHA 1TXRA 2AFWA 1DE4C 2V8DA 4NGNA 3PBEA 4X2TA 4P45A 1R43A 1DTDA 3NA6A 3KI9A 1TKFA 2OOTA 4ZX8A 4KSIA 1FNOA 5K8MA 1CP6A 3NH4A 2AFOA 2QVPA 3FH4A 6CPAA 4R76A 1YLOA 3TX8A 1XFOA 4YWYA 3PBBA 4OC4A 3SI2A 3V38A 4MHPA 3NFZA 5J1QA 3RBUA 4PXEA 2ZELA 3VH9A 2HC9A 3FECA 4OIWA 4FWUA 4MCQA 4G1PA 4OC3A 4A37A 4O23A 2BOAA 2PJ0A 2O53A 3GUXA 2ZEFA 1LFWA 3HLPA 3CPXA 4MCRA 4A38A 4ZYQA 1ZG7A 1XBUA 2QYVA 1CPXA 2QJ8A 4ZY0A 4NFRA 2ZEPA 1OBRA 4JYWA 3S9MA 3D7HA 2Q51A 4F9UA 3KQXA 3MN8A 1NSAA 4FUUA 3KL9A 1F57A 4LQGA 3V7ZA 2XEJA 4ZX9A 2IMOA 3FMCA 3MRUA 2RFHA 4R8FA 2JEWA 3LMSA 3D67A 1LAPA 2PJ1A 1H8LA 3B2YA 4NGQA 4ONWA 4ZY2A 3NH8A 4P4IA 2CTCA 1Q7LA 4A94A 1VHEA 5LRJA 1PCAA 1Z5RA 1HDUA 2GREA 5CPAA 5ELYA 1F2OA 1BAVA 2XEGA 2PE3A 3SJFA 2ZEDA 2PRQA 1ELLP 1TKJA 3SJEA 4NGPA 4UIBA 2PJAA 3VATA 1Y0RA 4DYOA 4WWVA 2EWBA 2V8VA 2PVVA 1VGYA 4YU9A 2ZOFA 3KR5A 3GB0A 1R3NA 1VHOA 3H8FA 2WZNA 3DLJA 1XMBA 2CIJA 3FF3A 3KHZA 2IJZA 4K3NA 4P4FA 1LCPA 3B3VA 2PIZA 2G9DA 4UEEA 1ELMP 2NSMA 5D29A 5LYLA 2ZEHA 1LAMA 5JM6A 3KHXA 1ZLHA 3RZAA 3L2NA 3WT4A 2ABZA 3SJGA 3CPAA 4IK2A 3I1UA 4TNUA 3FVLA 1ARLA 2CF4A 3B3TA 2AFSA 3PB9X 3IEHA 2ZOGA 5HVGA 2NYQA 2EK9A 1AYEA 2O4HA 4PXCA 3IWWA 2AFXA 2XEFA 1CG2A 4B6ZA 4ZI6A 1HDQA 2HB6A 1ZLIA 1FT7A 2PIYA 2WYRA 3FEEA 1ZG8A 1TF8A 3D4UA 1YSJA 3SI0A 2V8HA 1CBXA 4PXDA 2C6CA 3B7IA 5HXDA 2F8HA 2F7VA 3WABA 3S9NA 2PJ7A 4OC5A 4UEFA 1CPSA 1GYTA 3HUVA 4EFDA 2JBKA 2V8GA 3KR4A 3GLJA 3IJ3A 3KQZA 4GM5A 4R6TA 4OC2A 4OC1A 3IO1A 4NJRA 2AFMA 4MCPA 1BPNA 4NGRA 1F2PA 2PVWA 3PB6X 4UIAA 4NGTA 4OC0A 1VIXA 3B3CA 5DS0A 2PJ5A 2PJ8A 4UF4A 2Q4ZA 1QQ9A 4X8IA 2GLFA 4A39A 3IIBA 8CPAA 2V77A 2C1CA 2DEAA 3D7DA 4ZY1A 3IC1A 3PEIA 1ARMA 3IFEA 3B35A 1Y7EA 1Z2LA 3D66A 5K8OA 2XEIA 4PPZA 1QMUA 1XRYA 4FBEA 1YW6A 4X3RA 4PQAA 4P4JA 1YW4A 5LYFA 1LOKA 3K9TA 1LANA 1PYTB 2PJ3A 3B3WA 4Z65A 1BLLE 2ZEOA 4MXUA 4H2KA 2C6GA 1CP7A 3FX6A 4JZ0A 5HVFA 4MCSA 5LYDA 4RUHA 3LWUA 2BCOA 2BO9A 2Q43A 4MHZA 1IY7A 4Q7AA 1KWMA 2PJ4A 4MRIA 5LRGA 2EK8A 4IHMA 4MMOA 1UWYA 2JBJA 3D7FA 5IB9A 3PFEA 1JQGA 5CBMA 4OP4A 3KZWA 5F09A 4P4EA 3PB4X 2ZENA 4MHNA 3ISZA 3H8GA 2AFZA 3PB8X 1M4LA 4NGMA 3BI1A 3CT9A 1XJOA 5JGFA 3B3SA 4MHYA 3SI1A 2IQ6A 3SJXA 3N5FA 5HVHA 3JRUA 3D68A 5THWA 4EMEA 3ISXA 1TF9A 3FEDA 3NH5A 4F8ZA 4W9YA 3TC8A 3KGQA 4TWEA 3PFOA 3K2KA 2C6PA 3FJUA 2ZEMA 3WC6A 4DUKA 2PJBA 2ZEGA 5K8NA 1AMPA 4OMEA 4AXVA 5D8NA 2PCUA 3H8EA 5K8PA 3WC5A 2OR4A 4UEZA 3T8WA 2PJ6A 4P6YA 1YMEA 4F9VA 4CPAA 2RB7A 3S9LA 4P4BA 3RAMA 4DJLA 3DGVA 1Y0YA 2PJCA 3BHXA 2PJ2A 4OIDA 2FVGA 1BPMA 4WJBA 5JH9A 2VL1A 3BXMA 2GLJA 3CDXA 1EE3P 1CX8A 2ZEEA 5LYIA 5I4MA 2ANPA 3QNVA 3PRTA 4P44A 3BI0A 4OKOA 2I3CA 3WC7A 7CPAA 4IAVA 1ZG9A 3VARA 1HEEA
chains in the Genus database with same CATH superfamily
5KTCA 4UWJA 2CNSA 4MFQA 3CXQA 2O28A 4BINA 2OZHA 2YNDA 3D7GA 4R3LA 1Z8LA 3TOAA 4MFLA 2PJ9A 2VBQA 4IF5A 4P10A 1QSMA 4EWTA 2AFUA 2PDOA 4PXBA 1KUXA 2POKA 1RXTA 2Q0YA 4AVCA 3KASA 2VZYA 3S6FA 1RTQA 3TTHA 1XE4A 4BD9A 1YK3A 1MJAA 4LX9A 1IGBA 3EFAA 4KOUA 3DR6A 3EY5A 2CTBA 3K9UA 4R7MA 4FAIA 4NJQA 5LRKA 4P4DA 4L89A 5JPHA 1KUYA 2J9AA 4NGSA 2GU2A 4CGPA 3PB7X 1TKHA 1TXRA 2EUIA 4GS4A 4B5PB 2AFWA 1DE4C 3N7ZA 2P6EA 2V8DA 4NGNA 3PBEA 3B8GA 4X2TA 4UCPA 1U6MA 4P45A 2BEIA 4PSXA 1YVKA 1J4JA 3TT2A 1R43A 1Z8WA 4A95A 1DTDA 1N71A 3NA6A 4C7HA 3R1KA 1VHSA 3KI9A 1TKFA 4JD6A 2OOTA 2B3VA 1M4IA 4ZX8A 4KSIA 1FNOA 2RC4A 4OADA 5K8MA 3F0AA 1CP6A 3NH4A 2AFOA 4U9YA 2QVPA 3FH4A 4CYQA 6CPAA 4UFXA 2P6GA 3DDDA 4R76A 3BJ8A 1Z9UA 2R7HA 3QAHA 4LQ6A 1Y7RA 1OZPA 1YLOA 3TX8A 1XFOA 4CGLA 3W91A 2G0BA 4CS0B 5C88A 5J8FA 1QSRA 4YWYA 3PBBA 4OC4A 4XPDB 4C7IA 1VKCA 4U5YA 3SI2A 3V38A 5F49A 4BBHA 4MHPA 3NFZA 5J1QA 2R1IA 3TO7A 1P0HA 1AUGA 4B11A 2FSRA 3RBUA 2EO8A 4PXEA 1UFHA 2OZUA 4KUAA 2ZELA 5DWNA 3VH9A 2HC9A 3FECA 4OIWA 4FWUA 3TE4A 1Y9KA 3TO9A 