1FT7A

Aap complexed with l-leucinephosphonic acid
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the aminopeptidase from Aeromonas proteolytica by L-leucinephosphonic acid. Spectroscopic and crystallographic characterization of the transition state of peptide hydrolysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BACTERIAL LEUCYL AMINOPEPTIDASE
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ft7A00
2PJ8A 4IHMA 4P4DA 2CTCA 1HDQA 2NYQA 3S9MA 2PCUA 2XEJA 3IWWA 3V38A 4UEFA 1YMEA 2BOAA 2HB6A 1TKJA 2Q43A 3SJGA 3PFOA 4MMOA 2F8HA 4MHYA 4NJQA 3KL9A 1HEEA 3H8EA 2V8VA 4NJRA 1LCPA 4PXCA 2V8DA 3KR4A 4WJBA 3D7HA 2PIYA 2Q4ZA 3KI9A 3FEDA 5K8PA 2V8GA 2AFUA 3VH9A 1HDUA 2CF4A 4P4FA 4GM5A 2PJCA 3GLJA 4PQAA 3D68A 4Q7AA 4X3RA 2C1CA 5LYDA 4FBEA 3FVLA 1RTQA 3BHXA 4ZYQA 5DS0A 1QMUA 3FX6A 1CPXA 2ZOGA 3WC7A 1IY7A 2ZOFA 2C6CA 3KHXA 4X2TA 1LAPA 1XJOA 3DGVA 4Z65A 1TKHA 4TWEA 1BAVA 2ZEMA 3HLPA 4UIAA 1CP6A 1TKFA 3PB4X 3WC5A 4R8FA 3TX8A 2IMOA 3N5FA 5D8NA 4EFDA 3MRUA 2EK9A 1DE4C 2O53A 3RBUA 3B3CA 3FECA 2ZEDA 3NFZA 5I4MA 3D7FA 3KGQA 2PE3A 2PJAA 4A39A 4IAVA 3LMSA 5CPAA 1CPSA 5D29A 1ZG7A 2V77A 3IIBA 4PXBA 3NA6A 1AMPA 4P44A 1KWMA 1YW4A 2ZELA 3IJ3A 2FVGA 2PJ5A 3CPXA 2ANPA 1NSAA 1ARLA 3FH4A 4NGRA 1H8LA 4O23A 4OC5A 3CT9A 3D66A 3KHZA 4FWUA 7CPAA 4ONWA 2I3CA 2QVPA 1Z8LA 5LYLA 1ZG8A 2ABZA 4PXEA 1Z2LA 1ELLP 4PPZA 1BPMA 3NH8A 4FUUA 4NFRA 4OC3A 3SI0A 4OP4A 3NH4A 1CP7A 1AYEA 4UF4A 2EWBA 1PCAA 2G9DA 4R76A 5J1QA 2GREA 4OC0A 2CTBA 2ZEEA 1XFOA 1FT7A 2OOTA 2VL1A 3K2KA 1Y0YA 3VARA 4A37A 2AFMA 1TF8A 4UEZA 2Q51A 5K8OA 3KQXA 3PB6X 4B6ZA 3CPAA 4K3NA 3B3WA 4P4JA 2C6GA 1QQ9A 1TF9A 1XMBA 2WYRA 8CPAA 1VHOA 4WWVA 1CBXA 3S9LA 1R3NA 4H2KA 3VATA 5K8NA 3DLJA 3PB9X 1BLLE 3FF3A 1FNOA 2RB7A 1ZLIA 4DJLA 2PJ2A 2PJBA 3KASA 1R43A 2ZEGA 2IJZA 3S9NA 4ZX8A 5HVGA 4NGMA 1Q7LA 3PB8X 1ARMA 4NGSA 4NGQA 1LFWA 1ZG9A 5HVHA 2DEAA 2PVWA 3SJXA 1OBRA 4R6TA 1JQGA 3K9TA 3IC1A 3PBBA 4RUHA 3KQZA 1YSJA 3SJFA 2POKA 4P45A 5CBMA 2WZNA 3KZWA 3B2YA 4OKOA 5ELYA 4MRIA 2ZEHA 5JM6A 2ZEFA 4PXDA 2IQ6A 3PRTA 2GLJA 3CDXA 4G1PA 4JYWA 4DUKA 3SJEA 4F8ZA 1XBUA 3JRUA 4F9VA 2PJ3A 5HVFA 1VGYA 3FJUA 5HXDA 3I1UA 2PJ1A 3B3SA 2XEIA 3WT4A 3KR5A 4R7MA 4UIBA 2GLFA 1XRYA 2JBKA 3D4UA 3B35A 1TXRA 3PEIA 3FEEA 1Z5RA 4MCRA 4ZY0A 2BO9A 2ZENA 4NGPA 4CPAA 2PJ7A 4A94A 2HC9A 4YU9A 5LRJA 2GU2A 2CIJA 4AXVA 3NH5A 2PIZA 3FMCA 4EMEA 2XEFA 1F57A 4NGNA 4P4BA 5LYIA 3MN8A 5LYFA 1CG2A 4P4IA 3SI1A 4OMEA 3V7ZA 4DYOA 1M4LA 1UWYA 2AFOA 1YLOA 1F2OA 6CPAA 3B7IA 3H8FA 2NSMA 1DTDA 1ELMP 2OR4A 4UEEA 3HUVA 1ZLHA 2PRQA 4F9UA 1LANA 4MCQA 3LWUA 2F7VA 4X8IA 1BPNA 2QYVA 2AFWA 2AFSA 5THWA 4ZI6A 4MHZA 2AFZA 1Y7EA 5IB9A 2ZEOA 3B3TA 3PB7X 1YW6A 1IGBA 1GYTA 2ZEPA 3IO1A 4NGTA 2PVVA 1LOKA 1VHEA 3TC8A 2AFXA 3BI1A 2JBJA 2V8HA 2PJ9A 3GUXA 4EWTA 1EE3P 1PYTB 4MCPA 1F2PA 4OIDA 4ZY1A 2O4HA 3D67A 3RAMA 4IK2A 4OIWA 3WC6A 3GB0A 4BD9A 5JGFA 2QJ8A 4ZY2A 3L2NA 3D7DA 3IEHA 3IFEA 4YWYA 3H8GA 4OC4A 2PJ4A 5K8MA 4KSIA 5LRGA 3RZAA 4MHNA 5F09A 4MCSA 2C6PA 4LQGA 3SI2A 4FAIA 3PFEA 4P4EA 3B3VA 4MHPA 3WABA 1VIXA 2JEWA 2PJ6A 5JH9A 1CX8A 4OC1A 2BCOA 4MXUA 4JZ0A 2J9AA 3BXMA 2PJ0A 4W9YA 4OC2A 4P6YA 4P10A 3ISZA 4ZX9A 3BI0A 4A38A 5LRKA 3T8WA 3D7GA 2XEGA 3PBEA 3ISXA 1Y0RA 1LAMA 2EK8A 2RFHA 3QNVA 4TNUA
chains in the Genus database with same CATH superfamily
