1FT7A

Aap complexed with l-leucinephosphonic acid
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the aminopeptidase from Aeromonas proteolytica by L-leucinephosphonic acid. Spectroscopic and crystallographic characterization of the transition state of peptide hydrolysis.
pubmed doi rcsb
molecule keywords BACTERIAL LEUCYL AMINOPEPTIDASE
molecule tags Hydrolase
total genus 108
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2000-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ft7A00
5HVFA 2EK9A 3HLPA 3KI9A 4OC1A 4PPZA 4YU9A 2PJ2A 2V8VA 1TXRA 1FNOA 4MHPA 1QQ9A 2POKA 3SI0A 2AFUA 5DS0A 3H8GA 1CP7A 5HXDA 1PCAA 4YWYA 5JM6A 2VL1A 4K3NA 1R3NA 5CPAA 5HVHA 4P10A 2RFHA 2QJ8A 2IJZA 2QYVA 3ISXA 4F9VA 3B35A 4JYWA 1VHOA 1YMEA 2PJ9A 4NGSA 3FECA 3KGQA 3L2NA 4UIBA 1QMUA 2RB7A 3WC7A 3KZWA 5J1QA 4MCPA 2DEAA 1PYTB 5JGFA 1LFWA 4OC4A 3PB7X 2BO9A 2ZEOA 4PQAA 2Q43A 2PJBA 1TKJA 4NJQA 3SI1A 4A38A 3KL9A 4H2KA 4P6YA 4ZX9A 5K8MA 1XFOA 3TX8A 2V8HA 4TWEA 1Z2LA 4RUHA 5HVGA 1YSJA 1ZG8A 4P4DA 2ZOFA 4MHNA 1Z5RA 1Z8LA 4DYOA 2GLJA 3FX6A 5LYDA 4MRIA 4NGPA 1OBRA 2XEFA 3IIBA 4NGTA 2WZNA 3D7HA 4O23A 1IY7A 2GREA 5ELYA 4ZX8A 2PVVA 5LYIA 3GUXA 4EMEA 4P4JA 4UEFA 2ZELA 1AYEA 3KHZA 3JRUA 1HDUA 1CPSA 4WWVA 4PXEA 4NGNA 3IC1A 1Y7EA 1FT7A 3V7ZA 3KQZA 3N5FA 3CDXA 2F8HA 3CT9A 3WC6A 2ZOGA 2ZEMA 4F9UA 2AFOA 2AFSA 2ZEPA 3D67A 1YW4A 1TF9A 3KQXA 3PB8X 2ZEFA 1CPXA 4ZYQA 3CPXA 4R76A 5D8NA 1HEEA 1LOKA 2OR4A 3IEHA 4Q7AA 2ZEEA 1RTQA 4P45A 1ELMP 4FUUA 2PJ4A 2PJ5A 1XRYA 3PBBA 2ANPA 2C1CA 2J9AA 2JEWA 5D29A 3MRUA 1XJOA 3IJ3A 1LCPA 1F2PA 3HUVA 4P44A 3K2KA 1M4LA 4IAVA 3FVLA 4GM5A 2PJ0A 1BAVA 2ZEGA 4A39A 3SI2A 1YLOA 2NYQA 5K8PA 1DTDA 2I3CA 4OC3A 4P4EA 1CX8A 4ZY1A 3DLJA 1CG2A 3NH4A 3GB0A 3GLJA 3WABA 2CTBA 2XEJA 2XEIA 3FH4A 4A94A 3WC5A 1XMBA 5K8NA 4OC5A 3BI0A 4NGQA 4KSIA 4Z65A 5CBMA 3RZAA 3TC8A 