4MCQA 1XEBA 3ZZIA 4CAEA 2JEVA 4G1PA 4NCZA 4OC3A 4O23A 2BOAA 3S6HA 4A37A 3T9YA 4KVXA 3IU1A 5HMNA 1WWZA 2PJ0A 2B4DB 5JQ4A 2O53A 2NMTA 2DF5A 3GUXA 5FVJA 3V8IA 2ZEFA 1LFWA 2CY2A 3CPXA 2Q4VA 3HLPA 4FD5A 3FBUA 4LUAA 1ZG7A 4MCRA 4A38A 2Z11A 1XBUA 4ZYQA 4KLVA 4XPKA 2QECA 4CGMA 2FT0A 3D2PA 2QYVA 3EO4A 1M1DA 1QSNA 1CPXA 2QJ8A 4ZY0A 4H6UA 2JDDA 2Z0ZA 1XF8A 2Y0MA 4NFRA 2ZEPA 2J8RA 2QIRA 2JLMA 1OBRA 3GKRA 4JYWA 3S9MA 3TCVA 2AE6A 3D7HA 2Q51A 4F9UA 4MJ8A 3KQXA 3MN8A 1NSAA 4FUUA 3KL9A 3NE7A 4FD4A 1F57A 4LQGA 4ORFA 2XEJA 3V7ZA 4ZX9A 5KTDA 2IMOA 3GYAA 3FMCA 3MRUA 2RFHA 2GANA 5AG6A 4R8FA 2B5GA 2VEZA 2CNTA 1IOIA 4HNWB 2G3AA 3PP9A 5HH1A 1K4JA 2JEWA 3LMSA 4AVAA 3VWDA 4MI4A 4AG9A 1TIQA 3D67A 3CXSA 4F0XA 1LAPA 4KOWA 2ZW4A 2PJ1A 2Q7BA 1Y9WA 4HKFA 4GXHA 1H8LA 1JWQA 3B2YA 4NGQA 3G8WA 2FXFA 4ONWA 4ZY2A 1S7KA 2PR1A 3NH8A 1I1DA 3G3SA 1X10A 2BSWA 4P4IA 4KOVA 3TOBA 4B10A 4F6AA 2CTCA 4B13A 5AG4A 2Z3KA 4I49A 2R98A 1B87A 1Q7LA 4A94A 4A32A 4UA3A 1VHEA 2IL4A 5LRJA 1PCAA 5E96A 1Z5RA 1HDUA 2GREA 4ZGYB 4C2XA 4KUBA 5CPAA 2HV2A 1B6BA 5ELYA 1F2OA 1BAVA 2XEGA 2FIWA 4MY3A 3R9EA 5H84A 2PE3A 3SJFA 3BLNA 1WK4A 2ZEDA 2PRQA 1ELLP 1YQEA 1TKJA 3SJEA 2D4PA 1KZFA 4NGPA 4PK3A 2PJAA 4UIBA 1XIXA 3VATA 3GY9A 1Y0RA 2P0WA 4DYOA 4WWVA 4XNHB 4RS2A 4B5PA 2EWBA 2V8VA 2PVVA 1VGYA 4YU9A 3LODA 5F47A 2ZOFA 3KR5A 3GB0A 1R3NA 1I12A 1VHOA 2Z3LA 3H8FA 5AG5A 2WZNA 4UBRA 5DWMA 3DLJA 1XMBA 2OU2A 2CIJA 3JVNA 3FF3A 5EBVA 4B5OA 1ON0A 3KHZA 2ATRA 2IJZA 4K3NA 1S3ZA 4P4FA 2H5MA 4UCNA 3SXOA 1LCPA 3B3VA 4C2YA 1V0CA 1MJBA 2C27A 3D8PA 4HNXB 3EC4A 1ZO0A 1IYLA 3FB3A 2PIZA 2G9DA 4OAEA 1ELMP 2NSMA 4PSWA 4QUSA 4M6GA 4UCMA 4UEEA 5LYLA 2ZEHA 1LAMA 3P2FA 3KHXA 5AG7A 5JM6A 1NE9A 2J8NA 5G20A 2PRBA 3RYOA 1ZLHA 1CJWA 4MY0A 3RZAA 4RN7A 4JXRA 2PR8A 3L2NA 2D4OA 4R3KA 1MJ9A 2B58A 1R57A 2DPTA 4YFJA 3WT4A 2G3TA 2ABZA 3FYNA 3LD2A 4HNYB 5EC4A 3SJGA 1SQHA 3CPAA 2EBJA 4IK2A 4XPDC 3I1UA 2VI7A 1CM0A 4ZBGA 4TNUA 3DSBA 1YVOA 3DNSA 4JWPA 3FVLA 1IIDA 1ARLA 2CF4A 3B3TA 4R9MA 2AFSA 2ODFA 3PB9X 4DNCA 5IV0A 3IEHA 2ZOGA 5HVGA 2B4DA 4QBJA 4U9ZA 2NYQA 2EK9A 1BO4A 4ONUA 4CGNA 4KOYA 3VWEA 5CNPA 4EVYA 1AYEA 4UFVA 2O4HA 1RO5A 4PXCA 3I3GA 3F5BA 2Q04A 3IWWA 1BOBA 4B12A 2PQ8A 2AFXA 2XEFA 1CG2A 4KVME 4B6ZA 3FNCA 4ZI6A 1HDQA 4A2ZA 2HB6A 4AG7A 2WPWA 1ZLIA 1PUAA 1FT7A 2PC1A 2PIYA 2WYRA 3FEEA 1ZG8A 1TF8A 3D4UA 1YSJA 2I79A 3F8KA 2V8HA 3SI0A 1CBXA 4CAXA 4PXDA 5IX3A 2C6CA 3B7IA 5HXDA 2VQYA 2F8HA 2F7VA 2JDCA 4M85A 3QB8A 3WABA 3ZJ0A 3S9NA 3JTKA 2PJ7A 4OC5A 4UEFA 2X7BA 4Y49B 1CPSA 1GYTA 3HUVA 4EFDA 2JBKA 2OZGA 4AB7A 2V8GA 3KR4A 3GLJA 3IJ3A 4HPSA 3KQZA 2ARHA 3W6XA 3TO6A 2Z3PA 4KSAA 2DXQA 2FCKA 2REEA 2ZW6A 4GM5A 4R6TA 2YGWA 3FIXA 4OC2A 4OC1A 3IO1A 4KVOE 4NJRA 2AFMA 2J8MA 4J3GA 4MCPA 1A2ZA 1IYKA 1BPNA 4NGRA 5F46A 1F2PA 3D3SA 3P2HA 3CZXA 4CRZB 4L8AA 1YREA 1S7FA 3IU2A 4OLLA 4CYPA 2PVWA 3PB6X 4UIAA 4CGOA 5KTAA 4NGTA 2I00A 4OC0A 1VIXA 3E0KA 3B3CA 2GE3A 4R57A 2WUUA 3FXTA 5DS0A 5ISVA 4QB9A 2B5GB 2PJ5A 2PJ8A 4UF4A 2Q4ZA 1GHEA 3CXPA 1Z8XA 4KZTA 5G1ZA 4CYNA 1QQ9A 2WPXA 1NSLA 4X8IA 2GLFA 2P6FA 4CRYB 4NSQA 4A39A 3I9SA 3IIBA 3H5ZA 3S6GA 2BUEA 5A27A 8CPAA 2AJ6A 4A33A 2V77A 2C1CA 4KSFA 5H86A 5I0CA 1LRZA 2DEAA 3D7DA 2WSAA 4ZY1A 1I21A 3IC1A 2PSWA 3PEIA 1ARMA 3IFEA 4XPLA 2ZW7A 3B35A 1Y7EA 1Z2LA 3D66A 4XNHC 1Z8TA 5IB0A 5K8OA 2XEIA 4YRHA 3R9FA 4MFJA 4PPZA 5A28A 5G22A 1Q2CA 2HUZA 1QMUA 1XRYA 2ZPAA 2HQYA 3WR7A 2FIAA 3S6KA 3IGRA 2B4BA 3NE8A 4IUSA 3A9LA 4FBEA 1YW6A 1M4DA 1KUVA 4X3RA 3BJ7A 3DR8A 4QVTA 4PQAA 4X5KA 5C82A 4II9A 4MFKA 4P4JA 4BMHA 1S5KA 1YW4A 5J8CA 1LOKA 1LANA 1PYTB 2YNEA 3K9TA 4NEXA 2PJ3A 3B3WA 3QAYA 4FD7A 1S7LA 4CYOA 1BLLE 4Z65A 2YNCA 2ZEOA 4MXUA 4H2KA 4E2AA 2C6GA 1CP7A 3GIUA 3FX6A 2Q44A 4KOXA 4JZ0A 5HVFA 5GCNA 4MCSA 2GIVA 1Z4EA 1Z4RA 5LYDA 4MBUA 4RUHA 4AVBA 3FRMA 3LWUA 