2PJ8A 4IHMA 4P4DA 2CTCA 1N71A 3PZJA 4JD6A 1HDQA 3RNZA 2NYQA 3S9MA 4QBJA 2PCUA 2XEJA 3IWWA 3V38A 4UEFA 1YMEA 2BOAA 1J4JA 2HB6A 1P0HA 4F0XA 1TKJA 2YNEA 1NE9A 4H89A 4OAEA 1CJWA 4UBRA 4H6ZA 2Q43A 3NE8A 3PFOA 3SJGA 4MMOA 2F8HA 2J8MA 2B5GA 4MHYA 5F47A 4NJQA 1HEEA 3H8EA 3KL9A 2V8VA 4NJRA 1LCPA 4PXCA 4JWPA 2Q0YA 2V8DA 3KR4A 4RS2A 4WJBA 4A95A 3D7HA 2PIYA 2Q4ZA 4KVME 3EO4A 3KI9A 3RYOA 3GKRA 3FEDA 2YNCA 2V8GA 3SXOA 1I1DA 4BINA 5K8PA 1IOIA 2CXAA 2AFUA 3VH9A 1HDUA 1PUAA 1QSNA 3S6HA 3V8IA 2CF4A 5H86A 2REEA 4P4FA 5AGEA 4GM5A 2PJCA 3R9EA 4AVBA 3GLJA 2B4BA 4PQAA 3D68A 1IB1E 1M4IA 4Q7AA 3SXNA 4X3RA 2WUUA 2C1CA 4LQ6A 4YRHA 5LYDA 4MHDA 1SQHA 4FBEA 3H5ZA 4B5PB 3FVLA 1RTQA 1A2ZA 3BHXA 4ZYQA 1ON0A 4CAWA 5DS0A 2Z3LA 3UY5A 4H6UA 1QMUA 3FX6A 1CPXA 2ZOGA 3WC7A 1IY7A 2ZOFA 2ATRA 2C6CA 3KHXA 4KOTA 4X2TA 1LAPA 1XJOA 3DGVA 4PK3A 5C82A 4Z65A 3G8WA 1TKHA 4TWEA 2HV2A 1BAVA 1NMTA 2EUIA 1KZFA 1CP6A 2FS5A 2ZEMA 3GYAA 3HLPA 4NEXA 4UIAA 1JWQA 4UCPA 1KUVA 1TKFA 3D2PA 3PB4X 3R9GA 3TO7A 5JPHA 2FXFA 3P2FA 3WC5A 4R8FA 3TX8A 4ZGYB 5BWAB 2IMOA 3N5FA 4M3SA 2JDDA 5D8NA 4Q38A 1RXTA 3F8KA 3TT2A 1M4DA 4EFDA 3TCVA 4YGOA 3D3SA 4A30A 2GE3A 3MRUA 2IL4A 2R1IA 1VKCA 3DDDA 4PK2A 4PSXA 2EK9A 4OADA 4C2ZA 1DE4C 2O53A 4MFKA 1MJAA 4R9MA 3RBUA 1X12A 4IUSA 5F48A 3B3CA 3FECA 5IB0A 2ZEDA 3CZXA 3NFZA 2JEVA 2ZW6A 2DF5A 1ZO0A 4M6HA 1YVKA 2Q7SA 5I4MA 4A32A 3F0AA 3MGDA 3D7FA 1Y7RA 1B6BA 3KGQA 4OLLA 2B58A 1XF8A 4Q36A 4JJXA 2PE3A 2PJAA 5AG6A 4A39A 1Q2YA 4GS4A 3TO6A 4IAVA 1WWZA 5ISVA 4HNYB 4Y49C 4KVXA 4AG7A 3TFYA 3LMSA 4UFWA 2WPXA 5CPAA 4B14A 1CPSA 5D29A 4AVAA 2Z3MA 1BOBA 1ZG7A 1B87A 2V77A 3IIBA 4PXBA 2DXQA 1AMPA 3NA6A 2D4PA 4P44A 1Q2CA 3T9YA 3I3GA 2Y0MA 1Z4EA 3TOAA 4R3KA 1U6MA 2B4DB 1KWMA 1YW4A 4B13A 2ZELA 2HUZA 1VHSA 3IJ3A 2FVGA 5G22A 2PJ5A 3CPXA 4K30A 2ANPA 4XPDC 1NSAA 2FSRA 4FD7A 4A33A 1ARLA 4DNCA 4KLVA 3FH4A 4E8OA 5C88A 5CNPA 4NGRA 4LX9A 1H8LA 4O23A 4OC5A 3CT9A 3D66A 3KHZA 4FWUA 4R57A 3T90A 3WR7A 2B4DA 7CPAA 1TIQA 2ZPAA 4ONWA 3FXTA 2I3CA 2QVPA 1Z8LA 5LYLA 1ZG8A 3BJ7A 1MK4A 4E2AA 2ABZA 1S60A 2YNCC 4PXEA 4CS0B 3QAHA 3G3SA 5F49A 5GCNA 1Z2LA 1ELLP 1QSRA 4XPKA 5H84A 4PPZA 4MJ8A 1BPMA 4CAFA 3NH8A 2EO8A 4FUUA 3TOBA 2FT0A 4NFRA 3JUWA 4OC3A 2WSAA 4A31A 1Z9UA 5HMNA 3SI0A 3VWEA 1MJ9A 4OP4A 5F46A 2VXKA 2REFA 4RN7A 3S6FA 2CNMA 3NH4A 5DWNA 2CY2A 1S7LA 1CP7A 2J8RA 2VI7A 3R96A 1AYEA 4UF4A 2Q4YA 2BUEA 3D2MA 1M44A 4KOUA 4QC6A 1M1DA 4PSWA 2EWBA 1XIXA 2AJ6A 1PCAA 2G9DA 4R76A 5J1QA 2GREA 4OC0A 4C7HA 5J8FA 1Y9WA 2HQYA 2CTBA 2ZEEA 4MFZA 1XFOA 1FT7A 2OOTA 2VL1A 5G21A 1WK4A 3K2KA 4MI4A 1OZPA 5G20A 4RI1A 1Y0YA 3VARA 3KKWA 4A37A 4KVOE 2ZW5A 2AFMA 1TF8A 3S6KA 4UEZA 2Q51A 4E0AA 5K8OA 3JTKA 1YREA 3A9LA 3KQXA 3PB6X 2VQYA 2GIVA 3CPAA 4K3NA 3B3WA 4M6IA 1BO4A 2C6GA 4P4JA 5EMIA 4B6ZA 4CYOA 1QQ9A 3R1KA 2OZHA 3RO0A 2Q7BA 1Z8XA 1TF9A 1XMBA 2WYRA 4U9YA 1VHOA 8CPAA 4WWVA 1CBXA 1MJBA 4KS9A 3S9LA 1R3NA 4H2KA 3VATA 5K8NA 1IICA 3DLJA 1P4NA 4CGLA 3PB9X 1S7NA 1BLLE 3FF3A 4MFLA 2B3UA 1FNOA 2BEIA 2G3TA 2RB7A 2R7HA 1X10A 2Z10A 3FBUA 1ZLIA 1YVOA 2B3VA 2PJ2A 3TTHA 4DJLA 2FIWA 4FD6A 1QSMA 3E0KA 2PR8A 4MFQA 2PJBA 3KASA 1R43A 3P2HA 4HNWB 1V0CA 4ONUA 2ZEGA 4UCMA 4FD5A 1GHEA 2IJZA 3S9NA 4YFJA 4ZX8A 5HVGA 4NGMA 1Q7LA 3PB8X 1IU8A 1ARMA 4NGSA 4X5KA 1M4GA 2ZW7A 1LFWA 3DR8A 4NGQA 1ZG9A 5HVHA 2DEAA 2PVWA 3SJXA 1XE4A 2Z11A 1OBRA 2VZZA 3LACA 5AG7A 2PRBA 4R6TA 1JQGA 3K9TA 2G0BA 4KSAA 3B8GA 3IC1A 4CRZB 3PBBA 4RUHA 3KQZA 1YSJA 4U5YA 3SJFA 3D8PA 2POKA 3LD2A 4P45A 2OB0A 3FB3A 4C2XA 4KOYA 1R57A 2Z3OA 5CBMA 2WZNA 1XOVA 1Z8WA 4I49A 4CGPA 2FCKA 3QAYA 3KZWA 3B2YA 4OKOA 4UWIA 2J8NA 4CGMA 4XPDB 5ELYA 4ZY2A 4XPLA 4JXRA 2ZEHA 2YGWA 4MRIA 1IOFA 3IU1A 5JM6A 2ZEFA 4UWJA 4PXDA 2IQ6A 3PRTA 4MFPA 1UFHA 2Q04A 4AVCA 2I00A 2GLJA 3CDXA 2EVNA 3IGRA 4MY3A 4G1PA 4JYWA 1YLEA 4DUKA 5KTDA 2EBJA 3SJEA 3IU2A 4AB7A 4M85A 4F8ZA 1XBUA 2DPTA 2FL4A 3JRUA 1Q2DA 4F9VA 2PJ3A 5HVFA 5AG5A 3BJ8A 1VGYA 3W6SA 2FE7A 2X7BA 3ZJ0A 3FJUA 3FNCA 3PGPA 5HXDA 5EC4A 3I1UA 2D4OA 5G1ZA 2PJ1A 3B3SA 2XEIA 3WT4A 5KTCA 2OH1A 3KR5A 4R7MA 4UIBA 2GLFA 2WPWA 4XNHC 4LUAA 4CYNA 1XRYA 4KOVA 2P6GA 2R8VA 2JBKA 4EVYA 3D4UA 3B35A 4BBHA 1TXRA 3PEIA 2P6FA 1AUGA 1S5KA 4B12A 3F5BA 4NSQA 3FEEA 1Z5RA 2QIRA 4MCRA 4QVTA 4ZY0A 5FVJA 2BO9A 3FIXA 1Z8TA 3DNSA 2ZENA 4U9ZA 5DWMA 3W91A 2GANA 1LRZA 4NGPA 4CPAA 2PJ7A 4A94A 1L0CA 2G3AA 2PQ8A 2HC9A 4YU9A 5LRJA 3IWGA 4F6AA 2GU2A 5A28A 2A4NA 4AG9A 2CIJA 4ORFA 4KLWA 