2HC9A 2Q51A 5LRGA 3S9MA 2Q4ZA 4MHZA 4PXBA 4MXUA 1LAMA 4OC0A 1R43A 3FEDA 4OC2A 2C6CA 3WT4A 2PJ6A 3K9TA 1DE4C 2ZEHA 3NH8A 3H8FA 2PCUA 3VATA 1VHEA 4PXDA 3PRTA 5LRJA 1VIXA 4NJRA 1ELLP 4A37A 3FF3A 3BHXA 1LAPA 3NA6A 5THWA 1TKHA 3PB9X 1Y0RA 3B3SA 2PJAA 3DGVA 4OP4A 4X2TA 3NFZA 2PIZA 2O53A 4UEZA 4BD9A 3FMCA 3LMSA 1TF8A 1ARLA 4DUKA 4F8ZA 1CBXA 1IGBA 3BXMA 4P4BA 3RBUA 2IMOA 2JBKA 2V77A 2PIYA 4B6ZA 3KR5A 2PJ3A 6CPAA 1LANA 3PB4X 1TKFA 4P4FA 4OMEA 3SJXA 2PE3A 2BCOA 3B3TA 3PB6X 3SJEA 2C6PA 2PVWA 2NSMA 4UF4A 4WJBA 4OIWA 3B7IA 4FAIA 2ABZA 1ARMA 3D4UA 3B2YA 3SJGA 2ZENA 3QNVA 1EE3P 2OOTA 3D66A 2GU2A 2V8DA 4LQGA 3VARA 3T8WA 4R6TA 3FEEA 1XBUA 3D7FA 4DJLA 2CIJA 1Q7LA 2CF4A 1Y0YA 4X8IA 3V38A 4NFRA 5I4MA 3MN8A 4ZI6A 2PRQA 2HB6A 1GYTA 4PXCA 2JBJA 1ZG9A 3RAMA 4OIDA 4ZY2A 2O4HA 3CPAA 1AMPA 3PBEA 2V8GA 1ZG7A 2IQ6A 2QVPA 3BI1A 4UIAA 3IFEA 2AFWA 4MCRA 4NGMA 4ONWA 4EWTA 1BLLE 5K8OA 1CP6A 1KWMA 2C6GA 2PJ7A 5LYFA 4MHYA 1YW6A 4UEEA 2PJ8A 3B3CA 3IO1A 1H8LA 1ZLIA 2AFZA 5IB9A 4MMOA 2XEGA 2AFXA 1ZLHA 2EWBA 3KHXA 2PJ1A 3B3WA 3PFOA 1NSAA 3B3VA 4MCSA 4X3RA 4P4IA 3I1UA 5LRKA 3NH5A 4R7MA 1F57A 4FWUA 1UWYA 3H8EA 5JH9A 2CTCA 3D68A 2F7VA 4R8FA 4AXVA 8CPAA 4IK2A 7CPAA 3FJUA 4NGRA 3IWWA 4CPAA 1HDQA 4ZY0A 4JZ0A 3S9LA 4FBEA 1VGYA 5F09A 3KASA 3PEIA 3VH9A 4G1PA 2G9DA 3SJFA 2GLFA 3D7GA 2BOAA 2AFMA 4IHMA 1JQGA 4OKOA 3KR4A 3LWUA 2FVGA 4EFDA 3S9NA 3D7DA 1BPNA 3PFEA 2PJCA 1BPMA 4W9YA 2EK8A 4TNUA 1F2OA 2WYRA 4MCQA 3ISZA 2ZEDA 5LYLA
chains in the Genus database with same CATH superfamily
1A2ZA 5AG7A 5HVFA 2Z3MA 2EK9A 1Q2CA 1S7NA 1QSTA 3HLPA 4NXYA 2Z3OA 3KI9A 4OC1A 4PPZA 4YU9A 2J8RA 2PJ2A 2V8VA 3LACA 1TXRA 1FNOA 2Q7SA 4MHPA 3VWDA 1QQ9A 3DR6A 1BO4A 3TE4A 2POKA 2B5GA 3SI0A 1P4NA 4I49A 4MY3A 2AFUA 2Z3LA 4UCPA 5DS0A 3H8GA 3SXOA 1CP7A 1N71A 4XPLA 5HXDA 5ISVA 1PCAA 4YWYA 3R96A 5JM6A 3EFAA 1NSLA 2VL1A 4K3NA 