3R9GA 3TFYA 2BCOA 2BO9A 2Q43A 2Z3MA 3H4QA 4MHZA 2YNCC 4MHDA 4Q36A 1IY7A 2ZW5A 3EXNA 4Q7AA 1KWMA 2PJ4A 4MRIA 5LRGA 5BWAB 2GFQA 1IOFA 2EK8A 4IHMA 1XMTA 4MMOA 1Q2DA 5EMIA 1UWYA 1YR0A 4NF1A 1IB1E 2JBJA 3D7FA 2BL1A 5IB9A 2F5IA 3PFEA 1JQGA 1NMTA 3SXNA 4C2ZA 2K5TA 2Q7SA 3LACA 5CBMA 4OP4A 3KZWA 5F09A 2EVNA 3C26A 4P4EA 4R87A 2QMLA 3PB4X 3RO0A 1MK4A 2B3UA 2ZENA 4MHNA 4F0YA 3ISZA 4M3SA 3H8GA 3IWEA 1YGHA 2AFZA 1S60A 3PB8X 1M4LA 4NGMA 5G21A 1YLEA 2Z10A 3BI1A 3CT9A 1QSOA 1XJOA 3IWGA 5JGFA 4YGOA 4NXYA 3B3SA 4MHYA 3SI1A 1FY7A 2IQ6A 3W6SA 2FE7A 5LYFA 3SJXA 2VZZA 4M6IA 3N5FA 2FL4A 5HVHA 3JRUA 1M4GA 3D68A 4QC6A 1X12A 3PZJA 1M44A 4K30A 2Z3NA 5THWA 4EMEA 3ISXA 1TF9A 3FEDA 3NH5A 3PGPA 3JUWA 2R8VA 3T90A 4F8ZA 4CAVA 4Y49C 4JJXA 4C68A 4W9YA 4MFZA 4MFPA 3KGQA 3TC8A 1S7NA 4B14A 2OH1A 4TWEA 1L0CA 3PFOA 4H6ZA 3K2KA 3R95A 2C6PA 3FJUA 3R96A 2ZEMA 3WC6A 4DUKA 2CNMA 2PJBA 2ZEGA 2Z3OA 5K8NA 3VARA 1AMPA 2CXAA 4OMEA 1P4NA 4AXVA 5D8NA 1Q2YA 2PCUA 3D2MA 2ZXVA 4KORA 3SHPA 4CAWA 3H8EA 5K8PA 3WC5A 3OWCA 4KOTA 4RI1A 4JLYA 4PK2A 5F48A 3UY5A 1YX0A 1IU8A 2OR4A 3KKWA 4UEZA 3T8WA 2PJ6A 4E8OA 4A30A 2DPSA 4P6YA 4CAFA 1YMEA 2FS5A 2A4NA 2KCWA 4F9VA 4CPAA 2RB7A 3S9LA 4P4BA 3RAMA 4H89A 4DJLA 4JXQA 3DGVA 4UFWA 4E0AA 1Y0YA 2PJCA 2VXKA 3BHXA 2OB0A 2PJ2A 4OIDA 2FVGA 4FD6A 2REFA 1BPMA 4A31A 4WJBA 1QSTA 5JH9A 1IICA 2VL1A 3BXMA 4Q38A 4PV6A 2GLJA 3CDXA 2Q4YA 5D29A 1EE3P 1CX8A 5AGEA 4UWIA 2ZEEA 5LYIA 1PU9A 5I4MA 2ANPA 3MGDA 3QNVA 4KOSA 3PRTA 4M6HA 4P44A 3BI0A 3RNZA 4OKOA 2I3CA 4KS9A 1XOVA 3WC7A 7CPAA 4IAVA 1ZG9A 4KLWA 1HEEA
chains in the Genus database with same CATH topology
3D7GA 1Z8LA 2PJ9A 4P10A 4EWTA 2AFUA 4PXBA 2POKA 3KASA 1RTQA 4BD9A 1IGBA 4R7MA 2CTBA 4FAIA 4NJQA 5LRKA 4P4DA 2J9AA 4NGSA 2GU2A 3PB7X 1TKHA 1TXRA 2AFWA 1DE4C 2V8DA 4NGNA 3PBEA 4X2TA 4P45A 1R43A 1DTDA 3NA6A 3KI9A 1TKFA 2OOTA 4ZX8A 4KSIA 1FNOA 5K8MA 1CP6A 3NH4A 2AFOA 2QVPA 3FH4A 6CPAA 4R76A 1YLOA 3TX8A 1XFOA 4YWYA 3PBBA 4OC4A 3SI2A 3V38A 4MHPA 3NFZA 5J1QA 3RBUA 4PXEA 2ZELA 3VH9A 2HC9A 3FECA 4OIWA 4FWUA 4MCQA 4G1PA 4OC3A 4A37A 4O23A 2BOAA 2PJ0A 2O53A 3GUXA 2ZEFA 1LFWA 3HLPA 3CPXA 4MCRA 4A38A 4ZYQA 1ZG7A 1XBUA 2QYVA 1CPXA 2QJ8A 4ZY0A 4NFRA 2ZEPA 1OBRA 4JYWA 3S9MA 3D7HA 2Q51A 4F9UA 3KQXA 3MN8A 1NSAA 4FUUA 3KL9A 1F57A 4LQGA 3V7ZA 2XEJA 4ZX9A 2IMOA 3FMCA 3MRUA 2RFHA 4R8FA 2JEWA 3LMSA 3D67A 1LAPA 2PJ1A 1H8LA 3B2YA 4NGQA 4ONWA 4ZY2A 3NH8A 4P4IA 2CTCA 1Q7LA 4A94A 1VHEA 5LRJA 1PCAA 1Z5RA 1HDUA 2GREA 5CPAA 5ELYA 1F2OA 1BAVA 2XEGA 2PE3A 3SJFA 2ZEDA 2PRQA 1ELLP 1TKJA 3SJEA 4NGPA 4UIBA 2PJAA 3VATA 1Y0RA 4DYOA 4WWVA 2EWBA 2V8VA 2PVVA 1VGYA 4YU9A 2ZOFA 3KR5A 3GB0A 1R3NA 1VHOA 3H8FA 2WZNA 3DLJA 1XMBA 2CIJA 3FF3A 3KHZA 2IJZA 4K3NA 4P4FA 1LCPA 3B3VA 2PIZA 2G9DA 4UEEA 1ELMP 2NSMA 5D29A 5LYLA 2ZEHA 1LAMA 5JM6A 3KHXA 1ZLHA 3RZAA 3L2NA 3WT4A 2ABZA 3SJGA 3CPAA 4IK2A 3I1UA 4TNUA 3FVLA 1ARLA 2CF4A 3B3TA 2AFSA 3PB9X 3IEHA 2ZOGA 5HVGA 2NYQA 2EK9A 1AYEA 2O4HA 4PXCA 3IWWA 2AFXA 2XEFA 1CG2A 4B6ZA 4ZI6A 1HDQA 2HB6A 1ZLIA 1FT7A 2PIYA 2WYRA 3FEEA 1ZG8A 1TF8A 3D4UA 1YSJA 3SI0A 2V8HA 1CBXA 4PXDA 2C6CA 3B7IA 5HXDA 2F8HA 2F7VA 3WABA 3S9NA 2PJ7A 4OC5A 4UEFA 1CPSA 1GYTA 3HUVA 4EFDA 2JBKA 2V8GA 3KR4A 3GLJA 3IJ3A 3KQZA 4GM5A 4R6TA 4OC2A 4OC1A 3IO1A 4NJRA 2AFMA 4MCPA 1BPNA 4NGRA 1F2PA 2PVWA 3PB6X 4UIAA 4NGTA 4OC0A 1VIXA 3B3CA 5DS0A 2PJ5A 2PJ8A 4UF4A 2Q4ZA 1QQ9A 4X8IA 2GLFA 4A39A 3IIBA 8CPAA 2V77A 2C1CA 2DEAA 3D7DA 4ZY1A 3IC1A 3PEIA 1ARMA 3IFEA 3B35A 1Y7EA 1Z2LA 3D66A 5K8OA 2XEIA 4PPZA 1QMUA 1XRYA 4FBEA 1YW6A 4X3RA 4PQAA 4P4JA 1YW4A 5LYFA 1LOKA 3K9TA 1LANA 1PYTB 2PJ3A 3B3WA 4Z65A 1BLLE 2ZEOA 4MXUA 4H2KA 2C6GA 1CP7A 3FX6A 4JZ0A 5HVFA 4MCSA 5LYDA 4RUHA 3LWUA 2BCOA 2BO9A 2Q43A 4MHZA 1IY7A 4Q7AA 1KWMA 2PJ4A 4MRIA 5LRGA 2EK8A 4IHMA 4MMOA 1UWYA 2JBJA 3D7FA 5IB9A 