4AXVA 1Y9KA 3NH5A 2PIZA 2Z0ZA 3FMCA 4EMEA 1K4JA 2XEFA 4C2YA 3K9UA 4CAEA 1F57A 4KOWA 4NGNA 4P4BA 5LYIA 4B10A 4MBUA 2PSWA 3EC4A 3MN8A 2BL1A 2B5GB 5LYFA 1CG2A 3FYNA 4R87A 4P4IA 5A27A 3SI1A 3DSBA 4M6GA 4CYQA 4OMEA 3V7ZA 4CGNA 1YGHA 4DYOA 4B11A 1M4LA 2P6EA 2PC1A 2BSWA 2ZXVA 2R98A 2PDOA 3DR6A 1UWYA 1YX0A 2AFOA 2P0WA 4CYPA 1YLOA 1F2OA 6CPAA 2FIAA 3B7IA 4KUBA 3H8FA 4GXHA 2QMLA 3W6XA 2NSMA 3CXPA 1DTDA 1ELMP 2OR4A 4UEEA 2F5IA 1NSLA 2RC4A 3HUVA 4XNHB 1ZLHA 3IWEA 2PRQA 2AE6A 4JLYA 1LANA 1IIDA 1IYKA 2NMTA 4F9UA 3LODA 4B5PA 4MCQA 3LWUA 2F7VA 4X8IA 2OU2A 4C7IA 2ARHA 2JLMA 2QYVA 4UCNA 2AFWA 3S6GA 2AFSA 3EXNA 5THWA 2K5TA 4MHZA 3CXQA 4ZI6A 2AFZA 4CGOA 1KUYA 1Y7EA 3CXSA 2ZEOA 3B3TA 3PB7X 4KOSA 5E96A 4A2ZA 5IB9A 2CNSA 2C27A 4UA3A 1I12A 1YW6A 2VZYA 1IGBA 2KCWA 5JQ4A 1GYTA 2ZEPA 3IO1A 4HKFA 4NGTA 4NF1A 1RO5A 2PVVA 3QB8A 1FY7A 3ZZIA 1LOKA 4L89A 1VHEA 2CNTA 4UFXA 3TC8A 2AFXA 3PP9A 3BI1A 2JBJA 1Z4RA 2V8HA 2PJ9A 3GUXA 4FD4A 1S3ZA 4CAXA 4EWTA 4MY0A 4QUSA 3TO9A 1EE3P 1YQEA 2OZGA 1PYTB 2JDCA 2H5MA 5KTAA 4MCPA 5IV0A 3TE4A 1F2PA 4OIDA 4KSFA 4ZY1A 2OZUA 2O4HA 2PR1A 1S7FA 1QSOA 3D67A 3RAMA 4IK2A 3R95A 3JVNA 4OIWA 3WC6A 3GB0A 4BD9A 2Q4VA 5JGFA 2Z3KA 3GIUA 3I9SA 4ZBGA 5AG4A 2QJ8A 1S7KA 2YNDA 3FRMA 1CM0A 3D7DA 3GY9A 3L2NA 3IEHA 4Y49B 2O28A 1KUXA 3IFEA 4YWYA 3H8GA 4C68A 1YR0A 4OC4A 2PJ4A 2ODFA 5K8MA 4KSIA 5LRGA 3RZAA 4CAVA 3BLNA 4PV6A 4MHNA 5F09A 3QNVA 4MCSA 3EFAA 2VEZA 4NXYA 2C6PA 5IX3A 2Z3PA 2VBQA 1PU9A 4LQGA 2ZW4A 1XMTA 1QSTA 5J8CA 3SI2A 4JXQA 2Z3NA 4FAIA 3PFEA 4P4EA 2QECA 4BMHA 5HH1A 3B3VA 3N7ZA 4MHPA 3NE7A 4B5OA 4NCZA 3WABA 1VIXA 4QB9A 5EBVA 2Q44A 2JEWA 2PJ6A 4J3GA 5JH9A 4HPSA 1CX8A 4II9A 2GFQA 4OC1A 2BCOA 3VWDA 4MXUA 4KORA 4JZ0A 2J9AA 3BXMA 2PJ0A 4KUAA 4IF5A 4W9YA 4OC2A 4P6YA 1YK3A 2DPSA 3H4QA 4P10A 3ISZA 3C26A 4ZX9A 3SHPA 3BI0A 4R3LA 4CRYB 2I79A 4MFJA 5I0CA 4A38A 1I21A 4KOXA 4UFVA 5LRKA 3OWCA 1XEBA 4KZTA 3D7GA 4HNXB 3T8WA 4F0YA 4L8AA 2XEGA 1IYLA 3EY5A 3PBEA 3ISXA 3R9FA 1Y0RA 1LAMA 2EK8A 2RFHA 1BPNA 4TNUA
chains in the Genus database with same CATH topology
2PJ8A 4IHMA 4P4DA 2CTCA 1HDQA 2NYQA 3S9MA 2PCUA 2XEJA 3IWWA 3V38A 4UEFA 1YMEA 2BOAA 2HB6A 1TKJA 2Q43A 3SJGA 3PFOA 4MMOA 2F8HA 4MHYA 4NJQA 3KL9A 1HEEA 3H8EA 2V8VA 4NJRA 1LCPA 4PXCA 2V8DA 3KR4A 4WJBA 3D7HA 2PIYA 2Q4ZA 3KI9A 3FEDA 5K8PA 2V8GA 2AFUA 3VH9A 1HDUA 2CF4A 4P4FA 4GM5A 2PJCA 3GLJA 4PQAA 3D68A 4Q7AA 4X3RA 2C1CA 5LYDA 4FBEA 3FVLA 1RTQA 3BHXA 4ZYQA 5DS0A 1QMUA 3FX6A 1CPXA 2ZOGA 3WC7A 1IY7A 2ZOFA 2C6CA 3KHXA 4X2TA 1LAPA 1XJOA 3DGVA 4Z65A 1TKHA 4TWEA 1BAVA 2ZEMA 3HLPA 4UIAA 1CP6A 1TKFA 3PB4X 3WC5A 4R8FA 3TX8A 2IMOA 3N5FA 5D8NA 4EFDA 3MRUA 2EK9A 1DE4C 2O53A 3RBUA 3B3CA 3FECA 2ZEDA 3NFZA 5I4MA 3D7FA 3KGQA 2PE3A 2PJAA 4A39A 4IAVA 3LMSA 5CPAA 1CPSA 5D29A 1ZG7A 2V77A 3IIBA 4PXBA 3NA6A 1AMPA 4P44A 1KWMA 1YW4A 2ZELA 3IJ3A 2FVGA 2PJ5A 3CPXA 2ANPA 1NSAA 1ARLA 3FH4A 4NGRA 1H8LA 4O23A 4OC5A 3CT9A 3D66A 3KHZA 4FWUA 7CPAA 4ONWA 2I3CA 2QVPA 1Z8LA 5LYLA 1ZG8A 2ABZA 4PXEA 1Z2LA 1ELLP 4PPZA 1BPMA 3NH8A 4FUUA 4NFRA 4OC3A 3SI0A 4OP4A 3NH4A 1CP7A 1AYEA 4UF4A 2EWBA 1PCAA 2G9DA 4R76A 5J1QA 2GREA 4OC0A 2CTBA 2ZEEA 1XFOA 1FT7A 2OOTA 2VL1A 3K2KA 1Y0YA 3VARA 4A37A 2AFMA 1TF8A 4UEZA 2Q51A 5K8OA 3KQXA 3PB6X 4B6ZA 3CPAA 4K3NA 3B3WA 4P4JA 2C6GA 1QQ9A 1TF9A 1XMBA 2WYRA 8CPAA 1VHOA 4WWVA 1CBXA 3S9LA 1R3NA 4H2KA 3VATA 5K8NA 3DLJA 3PB9X 1BLLE 3FF3A 1FNOA 2RB7A 1ZLIA 4DJLA 2PJ2A 2PJBA 3KASA 1R43A 2ZEGA 2IJZA 3S9NA 4ZX8A 5HVGA 4NGMA 1Q7LA 3PB8X 1ARMA 4NGSA 4NGQA 1LFWA 1ZG9A 5HVHA 2DEAA 2PVWA 3SJXA 1OBRA 4R6TA 1JQGA 3K9TA 3IC1A 3PBBA 4RUHA 3KQZA 1YSJA 3SJFA 2POKA 4P45A 5CBMA 2WZNA 3KZWA 3B2YA 4OKOA 5ELYA 4MRIA 2ZEHA 5JM6A 2ZEFA 4PXDA 2IQ6A 3PRTA 2GLJA 3CDXA 4G1PA 4JYWA 4DUKA 3SJEA 4F8ZA 1XBUA 3JRUA 4F9VA 2PJ3A 5HVFA 1VGYA 3FJUA 5HXDA 3I1UA 2PJ1A 3B3SA 2XEIA 3WT4A 3KR5A 4R7MA 4UIBA 2GLFA 1XRYA 2JBKA 3D4UA 