3PFEA 1JQGA 5CBMA 4OP4A 3KZWA 5F09A 4P4EA 3PB4X 2ZENA 4MHNA 3ISZA 3H8GA 2AFZA 3PB8X 1M4LA 4NGMA 3BI1A 3CT9A 1XJOA 5JGFA 3B3SA 4MHYA 3SI1A 2IQ6A 3SJXA 3N5FA 5HVHA 3JRUA 3D68A 5THWA 4EMEA 3ISXA 1TF9A 3FEDA 3NH5A 4F8ZA 4W9YA 3TC8A 3KGQA 4TWEA 3PFOA 3K2KA 2C6PA 3FJUA 2ZEMA 3WC6A 4DUKA 2PJBA 2ZEGA 5K8NA 1AMPA 4OMEA 4AXVA 5D8NA 2PCUA 3H8EA 5K8PA 3WC5A 2OR4A 4UEZA 3T8WA 2PJ6A 4P6YA 1YMEA 4F9VA 4CPAA 2RB7A 3S9LA 4P4BA 3RAMA 4DJLA 3DGVA 1Y0YA 2PJCA 3BHXA 2PJ2A 4OIDA 2FVGA 1BPMA 4WJBA 5JH9A 2VL1A 3BXMA 2GLJA 3CDXA 1EE3P 1CX8A 2ZEEA 5LYIA 5I4MA 2ANPA 3QNVA 3PRTA 4P44A 3BI0A 4OKOA 2I3CA 3WC7A 7CPAA 4IAVA 1ZG9A 3VARA 1HEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7G A;  1Z8L A;  2PJ9 A;  4P10 A;  4EWT A;  2AFU A;  4PXB A;  2POK A;  3KAS A;  1RTQ A;  4BD9 A;  1IGB A;  4R7M A;  2CTB A;  4FAI A;  4NJQ A;  5LRK A;  4P4D A;  2J9A A;  4NGS A;  2GU2 A;  3PB7 X;  1TKH A;  1TXR A;  2AFW A;  1DE4 C;  2V8D A;  4NGN A;  3PBE A;  4X2T A;  4P45 A;  1R43 A;  1DTD A;  3NA6 A;  3KI9 A;  1TKF A;  2OOT A;  4ZX8 A;  4KSI A;  1FNO A;  5K8M A;  1CP6 A;  3NH4 A;  2AFO A;  2QVP A;  3FH4 A;  6CPA A;  4R76 A;  1YLO A;  3TX8 A;  1XFO A;  4YWY A;  3PBB A;  4OC4 A;  3SI2 A;  3V38 A;  4MHP A;  3NFZ A;  5J1Q A;  3RBU A;  4PXE A;  2ZEL A;  3VH9 A;  2HC9 A;  3FEC A;  4OIW A;  4FWU A;  4MCQ A;  4G1P A;  4OC3 A;  4A37 A;  4O23 A;  2BOA A;  2PJ0 A;  2O53 A;  3GUX A;  2ZEF A;  1LFW A;  3HLP A;  3CPX A;  4MCR A;  4A38 A;  4ZYQ A;  1ZG7 A;  1XBU A;  2QYV A;  1CPX A;  2QJ8 A;  4ZY0 A;  4NFR A;  2ZEP A;  1OBR A;  4JYW A;  3S9M A;  3D7H A;  2Q51 A;  4F9U A;  3KQX A;  3MN8 A;  1NSA A;  4FUU A;  3KL9 A;  1F57 A;  4LQG A;  3V7Z A;  2XEJ A;  4ZX9 A;  2IMO A;  3FMC A;  3MRU A;  2RFH A;  4R8F A;  2JEW A;  3LMS A;  3D67 A;  1LAP A;  2PJ1 A;  1H8L A;  3B2Y A;  4NGQ A;  4ONW A;  4ZY2 A;  3NH8 A;  4P4I A;  2CTC A;  1Q7L A;  4A94 A;  1VHE A;  5LRJ A;  1PCA A;  1Z5R A;  1HDU A;  2GRE A;  5CPA A;  5ELY A;  1F2O A;  1BAV A;  2XEG A;  2PE3 A;  3SJF A;  2ZED A;  2PRQ A;  1ELL P;  1TKJ A;  3SJE A;  4NGP A;  4UIB A;  2PJA A;  3VAT A;  1Y0R A;  4DYO A;  4WWV A;  2EWB A;  2V8V A;  2PVV A;  1VGY A;  4YU9 A;  2ZOF A;  3KR5 A;  3GB0 A;  1R3N A;  1VHO A;  3H8F A;  2WZN A;  3DLJ A;  1XMB A;  2CIJ A;  3FF3 A;  3KHZ A;  2IJZ A;  4K3N A;  4P4F A;  1LCP A;  3B3V A;  2PIZ A;  2G9D A;  4UEE A;  1ELM P;  2NSM A;  5D29 A;  5LYL A;  2ZEH A;  1LAM A;  5JM6 A;  3KHX A;  1ZLH A;  3RZA A;  3L2N A;  3WT4 A;  2ABZ A;  3SJG A;  3CPA A;  4IK2 A;  3I1U A;  4TNU A;  3FVL A;  1ARL A;  2CF4 A;  3B3T A;  2AFS A;  3PB9 X;  3IEH A;  2ZOG A;  5HVG A;  2NYQ A;  2EK9 A;  1AYE A;  2O4H A;  4PXC A;  3IWW A;  2AFX A;  2XEF A;  1CG2 A;  4B6Z A;  4ZI6 A;  1HDQ A;  2HB6 A;  1ZLI A;  1FT7 A;  2PIY A;  2WYR A;  3FEE A;  1ZG8 A;  1TF8 A;  3D4U A;  1YSJ A;  3SI0 A;  2V8H A;  1CBX A;  4PXD A;  2C6C A;  3B7I A;  5HXD A;  2F8H A;  2F7V A;  3WAB A;  3S9N A;  2PJ7 A;  4OC5 A;  4UEF A;  1CPS A;  1GYT A;  3HUV A;  4EFD A;  2JBK A;  2V8G A;  3KR4 A;  3GLJ A;  3IJ3 A;  3KQZ A;  4GM5 A;  4R6T A;  4OC2 A;  4OC1 A;  3IO1 A;  4NJR A;  2AFM A;  4MCP A;  1BPN A;  4NGR A;  1F2P A;  2PVW A;  3PB6 X;  4UIA A;  4NGT A;  4OC0 A;  1VIX A;  3B3C A;  5DS0 A;  2PJ5 A;  2PJ8 A;  4UF4 A;  2Q4Z A;  1QQ9 A;  4X8I A;  2GLF A;  4A39 A;  3IIB A;  8CPA A;  2V77 A;  2C1C A;  2DEA A;  3D7D A;  4ZY1 A;  3IC1 A;  3PEI A;  1ARM A;  3IFE A;  3B35 A;  1Y7E A;  1Z2L A;  3D66 A;  5K8O A;  2XEI A;  4PPZ A;  1QMU A;  1XRY A;  4FBE A;  1YW6 A;  4X3R A;  4PQA A;  4P4J A;  1YW4 A;  5LYF A;  1LOK A;  3K9T A;  1LAN A;  1PYT B;  2PJ3 A;  3B3W A;  4Z65 A;  1BLL E;  2ZEO A;  4MXU A;  4H2K A;  2C6G A;  1CP7 A;  3FX6 A;  4JZ0 A;  5HVF A;  4MCS A;  5LYD A;  4RUH A;  3LWU A;  2BCO A;  2BO9 A;  2Q43 A;  4MHZ A;  1IY7 A;  4Q7A A;  1KWM A;  2PJ4 A;  4MRI A;  5LRG A;  2EK8 A;  4IHM A;  4MMO A;  1UWY A;  2JBJ A;  3D7F A;  5IB9 A;  3PFE A;  1JQG A;  5CBM A;  4OP4 A;  3KZW A;  5F09 A;  4P4E A;  3PB4 X;  2ZEN A;  4MHN A;  3ISZ A;  3H8G A;  2AFZ A;  3PB8 X;  1M4L A;  4NGM A;  3BI1 A;  3CT9 A;  1XJO A;  5JGF A;  3B3S A;  4MHY A;  3SI1 A;  2IQ6 A;  3SJX A;  3N5F A;  5HVH A;  3JRU A;  3D68 A;  5THW A;  4EME A;  3ISX A;  1TF9 A;  3FED A;  3NH5 A;  4F8Z A;  4W9Y A;  3TC8 A;  3KGQ A;  4TWE A;  3PFO A;  3K2K A;  2C6P A;  3FJU A;  2ZEM A;  3WC6 A;  4DUK A;  2PJB A;  2ZEG A;  5K8N A;  1AMP A;  4OME A;  4AXV A;  5D8N A;  2PCU A;  3H8E A;  5K8P A;  3WC5 A;  2OR4 A;  4UEZ A;  3T8W A;  2PJ6 A;  4P6Y A;  1YME A;  4F9V A;  4CPA A;  2RB7 A;  3S9L A;  4P4B A;  3RAM A;  4DJL A;  3DGV A;  1Y0Y A;  2PJC A;  3BHX A;  2PJ2 A;  4OID A;  2FVG A;  1BPM A;  4WJB A;  5JH9 A;  2VL1 A;  3BXM A;  2GLJ A;  3CDX A;  1EE3 P;  1CX8 A;  2ZEE A;  5LYI A;  5I4M A;  2ANP A;  3QNV A;  3PRT A;  4P44 A;  3BI0 A;  4OKO A;  2I3C A;  3WC7 A;  7CPA A;  4IAV A;  1ZG9 A;  3VAR A;  1HEE A; 
#chains in the Genus database with same CATH topology
 5KTC A;  4UWJ A;  2CNS A;  4MFQ A;  3CXQ A;  2O28 A;  4BIN A;  2OZH A;  2YND A;  3D7G A;  4R3L A;  1Z8L A;  3TOA A;  4MFL A;  2PJ9 A;  2VBQ A;  4IF5 A;  4P10 A;  1QSM A;  4EWT A;  2AFU A;  2PDO A;  4PXB A;  1KUX A;  2POK A;  1RXT A;  2Q0Y A;  4AVC A;  3KAS A;  2VZY A;  3S6F A;  1RTQ A;  3TTH A;  1XE4 A;  4BD9 A;  1YK3 A;  1MJA A;  4LX9 A;  1IGB A;  3EFA A;  4KOU A;  3DR6 A;  3EY5 A;  2CTB A;  3K9U A;  4R7M A;  4FAI A;  4NJQ A;  5LRK A;  4P4D A;  4L89 A;  5JPH A;  1KUY A;  2J9A A;  4NGS A;  2GU2 A;  4CGP A;  3PB7 X;  1TKH A;  1TXR A;  2EUI A;  4GS4 A;  4B5P B;  2AFW A;  1DE4 C;  3N7Z A;  2P6E A;  2V8D A;  4NGN A;  3PBE A;  3B8G A;  4X2T A;  4UCP A;  1U6M A;  4P45 A;  2BEI A;  4PSX A;  1YVK A;  1J4J A;  3TT2 A;  1R43 A;  1Z8W A;  4A95 A;  1DTD A;  1N71 A;  3NA6 A;  4C7H A;  3R1K A;  1VHS A;  3KI9 A;  1TKF A;  4JD6 A;  2OOT A;  2B3V A;  1M4I A;  4ZX8 A;  4KSI A;  1FNO A;  2RC4 A;  4OAD A;  5K8M A;  3F0A A;  1CP6 A;  3NH4 A;  2AFO A;  4U9Y A;  2QVP A;  3FH4 A;  4CYQ A;  6CPA A;  4UFX A;  2P6G A;  3DDD A;  4R76 A;  3BJ8 A;  1Z9U A;  2R7H A;  3QAH A;  4LQ6 A;  1Y7R A;  1OZP A;  1YLO A;  3TX8 A;  1XFO A;  4CGL A;  3W91 A;  2G0B A;  4CS0 B;  5C88 A;  5J8F A;  1QSR A;  4YWY A;  3PBB A;  4OC4 A;  4XPD B;  4C7I A;  1VKC A;  4U5Y A;  3SI2 A;  3V38 A;  5F49 A;  4BBH A;  4MHP A;  3NFZ A;  5J1Q A;  2R1I A;  3TO7 A;  1P0H A;  1AUG A;  4B11 A;  2FSR A;  3RBU A;  2EO8 A;  4PXE A;  1UFH A;  2OZU A;  4KUA A;  2ZEL A;  5DWN A;  3VH9 A;  2HC9 A;  3FEC A;  4OIW A;  4FWU A;  3TE4 A;  1Y9K A;  3TO9 A;  4MCQ A;  1XEB A;  3ZZI A;  4CAE A;  2JEV A;  4G1P A;  4NCZ A;  4OC3 A;  4O23 A;  2BOA A;  3S6H A;  4A37 A;  3T9Y A;  4KVX A;  3IU1 A;  5HMN A;  1WWZ A;  2PJ0 A;  2B4D B;  5JQ4 A;  2O53 A;  2NMT A;  2DF5 A;  3GUX A;  5FVJ A;  3V8I A;  2ZEF A;  1LFW A;  2CY2 A;  3CPX A;  2Q4V A;  3HLP A;  4FD5 A;  3FBU A;  4LUA A;  1ZG7 A;  4MCR A;  4A38 A;  2Z11 A;  1XBU A;  4ZYQ A;  4KLV A;  4XPK A;  2QEC A;  4CGM A;  2FT0 A;  3D2P A;  2QYV A;  3EO4 A;  1M1D A;  1QSN A;  1CPX A;  2QJ8 A;  4ZY0 A;  4H6U A;  2JDD A;  2Z0Z A;  1XF8 A;  2Y0M A;  4NFR A;  2ZEP A;  2J8R A;  2QIR A;  2JLM A;  1OBR A;  3GKR A;  4JYW A;  3S9M A;  3TCV A;  2AE6 A;  3D7H A;  2Q51 A;  4F9U A;  4MJ8 A;  3KQX A;  3MN8 A;  1NSA A;  4FUU A;  3KL9 A;  3NE7 A;  4FD4 A;  1F57 A;  4LQG A;  4ORF A;  2XEJ A;  3V7Z A;  4ZX9 A;  5KTD A;  2IMO A;  3GYA A;  3FMC A;  3MRU A;  2RFH A;  2GAN A;  5AG6 A;  4R8F A;  2B5G A;  2VEZ A;  2CNT A;  1IOI A;  4HNW B;  2G3A A;  3PP9 A;  5HH1 A;  1K4J A;  2JEW A;  