3B35A 1TXRA 3PEIA 3FEEA 1Z5RA 4MCRA 4ZY0A 2BO9A 2ZENA 4NGPA 4CPAA 2PJ7A 4A94A 2HC9A 4YU9A 5LRJA 2GU2A 2CIJA 4AXVA 3NH5A 2PIZA 3FMCA 4EMEA 2XEFA 1F57A 4NGNA 4P4BA 5LYIA 3MN8A 5LYFA 1CG2A 4P4IA 3SI1A 4OMEA 3V7ZA 4DYOA 1M4LA 1UWYA 2AFOA 1YLOA 1F2OA 6CPAA 3B7IA 3H8FA 2NSMA 1DTDA 1ELMP 2OR4A 4UEEA 3HUVA 1ZLHA 2PRQA 4F9UA 1LANA 4MCQA 3LWUA 2F7VA 4X8IA 1BPNA 2QYVA 2AFWA 2AFSA 5THWA 4ZI6A 4MHZA 2AFZA 1Y7EA 5IB9A 2ZEOA 3B3TA 3PB7X 1YW6A 1IGBA 1GYTA 2ZEPA 3IO1A 4NGTA 2PVVA 1LOKA 1VHEA 3TC8A 2AFXA 3BI1A 2JBJA 2V8HA 2PJ9A 3GUXA 4EWTA 1EE3P 1PYTB 4MCPA 1F2PA 4OIDA 4ZY1A 2O4HA 3D67A 3RAMA 4IK2A 4OIWA 3WC6A 3GB0A 4BD9A 5JGFA 2QJ8A 4ZY2A 3L2NA 3D7DA 3IEHA 3IFEA 4YWYA 3H8GA 4OC4A 2PJ4A 5K8MA 4KSIA 5LRGA 3RZAA 4MHNA 5F09A 4MCSA 2C6PA 4LQGA 3SI2A 4FAIA 3PFEA 4P4EA 3B3VA 4MHPA 3WABA 1VIXA 2JEWA 2PJ6A 5JH9A 1CX8A 4OC1A 2BCOA 4MXUA 4JZ0A 2J9AA 3BXMA 2PJ0A 4W9YA 4OC2A 4P6YA 4P10A 3ISZA 4ZX9A 3BI0A 4A38A 5LRKA 3T8WA 3D7GA 2XEGA 3PBEA 3ISXA 1Y0RA 1LAMA 2EK8A 2RFHA 3QNVA 4TNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ8 A;  4IHM A;  4P4D A;  2CTC A;  1HDQ A;  2NYQ A;  3S9M A;  2PCU A;  2XEJ A;  3IWW A;  3V38 A;  4UEF A;  1YME A;  2BOA A;  2HB6 A;  1TKJ A;  2Q43 A;  3SJG A;  3PFO A;  4MMO A;  2F8H A;  4MHY A;  4NJQ A;  3KL9 A;  1HEE A;  3H8E A;  2V8V A;  4NJR A;  1LCP A;  4PXC A;  2V8D A;  3KR4 A;  4WJB A;  3D7H A;  2PIY A;  2Q4Z A;  3KI9 A;  3FED A;  5K8P A;  2V8G A;  2AFU A;  3VH9 A;  1HDU A;  2CF4 A;  4P4F A;  4GM5 A;  2PJC A;  3GLJ A;  4PQA A;  3D68 A;  4Q7A A;  4X3R A;  2C1C A;  5LYD A;  4FBE A;  3FVL A;  1RTQ A;  3BHX A;  4ZYQ A;  5DS0 A;  1QMU A;  3FX6 A;  1CPX A;  2ZOG A;  3WC7 A;  1IY7 A;  2ZOF A;  2C6C A;  3KHX A;  4X2T A;  1LAP A;  1XJO A;  3DGV A;  4Z65 A;  1TKH A;  4TWE A;  1BAV A;  2ZEM A;  3HLP A;  4UIA A;  1CP6 A;  1TKF A;  3PB4 X;  3WC5 A;  4R8F A;  3TX8 A;  2IMO A;  3N5F A;  5D8N A;  4EFD A;  3MRU A;  2EK9 A;  1DE4 C;  2O53 A;  3RBU A;  3B3C A;  3FEC A;  2ZED A;  3NFZ A;  5I4M A;  3D7F A;  3KGQ A;  2PE3 A;  2PJA A;  4A39 A;  4IAV A;  3LMS A;  5CPA A;  1CPS A;  5D29 A;  1ZG7 A;  2V77 A;  3IIB A;  4PXB A;  3NA6 A;  1AMP A;  4P44 A;  1KWM A;  1YW4 A;  2ZEL A;  3IJ3 A;  2FVG A;  2PJ5 A;  3CPX A;  2ANP A;  1NSA A;  1ARL A;  3FH4 A;  4NGR A;  1H8L A;  4O23 A;  4OC5 A;  3CT9 A;  3D66 A;  3KHZ A;  4FWU A;  7CPA A;  4ONW A;  2I3C A;  2QVP A;  1Z8L A;  5LYL A;  1ZG8 A;  2ABZ A;  4PXE A;  1Z2L A;  1ELL P;  4PPZ A;  1BPM A;  3NH8 A;  4FUU A;  4NFR A;  4OC3 A;  3SI0 A;  4OP4 A;  3NH4 A;  1CP7 A;  1AYE A;  4UF4 A;  2EWB A;  1PCA A;  2G9D A;  4R76 A;  5J1Q A;  2GRE A;  4OC0 A;  2CTB A;  2ZEE A;  1XFO A;  1FT7 A;  2OOT A;  2VL1 A;  3K2K A;  1Y0Y A;  3VAR A;  4A37 A;  2AFM A;  1TF8 A;  4UEZ A;  2Q51 A;  5K8O A;  3KQX A;  3PB6 X;  4B6Z A;  3CPA A;  4K3N A;  3B3W A;  4P4J A;  2C6G A;  1QQ9 A;  1TF9 A;  1XMB A;  2WYR A;  8CPA A;  1VHO A;  4WWV A;  1CBX A;  3S9L A;  1R3N A;  4H2K A;  3VAT A;  5K8N A;  3DLJ A;  3PB9 X;  1BLL E;  3FF3 A;  1FNO A;  2RB7 A;  1ZLI A;  4DJL A;  2PJ2 A;  2PJB A;  3KAS A;  1R43 A;  2ZEG A;  2IJZ A;  3S9N A;  4ZX8 A;  5HVG A;  4NGM A;  1Q7L A;  3PB8 X;  1ARM A;  4NGS A;  4NGQ A;  1LFW A;  1ZG9 A;  5HVH A;  2DEA A;  2PVW A;  3SJX A;  1OBR A;  4R6T A;  1JQG A;  3K9T A;  3IC1 A;  3PBB A;  4RUH A;  3KQZ A;  1YSJ A;  3SJF A;  2POK A;  4P45 A;  5CBM A;  2WZN A;  3KZW A;  3B2Y A;  4OKO A;  5ELY A;  4MRI A;  2ZEH A;  5JM6 A;  2ZEF A;  4PXD A;  2IQ6 A;  3PRT A;  2GLJ A;  3CDX A;  4G1P A;  4JYW A;  4DUK A;  3SJE A;  4F8Z A;  1XBU A;  3JRU A;  4F9V A;  2PJ3 A;  5HVF A;  1VGY A;  3FJU A;  5HXD A;  3I1U A;  2PJ1 A;  3B3S A;  2XEI A;  3WT4 A;  3KR5 A;  4R7M A;  4UIB A;  2GLF A;  1XRY A;  2JBK A;  3D4U A;  3B35 A;  1TXR A;  3PEI A;  3FEE A;  1Z5R A;  4MCR A;  4ZY0 A;  2BO9 A;  2ZEN A;  4NGP A;  4CPA