3LMS A;  4AVA A;  3VWD A;  4MI4 A;  4AG9 A;  1TIQ A;  3D67 A;  3CXS A;  4F0X A;  1LAP A;  4KOW A;  2ZW4 A;  2PJ1 A;  2Q7B A;  1Y9W A;  4HKF A;  4GXH A;  1H8L A;  1JWQ A;  3B2Y A;  4NGQ A;  3G8W A;  2FXF A;  4ONW A;  4ZY2 A;  1S7K A;  2PR1 A;  3NH8 A;  1I1D A;  3G3S A;  1X10 A;  2BSW A;  4P4I A;  4KOV A;  3TOB A;  4B10 A;  4F6A A;  2CTC A;  4B13 A;  5AG4 A;  2Z3K A;  4I49 A;  2R98 A;  1B87 A;  1Q7L A;  4A94 A;  4A32 A;  4UA3 A;  1VHE A;  2IL4 A;  5LRJ A;  1PCA A;  5E96 A;  1Z5R A;  1HDU A;  2GRE A;  4ZGY B;  4C2X A;  4KUB A;  5CPA A;  2HV2 A;  1B6B A;  5ELY A;  1F2O A;  1BAV A;  2XEG A;  2FIW A;  4MY3 A;  3R9E A;  5H84 A;  2PE3 A;  3SJF A;  3BLN A;  1WK4 A;  2ZED A;  2PRQ A;  1ELL P;  1YQE A;  1TKJ A;  3SJE A;  2D4P A;  1KZF A;  4NGP A;  4PK3 A;  2PJA A;  4UIB A;  1XIX A;  3VAT A;  3GY9 A;  1Y0R A;  2P0W A;  4DYO A;  4WWV A;  4XNH B;  4RS2 A;  4B5P A;  2EWB A;  2V8V A;  2PVV A;  1VGY A;  4YU9 A;  3LOD A;  5F47 A;  2ZOF A;  3KR5 A;  3GB0 A;  1R3N A;  1I12 A;  1VHO A;  2Z3L A;  3H8F A;  5AG5 A;  2WZN A;  4UBR A;  5DWM A;  3DLJ A;  1XMB A;  2OU2 A;  2CIJ A;  3JVN A;  3FF3 A;  5EBV A;  4B5O A;  1ON0 A;  3KHZ A;  2ATR A;  2IJZ A;  4K3N A;  1S3Z A;  4P4F A;  2H5M A;  4UCN A;  3SXO A;  1LCP A;  3B3V A;  4C2Y A;  1V0C A;  1MJB A;  2C27 A;  3D8P A;  4HNX B;  3EC4 A;  1ZO0 A;  1IYL A;  3FB3 A;  2PIZ A;  2G9D A;  4OAE A;  1ELM P;  2NSM A;  4PSW A;  4QUS A;  4M6G A;  4UCM A;  4UEE A;  5LYL A;  2ZEH A;  1LAM A;  3P2F A;  3KHX A;  5AG7 A;  5JM6 A;  1NE9 A;  2J8N A;  5G20 A;  2PRB A;  3RYO A;  1ZLH A;  1CJW A;  4MY0 A;  3RZA A;  4RN7 A;  4JXR A;  2PR8 A;  3L2N A;  2D4O A;  4R3K A;  1MJ9 A;  2B58 A;  1R57 A;  2DPT A;  4YFJ A;  3WT4 A;  2G3T A;  2ABZ A;  3FYN A;  3LD2 A;  4HNY B;  5EC4 A;  3SJG A;  1SQH A;  3CPA A;  2EBJ A;  4IK2 A;  4XPD C;  3I1U A;  2VI7 A;  1CM0 A;  4ZBG A;  4TNU A;  3DSB A;  1YVO A;  3DNS A;  4JWP A;  3FVL A;  1IID A;  1ARL A;  2CF4 A;  3B3T A;  4R9M A;  2AFS A;  2ODF A;  3PB9 X;  4DNC A;  5IV0 A;  3IEH A;  2ZOG A;  5HVG A;  2B4D A;  4QBJ A;  4U9Z A;  2NYQ A;  2EK9 A;  1BO4 A;  4ONU A;  4CGN A;  4KOY A;  3VWE A;  5CNP A;  4EVY A;  1AYE A;  4UFV A;  2O4H A;  1RO5 A;  4PXC A;  3I3G A;  3F5B A;  2Q04 A;  3IWW A;  1BOB A;  4B12 A;  2PQ8 A;  2AFX A;  2XEF A;  1CG2 A;  4KVM E;  4B6Z A;  3FNC A;  4ZI6 A;  1HDQ A;  4A2Z A;  2HB6 A;  4AG7 A;  2WPW A;  1ZLI A;  1PUA A;  1FT7 A;  2PC1 A;  2PIY A;  2WYR A;  3FEE A;  1ZG8 A;  1TF8 A;  3D4U A;  1YSJ A;  2I79 A;  3F8K A;  2V8H A;  3SI0 A;  1CBX A;  4CAX A;  4PXD A;  5IX3 A;  2C6C A;  3B7I A;  5HXD A;  2VQY A;  2F8H A;  2F7V A;  2JDC A;  4M85 A;  3QB8 A;  3WAB A;  3ZJ0 A;  3S9N A;  3JTK A;  2PJ7 A;  4OC5 A;  4UEF A;  2X7B A;  4Y49 B;  1CPS A;  1GYT A;  3HUV A;  4EFD A;  2JBK A;  2OZG A;  4AB7 A;  2V8G A;  3KR4 A;  3GLJ A;  3IJ3 A;  4HPS A;  3KQZ A;  2ARH A;  3W6X A;  3TO6 A;  2Z3P A;  4KSA A;  2DXQ A;  2FCK A;  2REE A;  2ZW6 A;  4GM5 A;  4R6T A;  2YGW A;  3FIX A;  4OC2 A;  4OC1 A;  3IO1 A;  4KVO E;  4NJR A;  2AFM A;  2J8M A;  4J3G A;  4MCP A;  1A2Z A;  1IYK A;  1BPN A;  4NGR A;  5F46 A;  1F2P A;  3D3S A;  3P2H A;  3CZX A;  4CRZ B;  4L8A A;  1YRE A;  1S7F A;  3IU2 A;  4OLL A;  4CYP A;  2PVW A;  3PB6 X;  4UIA A;  4CGO A;  5KTA A;  4NGT A;  2I00 A;  4OC0 A;  1VIX A;  3E0K A;  3B3C A;  2GE3 A;  4R57 A;  2WUU A;  3FXT A;  5DS0 A;  5ISV A;  4QB9 A;  2B5G B;  2PJ5 A;  2PJ8 A;  4UF4 A;  2Q4Z A;  1GHE A;  3CXP A;  1Z8X A;  4KZT A;  5G1Z A;  4CYN A;  1QQ9 A;  2WPX A;  1NSL A;  4X8I A;  2GLF A;  2P6F A;  4CRY B;  4NSQ A;  4A39 A;  3I9S A;  3IIB A;  3H5Z A;  3S6G A;  2BUE A;  5A27 A;  8CPA A;  2AJ6 A;  4A33 A;  2V77 A;  2C1C A;  4KSF A;  5H86 A;  5I0C A;  1LRZ A;  2DEA A;  3D7D A;  2WSA A;  4ZY1 