A;  2PJ7 A;  4A94 A;  2HC9 A;  4YU9 A;  5LRJ A;  2GU2 A;  2CIJ A;  4AXV A;  3NH5 A;  2PIZ A;  3FMC A;  4EME A;  2XEF A;  1F57 A;  4NGN A;  4P4B A;  5LYI A;  3MN8 A;  5LYF A;  1CG2 A;  4P4I A;  3SI1 A;  4OME A;  3V7Z A;  4DYO A;  1M4L A;  1UWY A;  2AFO A;  1YLO A;  1F2O A;  6CPA A;  3B7I A;  3H8F A;  2NSM A;  1DTD A;  1ELM P;  2OR4 A;  4UEE A;  3HUV A;  1ZLH A;  2PRQ A;  4F9U A;  1LAN A;  4MCQ A;  3LWU A;  2F7V A;  4X8I A;  1BPN A;  2QYV A;  2AFW A;  2AFS A;  5THW A;  4ZI6 A;  4MHZ A;  2AFZ A;  1Y7E A;  5IB9 A;  2ZEO A;  3B3T A;  3PB7 X;  1YW6 A;  1IGB A;  1GYT A;  2ZEP A;  3IO1 A;  4NGT A;  2PVV A;  1LOK A;  1VHE A;  3TC8 A;  2AFX A;  3BI1 A;  2JBJ A;  2V8H A;  2PJ9 A;  3GUX A;  4EWT A;  1EE3 P;  1PYT B;  4MCP A;  1F2P A;  4OID A;  4ZY1 A;  2O4H A;  3D67 A;  3RAM A;  4IK2 A;  4OIW A;  3WC6 A;  3GB0 A;  4BD9 A;  5JGF A;  2QJ8 A;  4ZY2 A;  3L2N A;  3D7D A;  3IEH A;  3IFE A;  4YWY A;  3H8G A;  4OC4 A;  2PJ4 A;  5K8M A;  4KSI A;  5LRG A;  3RZA A;  4MHN A;  5F09 A;  4MCS A;  2C6P A;  4LQG A;  3SI2 A;  4FAI A;  3PFE A;  4P4E A;  3B3V A;  4MHP A;  3WAB A;  1VIX A;  2JEW A;  2PJ6 A;  5JH9 A;  1CX8 A;  4OC1 A;  2BCO A;  4MXU A;  4JZ0 A;  2J9A A;  3BXM A;  2PJ0 A;  4W9Y A;  4OC2 A;  4P6Y A;  4P10 A;  3ISZ A;  4ZX9 A;  3BI0 A;  4A38 A;  5LRK A;  3T8W A;  3D7G A;  2XEG A;  3PBE A;  3ISX A;  1Y0R A;  1LAM A;  2EK8 A;  2RFH A;  3QNV A;  4TNU A; 
#chains in the Genus database with same CATH topology
 2PJ8 A;  4IHM A;  4P4D A;  2CTC A;  1N71 A;  3PZJ A;  4JD6 A;  1HDQ A;  3RNZ A;  2NYQ A;  3S9M A;  4QBJ A;  2PCU A;  2XEJ A;  3IWW A;  3V38 A;  4UEF A;  1YME A;  2BOA A;  1J4J A;  2HB6 A;  1P0H A;  4F0X A;  1TKJ A;  2YNE A;  1NE9 A;  4H89 A;  4OAE A;  1CJW A;  4UBR A;  4H6Z A;  2Q43 A;  3NE8 A;  3PFO A;  3SJG A;  4MMO A;  2F8H A;  2J8M A;  2B5G A;  4MHY A;  5F47 A;  4NJQ A;  1HEE A;  3H8E A;  3KL9 A;  2V8V A;  4NJR A;  1LCP A;  4PXC A;  4JWP A;  2Q0Y A;  2V8D A;  3KR4 A;  4RS2 A;  4WJB A;  4A95 A;  3D7H A;  2PIY A;  2Q4Z A;  4KVM E;  3EO4 A;  3KI9 A;  3RYO A;  3GKR A;  3FED A;  2YNC A;  2V8G A;  3SXO A;  1I1D A;  4BIN A;  5K8P A;  1IOI A;  2CXA A;  2AFU A;  3VH9 A;  1HDU A;  1PUA A;  1QSN A;  3S6H A;  3V8I A;  2CF4 A;  5H86 A;  2REE A;  4P4F A;  5AGE A;  4GM5 A;  2PJC A;  3R9E A;  4AVB A;  3GLJ A;  2B4B A;  4PQA A;  3D68 A;  1IB1 E;  1M4I A;  4Q7A A;  3SXN A;  4X3R A;  2WUU A;  2C1C A;  4LQ6 A;  4YRH A;  5LYD A;  4MHD A;  1SQH A;  4FBE A;  3H5Z A;  4B5P B;  3FVL A;  1RTQ A;  1A2Z A;  3BHX A;  4ZYQ A;  1ON0 A;  4CAW A;  5DS0 A;  2Z3L A;  3UY5 A;  4H6U A;  1QMU A;  3FX6 A;  1CPX A;  2ZOG A;  3WC7 A;  1IY7 A;  2ZOF A;  2ATR A;  2C6C A;  3KHX A;  4KOT A;  4X2T A;  1LAP A;  1XJO A;  3DGV A;  4PK3 A;  5C82 A;  4Z65 A;  3G8W A;  1TKH A;  4TWE A;  2HV2 A;  1BAV A;  1NMT A;  2EUI A;  1KZF A;  1CP6 A;  2FS5 A;  2ZEM A;  3GYA A;  3HLP A;  4NEX A;  4UIA A;  1JWQ A;  4UCP A;  1KUV A;  1TKF A;  3D2P A;  3PB4 X;  3R9G A;  3TO7 A;  5JPH A;  2FXF A;  3P2F A;  3WC5 A;  4R8F A;  3TX8 A;  4ZGY B;  5BWA B;  2IMO A;  3N5F A;  4M3S A;  2JDD A;  5D8N A;  4Q38 A;  1RXT A;  3F8K A;  3TT2 A;  1M4D A;  4EFD A;  3TCV A;  4YGO A;  3D3S A;  4A30 A;  2GE3 A;  3MRU A;  2IL4 A;  2R1I A;  1VKC A;  3DDD A;  4PK2 A;  4PSX A;  2EK9 A;  4OAD A;  4C2Z A;  1DE4 C;  2O53 A;  4MFK A;  1MJA A;  4R9M A;  3RBU A;  1X12 A;  4IUS A;  5F48 A;  3B3C A;  3FEC A;  5IB0 A;  2ZED A;  3CZX A;  3NFZ A;  2JEV A;  2ZW6 A;  2DF5 A;  1ZO0 A;  4M6H A;  1YVK A;  2Q7S A;  5I4M A;  4A32 A;  3F0A A;  3MGD A;  3D7F A;  1Y7R A;  1B6B A;  3KGQ A;  4OLL A;  2B58 A;  1XF8 A;  4Q36 A;  4JJX A;  2PE3 A;  2PJA A;  5AG6 A;  4A39 A;  1Q2Y A;  4GS4 A;  3TO6 A;  4IAV A;  1WWZ A;  5ISV A;  4HNY B;  4Y49 C;  4KVX A;  4AG7 A;  3TFY A;  3LMS A;  4UFW A;  2WPX A;  5CPA A;  4B14 A;  1CPS A;  5D29 A;  4AVA A;  2Z3M A;  1BOB A;  1ZG7 A;  1B87 A;  2V77 A;  3IIB A;  4PXB A;  2DXQ A;  1AMP A;  3NA6 A;  2D4P A;  4P44 A;  1Q2C A;  3T9Y A;  3I3G A;  2Y0M A;  1Z4E A;  3TOA A;  4R3K A;  1U6M A;  2B4D B;  1KWM A;  1YW4 A;  4B13 A;  2ZEL A;  2HUZ A;  1VHS A;  3IJ3 A;  2FVG A;  5G22 A;  2PJ5 A;  3CPX A;  4K30 A;  2ANP A;  4XPD C;  1NSA A;  2FSR A;  4FD7 A;  4A33 A;  1ARL A;  4DNC A;  4KLV A;  3FH4 A;  4E8O A;  5C88 A;  5CNP A;  4NGR A;  4LX9 A;  1H8L A;  4O23 A;  4OC5 A;  3CT9 A;  3D66 A;  3KHZ A;  4FWU A;  4R57 A;  3T90 A;  3WR7 A;  2B4D A;  7CPA A;  1TIQ A;  2ZPA A;  4ONW A;  3FXT A;  2I3C A;  2QVP A;  1Z8L A;  5LYL A;  1ZG8 A;  3BJ7 A;  1MK4 A;  4E2A A;  2ABZ A;  1S60 A;  2YNC C;  4PXE A;  4CS0 B;  3QAH A;  3G3S A;  5F49 A;  5GCN A;  1Z2L A;  1ELL P;  1QSR A;  4XPK A;  5H84 A;  4PPZ A;  4MJ8 A;  1BPM A;  4CAF A;  3NH8 A;  2EO8 A;  4FUU A;  3TOB A;  2FT0 A;  4NFR A;  3JUW A;  4OC3 A;  2WSA A;  4A31 A;  1Z9U A;  5HMN A;  3SI0 A;  3VWE A;  1MJ9 A;  4OP4 A;  5F46 A;  2VXK A;  2REF A;  4RN7 A;  3S6F A;  2CNM A;  3NH4 A;  5DWN A;  2CY2 A;  1S7L A;  1CP7 A;  2J8R A;  2VI7 A;  3R96 A;  1AYE A;  4UF4 A;  2Q4Y A;  2BUE A;  3D2M A;  1M44 A;  4KOU A;  4QC6 A;  1M1D A;  4PSW A;  2EWB A;  1XIX A;  2AJ6 A;  1PCA A;  2G9D A;  4R76 A;  5J1Q A;  2GRE A;  4OC0 A;  4C7H A;  5J8F A;  1Y9W A;  2HQY A;  2CTB A;  2ZEE A;  4MFZ A;  1XFO A;  1FT7 A;  2OOT A;  2VL1 A;  5G21 A;  1WK4 A;  3K2K A;  4MI4 A;  1OZP A;  5G20 A;  4RI1 A;  1Y0Y A;  3VAR A;  3KKW A;  4A37 A;  4KVO E;  2ZW5 A;  2AFM A;  1TF8 A;  3S6K A;  4UEZ A;  2Q51 A;  4E0A A;  5K8O A;  3JTK A;  1YRE A;  3A9L A;  3KQX A;  3PB6 X;  2VQY A;  2GIV A;  3CPA A;  4K3N A;  3B3W A;  4M6I A;  1BO4 A;  2C6G A;  4P4J A;  5EMI A;  4B6Z A;  4CYO A;  1QQ9 A;  3R1K A;  2OZH A;  3RO0 A;  2Q7B A;  1Z8X A;  1TF9 A;  1XMB A;  2WYR A;  4U9Y A;  1VHO A;  8CPA A;  4WWV A;  1CBX A;  1MJB A;  4KS9 A;  3S9L A;  1R3N A;  4H2K A;  3VAT A;  5K8N A;  1IIC A;  3DLJ A;  1P4N A;  4CGL A;  3PB9 X;  1S7N A;  1BLL E;  3FF3 A;  4MFL A;  2B3U A;  1FNO A;  2BEI A;  2G3T A;  2RB7 A;  2R7H A;  1X10 A;  2Z10 A;  3FBU A;  1ZLI A;  1YVO A;  2B3V A;  2PJ2 A;  3TTH A;  4DJL A;  2FIW A;  4FD6 A;  1QSM A;  3E0K A;  2PR8 A;  4MFQ A;  2PJB A;  3KAS A;  1R43 A;  3P2H A;  4HNW B;  1V0C A;  4ONU A;  2ZEG A;  4UCM A;  4FD5 A;  1GHE A;  2IJZ A;  3S9N A;  4YFJ A;  4ZX8 A;  5HVG A;  4NGM A;  1Q7L A;  3PB8 X;  1IU8 A;  1ARM A;  4NGS A;  4X5K A;  1M4G A;  2ZW7 A;  1LFW A;  3DR8 A;  4NGQ A;  1ZG9 A;  5HVH A;  2DEA A;  2PVW A;  3SJX A;  1XE4 A;  2Z11 A;  1OBR A;  2VZZ A;  3LAC A;  5AG7 A;  2PRB A;  4R6T A;  1JQG A;  3K9T A;  2G0B A;  4KSA A;  3B8G A;  3IC1 A;  4CRZ B;  3PBB A;  4RUH A;  3KQZ A;  1YSJ A;  4U5Y A;  3SJF A;  3D8P A;  2POK A;  3LD2 A;  4P45 A;  2OB0 A;  3FB3 A;  4C2X A;  4KOY A;  1R57 A;  2Z3O A;  5CBM A;  2WZN A;  1XOV A;  1Z8W A;  4I49 A;  4CGP A;  2FCK A;  3QAY A;  3KZW A;  3B2Y A;  4OKO A;  4UWI A;  2J8N A;  4CGM A;  4XPD B;  5ELY A;  4ZY2 A;  4XPL A;  4JXR A;  2ZEH A;  2YGW A;  4MRI A;  1IOF A;  3IU1 A;  5JM6 A;  2ZEF A;  4UWJ A;  4PXD A;  2IQ6 A;  3PRT A;  4MFP A;  1UFH A;  2Q04 A;  4AVC A;  2I00 A;  2GLJ A;  3CDX A;  2EVN A;  3IGR A;  4MY3 A;  4G1P A;  4JYW A;  1YLE A;  4DUK A;  5KTD A;  2EBJ A;  3SJE A;  3IU2 A;  4AB7 A;  4M85 A;  4F8Z A;  1XBU A;  2DPT A;  2FL4 A;  3JRU A;  1Q2D A;  4F9V A;  2PJ3 A;  5HVF A;  5AG5 A;  3BJ8 A;  1VGY A;  3W6S A;  2FE7 A;  2X7B A;  3ZJ0 A;  3FJU A;  3FNC A;  3PGP A;  5HXD A;  5EC4 A;  3I1U A;  2D4O A;  5G1Z A;  2PJ1 A;  3B3S A;  2XEI A;  3WT4 A;  5KTC A;  2OH1 A;  3KR5 A;  4R7M A;  4UIB A;  2GLF A;  2WPW A;  4XNH C;  4LUA A;  4CYN A;  1XRY A;  4KOV A;  2P6G A;  2R8V A;  2JBK A;  4EVY A;  3D4U A;  3B35 A;  4BBH A;  1TXR A;  3PEI A;  2P6F A;  1AUG A;  1S5K A;  