A;  1I21 A;  3IC1 A;  2PSW A;  3PEI A;  1ARM A;  3IFE A;  4XPL A;  2ZW7 A;  3B35 A;  1Y7E A;  1Z2L A;  3D66 A;  4XNH C;  1Z8T A;  5IB0 A;  5K8O A;  2XEI A;  4YRH A;  3R9F A;  4MFJ A;  4PPZ A;  5A28 A;  5G22 A;  1Q2C A;  2HUZ A;  1QMU A;  1XRY A;  2ZPA A;  2HQY A;  3WR7 A;  2FIA A;  3S6K A;  3IGR A;  2B4B A;  3NE8 A;  4IUS A;  3A9L A;  4FBE A;  1YW6 A;  1M4D A;  1KUV A;  4X3R A;  3BJ7 A;  3DR8 A;  4QVT A;  4PQA A;  4X5K A;  5C82 A;  4II9 A;  4MFK A;  4P4J A;  4BMH A;  1S5K A;  1YW4 A;  5J8C A;  1LOK A;  1LAN A;  1PYT B;  2YNE A;  3K9T A;  4NEX A;  2PJ3 A;  3B3W A;  3QAY A;  4FD7 A;  1S7L A;  4CYO A;  1BLL E;  4Z65 A;  2YNC A;  2ZEO A;  4MXU A;  4H2K A;  4E2A A;  2C6G A;  1CP7 A;  3GIU A;  3FX6 A;  2Q44 A;  4KOX A;  4JZ0 A;  5HVF A;  5GCN A;  4MCS A;  2GIV A;  1Z4E A;  1Z4R A;  5LYD A;  4MBU A;  4RUH A;  4AVB A;  3FRM A;  3LWU A;  3R9G A;  3TFY A;  2BCO A;  2BO9 A;  2Q43 A;  2Z3M A;  3H4Q A;  4MHZ A;  2YNC C;  4MHD A;  4Q36 A;  1IY7 A;  2ZW5 A;  3EXN A;  4Q7A A;  1KWM A;  2PJ4 A;  4MRI A;  5LRG A;  5BWA B;  2GFQ A;  1IOF A;  2EK8 A;  4IHM A;  1XMT A;  4MMO A;  1Q2D A;  5EMI A;  1UWY A;  1YR0 A;  4NF1 A;  1IB1 E;  2JBJ A;  3D7F A;  2BL1 A;  5IB9 A;  2F5I A;  3PFE A;  1JQG A;  1NMT A;  3SXN A;  4C2Z A;  2K5T A;  2Q7S A;  3LAC A;  5CBM A;  4OP4 A;  3KZW A;  5F09 A;  2EVN A;  3C26 A;  4P4E A;  4R87 A;  2QML A;  3PB4 X;  3RO0 A;  1MK4 A;  2B3U A;  2ZEN A;  4MHN A;  4F0Y A;  3ISZ A;  4M3S A;  3H8G A;  3IWE A;  1YGH A;  2AFZ A;  1S60 A;  3PB8 X;  1M4L A;  4NGM A;  5G21 A;  1YLE A;  2Z10 A;  3BI1 A;  3CT9 A;  1QSO A;  1XJO A;  3IWG A;  5JGF A;  4YGO A;  4NXY A;  3B3S A;  4MHY A;  3SI1 A;  1FY7 A;  2IQ6 A;  3W6S A;  2FE7 A;  5LYF A;  3SJX A;  2VZZ A;  4M6I A;  3N5F A;  2FL4 A;  5HVH A;  3JRU A;  1M4G A;  3D68 A;  4QC6 A;  1X12 A;  3PZJ A;  1M44 A;  4K30 A;  2Z3N A;  5THW A;  4EME A;  3ISX A;  1TF9 A;  3FED A;  3NH5 A;  3PGP A;  3JUW A;  2R8V A;  3T90 A;  4F8Z A;  4CAV A;  4Y49 C;  4JJX A;  4C68 A;  4W9Y A;  4MFZ A;  4MFP A;  3KGQ A;  3TC8 A;  1S7N A;  4B14 A;  2OH1 A;  4TWE A;  1L0C A;  3PFO A;  4H6Z A;  3K2K A;  3R95 A;  2C6P A;  3FJU A;  3R96 A;  2ZEM A;  3WC6 A;  4DUK A;  2CNM A;  2PJB A;  2ZEG A;  2Z3O A;  5K8N A;  3VAR A;  1AMP A;  2CXA A;  4OME A;  1P4N A;  4AXV A;  5D8N A;  1Q2Y A;  2PCU A;  3D2M A;  2ZXV A;  4KOR A;  3SHP A;  4CAW A;  3H8E A;  5K8P A;  3WC5 A;  3OWC A;  4KOT A;  4RI1 A;  4JLY A;  4PK2 A;  5F48 A;  3UY5 A;  1YX0 A;  1IU8 A;  2OR4 A;  3KKW A;  4UEZ A;  3T8W A;  2PJ6 A;  4E8O A;  4A30 A;  2DPS A;  4P6Y A;  4CAF A;  1YME A;  2FS5 A;  2A4N A;  2KCW A;  4F9V A;  4CPA A;  2RB7 A;  3S9L A;  4P4B A;  3RAM A;  4H89 A;  4DJL A;  4JXQ A;  3DGV A;  4UFW A;  4E0A A;  1Y0Y A;  2PJC A;  2VXK A;  3BHX A;  2OB0 A;  2PJ2 A;  4OID A;  2FVG A;  4FD6 A;  2REF A;  1BPM A;  4A31 A;  4WJB A;  1QST A;  5JH9 A;  1IIC A;  2VL1 A;  3BXM A;  4Q38 A;  4PV6 A;  2GLJ A;  3CDX A;  2Q4Y A;  5D29 A;  1EE3 P;  1CX8 A;  5AGE A;  4UWI A;  2ZEE A;  5LYI A;  1PU9 A;  5I4M A;  2ANP A;  3MGD A;  3QNV A;  4KOS A;  3PRT A;  4M6H A;  4P44 A;  3BI0 A;  3RNZ A;  4OKO A;  2I3C A;  4KS9 A;  1XOV A;  3WC7 A;  7CPA A;  4IAV A;  1ZG9 A;  4KLW A;  1HEE A; 
#chains in the Genus database with same CATH homology