4B12 A;  3F5B A;  4NSQ A;  3FEE A;  1Z5R A;  2QIR A;  4MCR A;  4QVT A;  4ZY0 A;  5FVJ A;  2BO9 A;  3FIX A;  1Z8T A;  3DNS A;  2ZEN A;  4U9Z A;  5DWM A;  3W91 A;  2GAN A;  1LRZ A;  4NGP A;  4CPA A;  2PJ7 A;  4A94 A;  1L0C A;  2G3A A;  2PQ8 A;  2HC9 A;  4YU9 A;  5LRJ A;  3IWG A;  4F6A A;  2GU2 A;  5A28 A;  2A4N A;  4AG9 A;  2CIJ A;  4ORF A;  4KLW A;  4AXV A;  1Y9K A;  3NH5 A;  2PIZ A;  2Z0Z A;  3FMC A;  4EME A;  1K4J A;  2XEF A;  4C2Y A;  3K9U A;  4CAE A;  1F57 A;  4KOW A;  4NGN A;  4P4B A;  5LYI A;  4B10 A;  4MBU A;  2PSW A;  3EC4 A;  3MN8 A;  2BL1 A;  2B5G B;  5LYF A;  1CG2 A;  3FYN A;  4R87 A;  4P4I A;  5A27 A;  3SI1 A;  3DSB A;  4M6G A;  4CYQ A;  4OME A;  3V7Z A;  4CGN A;  1YGH A;  4DYO A;  4B11 A;  1M4L A;  2P6E A;  2PC1 A;  2BSW A;  2ZXV A;  2R98 A;  2PDO A;  3DR6 A;  1UWY A;  1YX0 A;  2AFO A;  2P0W A;  4CYP A;  1YLO A;  1F2O A;  6CPA A;  2FIA A;  3B7I A;  4KUB A;  3H8F A;  4GXH A;  2QML A;  3W6X A;  2NSM A;  3CXP A;  1DTD A;  1ELM P;  2OR4 A;  4UEE A;  2F5I A;  1NSL A;  2RC4 A;  3HUV A;  4XNH B;  1ZLH A;  3IWE A;  2PRQ A;  2AE6 A;  4JLY A;  1LAN A;  1IID A;  1IYK A;  2NMT A;  4F9U A;  3LOD A;  4B5P A;  4MCQ A;  3LWU A;  2F7V A;  4X8I A;  2OU2 A;  4C7I A;  2ARH A;  2JLM A;  2QYV A;  4UCN A;  2AFW A;  3S6G A;  2AFS A;  3EXN A;  5THW A;  2K5T A;  4MHZ A;  3CXQ A;  4ZI6 A;  2AFZ A;  4CGO A;  1KUY A;  1Y7E A;  3CXS A;  2ZEO A;  3B3T A;  3PB7 X;  4KOS A;  5E96 A;  4A2Z A;  5IB9 A;  2CNS A;  2C27 A;  4UA3 A;  1I12 A;  1YW6 A;  2VZY A;  1IGB A;  2KCW A;  5JQ4 A;  1GYT A;  2ZEP A;  3IO1 A;  4HKF A;  4NGT A;  4NF1 A;  1RO5 A;  2PVV A;  3QB8 A;  1FY7 A;  3ZZI A;  1LOK A;  4L89 A;  1VHE A;  2CNT A;  4UFX A;  3TC8 A;  2AFX A;  3PP9 A;  3BI1 A;  2JBJ A;  1Z4R A;  2V8H A;  2PJ9 A;  3GUX A;  4FD4 A;  1S3Z A;  4CAX A;  4EWT A;  4MY0 A;  4QUS A;  3TO9 A;  1EE3 P;  1YQE A;  2OZG A;  1PYT B;  2JDC A;  2H5M A;  5KTA A;  4MCP A;  5IV0 A;  3TE4 A;  1F2P A;  4OID A;  4KSF A;  4ZY1 A;  2OZU A;  2O4H A;  2PR1 A;  1S7F A;  1QSO A;  3D67 A;  3RAM A;  4IK2 A;  3R95 A;  3JVN A;  4OIW A;  3WC6 A;  3GB0 A;  4BD9 A;  2Q4V A;  5JGF A;  2Z3K A;  3GIU A;  3I9S A;  4ZBG A;  5AG4 A;  2QJ8 A;  1S7K A;  2YND A;  3FRM A;  1CM0 A;  3D7D A;  3GY9 A;  3L2N A;  3IEH A;  4Y49 B;  2O28 A;  1KUX A;  3IFE A;  4YWY A;  3H8G A;  4C68 A;  1YR0 A;  4OC4 A;  2PJ4 A;  2ODF A;  5K8M A;  4KSI A;  5LRG A;  3RZA A;  4CAV A;  3BLN A;  4PV6 A;  4MHN A;  5F09 A;  3QNV A;  4MCS A;  3EFA A;  2VEZ A;  4NXY A;  2C6P A;  5IX3 A;  2Z3P A;  2VBQ A;  1PU9 A;  4LQG A;  2ZW4 A;  1XMT A;  1QST A;  5J8C A;  3SI2 A;  4JXQ A;  2Z3N A;  4FAI A;  3PFE A;  4P4E A;  2QEC A;  4BMH A;  5HH1 A;  3B3V A;  3N7Z A;  4MHP A;  3NE7 A;  4B5O A;  4NCZ A;  3WAB A;  1VIX A;  4QB9 A;  5EBV A;  2Q44 A;  2JEW A;  2PJ6 A;  4J3G A;  5JH9 A;  4HPS A;  1CX8 A;  4II9 A;  2GFQ A;  4OC1 A;  2BCO A;  3VWD A;  4MXU A;  4KOR A;  4JZ0 A;  2J9A A;  3BXM A;  2PJ0 A;  4KUA A;  4IF5 A;  4W9Y A;  4OC2 A;  4P6Y A;  1YK3 A;  2DPS A;  3H4Q A;  4P10 A;  3ISZ A;  3C26 A;  4ZX9 A;  3SHP A;  3BI0 A;  4R3L A;  4CRY B;  2I79 A;  4MFJ A;  5I0C A;  4A38 A;  1I21 A;  4KOX A;  4UFV A;  5LRK A;  3OWC A;  1XEB A;  4KZT A;  3D7G A;  4HNX B;  3T8W A;  4F0Y A;  4L8A A;  2XEG A;  1IYL A;  3EY5 A;  3PBE A;  3ISX A;  3R9F A;  1Y0R A;  1LAM A;  2EK8 A;  2RFH A;  1BPN A;  4TNU A; 
#chains in the Genus database with same CATH homology
 2PJ8 A;  4IHM A;  4P4D A;  2CTC A;  1HDQ A;  2NYQ A;  3S9M A;  2PCU A;  2XEJ A;  3IWW A;  3V38 A;  4UEF A;  1YME A;  2BOA A;  2HB6 A;  1TKJ A;  2Q43 A;  3SJG A;  3PFO A;  4MMO A;  2F8H A;  4MHY A;  4NJQ A;  3KL9 A;  1HEE A;  3H8E A;  2V8V A;  4NJR A;  1LCP A;  4PXC A;  2V8D A;  3KR4 A;  4WJB A;  3D7H A;  2PIY A;  2Q4Z A;  3KI9 A;  3FED A;  5K8P A;  2V8G A;  2AFU A;  3VH9 A;  1HDU A;  2CF4 A;  4P4F A;  4GM5 A;  2PJC A;  3GLJ A;  4PQA A;  3D68 A;  4Q7A A;  4X3R A;  2C1C A;  5LYD A;  4FBE A;  3FVL A;  1RTQ A;  3BHX A;  4ZYQ A;  5DS0 A;  1QMU A;  3FX6 A;  1CPX A;  2ZOG A;  3WC7 A;  1IY7 A;  2ZOF A;  2C6C A;  3KHX A;  4X2T A;  1LAP A;  1XJO A;  3DGV A;  4Z65 A;  1TKH A;  4TWE A;  1BAV A;  2ZEM A;  3HLP A;  4UIA A;  1CP6 A;  1TKF A;  3PB4 X;  3WC5 A;  4R8F A;  3TX8 A;  2IMO A;  3N5F A;  5D8N A;  4EFD A;  3MRU A;  2EK9 A;  1DE4 C;  2O53 A;  3RBU A;  3B3C A;  3FEC A;  2ZED A;  3NFZ A;  5I4M A;  3D7F A;  3KGQ A;  2PE3 A;  2PJA A;  4A39 A;  4IAV A;  3LMS A;  5CPA A;  1CPS A;  5D29 A;  1ZG7 A;  2V77 A;  3IIB A;  4PXB A;  3NA6 A;  1AMP A;  4P44 A;  1KWM A;  1YW4 A;  2ZEL A;  3IJ3 A;  2FVG A;  2PJ5 A;  3CPX A;  2ANP A;  1NSA A;  1ARL A;  3FH4 A;  4NGR A;  1H8L A;  4O23 A;  4OC5 A;  3CT9 A;  3D66 A;  3KHZ A;  4FWU A;  7CPA A;  4ONW A;  2I3C A;  2QVP A;  1Z8L A;  5LYL A;  1ZG8 A;  2ABZ A;  4PXE A;  1Z2L A;  1ELL P;  4PPZ A;  1BPM A;  3NH8 A;  4FUU A;  4NFR A;  4OC3 A;  3SI0 A;  4OP4 A;  3NH4 A;  1CP7 A;  1AYE A;  4UF4 A;  2EWB A;  1PCA A;  2G9D A;  4R76 A;  5J1Q A;  2GRE A;  4OC0 A;  2CTB A;  2ZEE A;  1XFO A;  1FT7 A;  2OOT A;  2VL1 A;  3K2K A;  1Y0Y A;  3VAR A;  4A37 A;  2AFM A;  1TF8 A;  4UEZ A;  2Q51 A;  5K8O A;  3KQX A;  3PB6 X;  4B6Z A;  3CPA A;  4K3N A;  3B3W A;  4P4J A;  2C6G A;  1QQ9 A;  1TF9 A;  1XMB A;  2WYR A;  8CPA A;  1VHO A;  4WWV A;  1CBX A;  3S9L A;  1R3N A;  4H2K A;  3VAT A;  5K8N A;  3DLJ A;  3PB9 X;  1BLL E;  3FF3 A;  1FNO A;  2RB7 A;  1ZLI A;  4DJL A;  2PJ2 A;  2PJB A;  3KAS A;  1R43 A;  2ZEG A;  2IJZ A;  3S9N A;  4ZX8 A;  5HVG A;  4NGM A;  1Q7L A;  3PB8 X;  1ARM A;  4NGS A;  4NGQ A;  1LFW A;  1ZG9 A;  5HVH A;  2DEA A;  2PVW A;  3SJX A;  1OBR A;  4R6T A;  1JQG A;  3K9T A;  3IC1 A;  3PBB A;  4RUH A;  3KQZ A;  1YSJ A;  3SJF A;  2POK A;  4P45 A;  5CBM A;  2WZN A;  3KZW A;  3B2Y A;  4OKO A;  5ELY A;  4MRI A;  2ZEH A;  5JM6 A;  2ZEF A;  4PXD A;  2IQ6 A;  3PRT A;  2GLJ A;  3CDX A;  4G1P A;  4JYW A;  4DUK A;  3SJE A;  4F8Z A;  1XBU A;  3JRU A;  4F9V A;  2PJ3 A;  5HVF A;  1VGY A;  3FJU A;  5HXD A;  3I1U A;  2PJ1 A;  3B3S A;  2XEI A;  3WT4 A;  3KR5 A;  4R7M A;  4UIB A;  2GLF A;  1XRY A;  2JBK A;  3D4U A;  3B35 A;  1TXR A;  3PEI A;  3FEE A;  1Z5R A;  4MCR A;  4ZY0 A;  2BO9 A;  2ZEN A;  4NGP A;  4CPA A;  2PJ7 A;  4A94 A;  2HC9 A;  4YU9 A;  5LRJ A;  2GU2 A;  2CIJ A;  4AXV A;  3NH5 A;  2PIZ A;  3FMC A;  4EME A;  2XEF A;  1F57 A;  4NGN A;  4P4B A;  5LYI A;  3MN8 A;  5LYF A;  1CG2 A;  4P4I A;  3SI1 A;  4OME A;  3V7Z A;  4DYO A;  1M4L A;  1UWY A;  2AFO A;  1YLO A;  1F2O A;  6CPA A;  3B7I A;  3H8F A;  2NSM A;  1DTD A;  1ELM P;  2OR4 A;  4UEE A;  3HUV A;  1ZLH A;  2PRQ A;  4F9U A;  1LAN A;  4MCQ A;  3LWU A;  2F7V A;  4X8I A;  1BPN A;  2QYV A;  2AFW A;  2AFS A;  5THW A;  4ZI6 A;  4MHZ A;  2AFZ A;  1Y7E A;  5IB9 A;  2ZEO A;  3B3T A;  3PB7 X;  1YW6 A;  1IGB A;  1GYT A;  2ZEP A;  3IO1 A;  4NGT A;  2PVV A;  1LOK A;  1VHE A;  3TC8 A;  2AFX A;  3BI1 A;  2JBJ A;  2V8H A;  2PJ9 A;  3GUX A;  4EWT A;  1EE3 P;  1PYT B;  4MCP A;  1F2P A;  4OID A;  4ZY1 A;  2O4H A;  3D67 A;  3RAM A;  4IK2 A;  4OIW A;  3WC6 A;  3GB0 A;  4BD9 A;  5JGF A;  2QJ8 A;  4ZY2 A;  3L2N A;  3D7D A;  3IEH A;  3IFE A;  4YWY A;  3H8G A;  4OC4 A;  2PJ4 A;  5K8M A;  4KSI A;  5LRG A;  3RZA A;  4MHN A;  5F09 A;  4MCS A;  2C6P A;  4LQG A;  3SI2 A;  4FAI A;  3PFE A;  4P4E A;  3B3V A;  4MHP A;  3WAB A;  1VIX A;  2JEW A;  2PJ6 A;  5JH9 A;  1CX8 A;  4OC1 A;  2BCO A;  4MXU A;  4JZ0 A;  2J9A A;  3BXM A;  2PJ0 A;  4W9Y A;  4OC2 A;  4P6Y A;  4P10 A;  3ISZ A;  4ZX9 A;  3BI0 A;  4A38 A;  5LRK A;  3T8W A;  3D7G A;  2XEG A;  3PBE A;  3ISX A;  1Y0R A;  1LAM A;  2EK8 A;  2RFH A;  3QNV A;  4TNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...