 3D7G A;  1Z8L A;  2PJ9 A;  4P10 A;  4EWT A;  2AFU A;  4PXB A;  2POK A;  3KAS A;  1RTQ A;  4BD9 A;  1IGB A;  4R7M A;  2CTB A;  4FAI A;  4NJQ A;  5LRK A;  4P4D A;  2J9A A;  4NGS A;  2GU2 A;  3PB7 X;  1TKH A;  1TXR A;  2AFW A;  1DE4 C;  2V8D A;  4NGN A;  3PBE A;  4X2T A;  4P45 A;  1R43 A;  1DTD A;  3NA6 A;  3KI9 A;  1TKF A;  2OOT A;  4ZX8 A;  4KSI A;  1FNO A;  5K8M A;  1CP6 A;  3NH4 A;  2AFO A;  2QVP A;  3FH4 A;  6CPA A;  4R76 A;  1YLO A;  3TX8 A;  1XFO A;  4YWY A;  3PBB A;  4OC4 A;  3SI2 A;  3V38 A;  4MHP A;  3NFZ A;  5J1Q A;  3RBU A;  4PXE A;  2ZEL A;  3VH9 A;  2HC9 A;  3FEC A;  4OIW A;  4FWU A;  4MCQ A;  4G1P A;  4OC3 A;  4A37 A;  4O23 A;  2BOA A;  2PJ0 A;  2O53 A;  3GUX A;  2ZEF A;  1LFW A;  3HLP A;  3CPX A;  4MCR A;  4A38 A;  4ZYQ A;  1ZG7 A;  1XBU A;  2QYV A;  1CPX A;  2QJ8 A;  4ZY0 A;  4NFR A;  2ZEP A;  1OBR A;  4JYW A;  3S9M A;  3D7H A;  2Q51 A;  4F9U A;  3KQX A;  3MN8 A;  1NSA A;  4FUU A;  3KL9 A;  1F57 A;  4LQG A;  3V7Z A;  2XEJ A;  4ZX9 A;  2IMO A;  3FMC A;  3MRU A;  2RFH A;  4R8F A;  2JEW A;  3LMS A;  3D67 A;  1LAP A;  2PJ1 A;  1H8L A;  3B2Y A;  4NGQ A;  4ONW A;  4ZY2 A;  3NH8 A;  4P4I A;  2CTC A;  1Q7L A;  4A94 A;  1VHE A;  5LRJ A;  1PCA A;  1Z5R A;  1HDU A;  2GRE A;  5CPA A;  5ELY A;  1F2O A;  1BAV A;  2XEG A;  2PE3 A;  3SJF A;  2ZED A;  2PRQ A;  1ELL P;  1TKJ A;  3SJE A;  4NGP A;  4UIB A;  2PJA A;  3VAT A;  1Y0R A;  4DYO A;  4WWV A;  2EWB A;  2V8V A;  2PVV A;  1VGY A;  4YU9 A;  2ZOF A;  3KR5 A;  3GB0 A;  1R3N A;  1VHO A;  3H8F A;  2WZN A;  3DLJ A;  1XMB A;  2CIJ A;  3FF3 A;  3KHZ A;  2IJZ A;  4K3N A;  4P4F A;  1LCP A;  3B3V A;  2PIZ A;  2G9D A;  4UEE A;  1ELM P;  2NSM A;  5D29 A;  5LYL A;  2ZEH A;  1LAM A;  5JM6 A;  3KHX A;  1ZLH A;  3RZA A;  3L2N A;  3WT4 A;  2ABZ A;  3SJG A;  3CPA A;  4IK2 A;  3I1U A;  4TNU A;  3FVL A;  1ARL A;  2CF4 A;  3B3T A;  2AFS A;  3PB9 X;  3IEH A;  2ZOG A;  5HVG A;  2NYQ A;  2EK9 A;  1AYE A;  2O4H A;  4PXC A;  3IWW A;  2AFX A;  2XEF A;  1CG2 A;  4B6Z A;  4ZI6 A;  1HDQ A;  2HB6 A;  1ZLI A;  1FT7 A;  2PIY A;  2WYR A;  3FEE A;  1ZG8 A;  1TF8 A;  3D4U A;  1YSJ A;  3SI0 A;  2V8H A;  1CBX A;  4PXD A;  2C6C A;  3B7I A;  5HXD A;  2F8H A;  2F7V A;  3WAB A;  3S9N A;  2PJ7 A;  4OC5 A;  4UEF A;  1CPS A;  1GYT A;  3HUV A;  4EFD A;  2JBK A;  2V8G A;  3KR4 A;  3GLJ A;  3IJ3 A;  3KQZ A;  4GM5 A;  4R6T A;  4OC2 A;  4OC1 A;  3IO1 A;  4NJR A;  2AFM A;  4MCP A;  1BPN A;  4NGR A;  1F2P A;  2PVW A;  3PB6 X;  4UIA A;  4NGT A;  4OC0 A;  1VIX A;  3B3C A;  5DS0 A;  2PJ5 A;  2PJ8 A;  4UF4 A;  2Q4Z A;  1QQ9 A;  4X8I A;  2GLF A;  4A39 A;  3IIB A;  8CPA A;  2V77 A;  2C1C A;  2DEA A;  3D7D A;  4ZY1 A;  3IC1 A;  3PEI A;  1ARM A;  3IFE A;  3B35 A;  1Y7E A;  1Z2L A;  3D66 A;  5K8O A;  2XEI A;  4PPZ A;  1QMU A;  1XRY A;  4FBE A;  1YW6 A;  4X3R A;  4PQA A;  4P4J A;  1YW4 A;  5LYF A;  1LOK A;  3K9T A;  1LAN A;  1PYT B;  2PJ3 A;  3B3W A;  4Z65 A;  1BLL E;  2ZEO A;  4MXU A;  4H2K A;  2C6G A;  1CP7 A;  3FX6 A;  4JZ0 A;  5HVF A;  4MCS A;  5LYD A;  4RUH A;  3LWU A;  2BCO A;  2BO9 A;  2Q43 A;  4MHZ A;  1IY7 A;  4Q7A A;  1KWM A;  2PJ4 A;  4MRI A;  5LRG A;  2EK8 A;  4IHM A;  4MMO A;  1UWY A;  2JBJ A;  3D7F A;  5IB9 A;  3PFE A;  1JQG A;  5CBM A;  4OP4 A;  3KZW A;  5F09 A;  4P4E A;  3PB4 X;  2ZEN A;  4MHN A;  3ISZ A;  3H8G A;  2AFZ A;  3PB8 X;  1M4L A;  4NGM A;  3BI1 A;  3CT9 A;  1XJO A;  5JGF A;  3B3S A;  4MHY A;  3SI1 A;  2IQ6 A;  3SJX A;  3N5F A;  5HVH A;  3JRU A;  3D68 A;  5THW A;  4EME A;  3ISX A;  1TF9 A;  3FED A;  3NH5 A;  4F8Z A;  4W9Y A;  3TC8 A;  3KGQ A;  4TWE A;  3PFO A;  3K2K A;  2C6P A;  3FJU A;  2ZEM A;  3WC6 A;  4DUK A;  2PJB A;  2ZEG A;  5K8N A;  1AMP A;  4OME A;  4AXV A;  5D8N A;  2PCU A;  3H8E A;  5K8P A;  3WC5 A;  2OR4 A;  4UEZ A;  3T8W A;  2PJ6 A;  4P6Y A;  1YME A;  4F9V A;  4CPA A;  2RB7 A;  3S9L A;  4P4B A;  3RAM A;  4DJL A;  3DGV A;  1Y0Y A;  2PJC A;  3BHX A;  2PJ2 A;  4OID A;  2FVG A;  1BPM A;  4WJB A;  5JH9 A;  2VL1 A;  3BXM A;  2GLJ A;  3CDX A;  1EE3 P;  1CX8 A;  2ZEE A;  5LYI A;  5I4M A;  2ANP A;  3QNV A;  3PRT A;  4P44 A;  3BI0 A;  4OKO A;  2I3C A;  3WC7 A;  7CPA A;  4IAV A;  1ZG9 A;  3VAR A;  1HEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...