2Q4VA 1R3NA 2WPXA 5CPAA 3R1KA 4CAEA 4P10A 2RFHA 5HVHA 4E0AA 2QJ8A 4Q36A 4H89A 2EUIA 2IJZA 2QYVA 3ISXA 3IU2A 1S5KA 2QMLA 5DWMA 4F9VA 3B35A 4JYWA 1M4DA 1OZPA 1VHOA 1YMEA 2PJ9A 4KLVA 4KSFA 4NGSA 2BUEA 4ORFA 4AG9A 3KGQA 3TCVA 4YRHA 2R8VA 2JDDA 2Q04A 4E8OA 4C7HA 1CM0A 3BJ7A 3L2NA 1XF8A 4UFVA 5A28A 2D4PA 1QMUA 4UIBA 2PRBA 2PR8A 2RB7A 5AG5A 3WC7A 3KZWA 5J1QA 4MCPA 2DEAA 1PYTB 3I9SA 3TO9A 4MI4A 2YNDA 5JGFA 2VZZA 3I3GA 2DPSA 5HMNA 5BWAB 1LFWA 4J3GA 4OC4A 3PB7X 4QUSA 4CAFA 2BO9A 2BEIA 4KS9A 4FD5A 2ZEOA 4PQAA 5H84A 3RNZA 2Q43A 2PJBA 3B8GA 1TKJA 4KOYA 4NJQA 3SI1A 4AG7A 2CNMA 2R98A 4A38A 2WUUA 1PU9A 3FYNA 3KL9A 4H2KA 4P6YA 4ZX9A 1XFOA 3RYOA 3TX8A 2V8HA 4QB9A 4TWEA 1IU8A 1Z2LA 4RUHA 5HVGA 1Z9UA 3IWEA 4GS4A 4M6HA 3N7ZA 2BSWA 2X7BA 1YSJA 2ATRA 2VQYA 1ZG8A 5HH1A 4B5OA 3GYAA 4U9ZA 4P4DA 2ZOFA 4MHNA 2YNCC 2J8MA 3P2FA 2FL4A 2OZGA 3BLNA 1Z5RA 4KVXA 1B87A 3S6FA 3T90A 4B5PB 1Z8LA 2P6GA 4AVCA 4PSWA 3S6KA 5EBVA 4DYOA 4NEXA 4U9YA 2GLJA 4UCMA 3FX6A 5AG4A 5LYDA 4MRIA 5G1ZA 5AGEA 1ZO0A 4AB7A 2Y0MA 4KUBA 4KSAA 2CXAA 3H5ZA 4NGPA 4RN7A 1OBRA 2OB0A 2XEFA 4MFQA 3IIBA 3CXPA 4CYPA 4KOTA 1Y9KA 1U6MA 4NGTA 2WZNA 2Z3KA 1QSRA 3D7HA 4LQ6A 1IY7A 2GREA 4O23A 5ELYA 4ZX8A 2PVVA 2ZEDA 5LYIA 3R9GA 3NE7A 3GUXA 4LX9A 4EMEA 4CGNA 4P4JA 2PDOA 1XEBA 2YNCA 1RXTA 4L89A 2ZELA 4UEFA 3SXNA 5JQ4A 2ZXVA 1AYEA 3KHZA 1XOVA 3JRUA 5C88A 1HDUA 3W91A 1YGHA 3GKRA 1CPSA 4NF1A 2KCWA 2GE3A 4WWVA 2EO8A 3NE8A 2A4NA 4PXEA 2FSRA 2VXKA 1TIQA 2RC4A 1M44A 4II9A 4NGNA 3K9UA 4H6UA 1BOBA 1QSNA 1QSOA 4KOXA 4KVOE 4CAXA 1IB1E 2FCKA 2GIVA 1Y7EA 3IC1A 1FT7A 3V7ZA 3KQZA 4B14A 3N5FA 3CDXA 2F8HA 1J4JA 2G3AA 3CT9A 2ZOGA 5G21A 2ZEMA 3WC6A 1AUGA 4F9UA 3RO0A 3V8IA 1Q2YA 2F5IA 2AFOA 4PK2A 4M3SA 4HNWB 4YGOA 4U5YA 3VWEA 2AFSA 2ZEPA 3D67A 4OAEA 1YW4A 4KOVA 3MGDA 1TF9A 2Z3NA 3P2HA 1NE9A 1KZFA 3FBUA 1SQHA 2EVNA 4KZTA 4CYNA 3KQXA 3DR8A 2Z10A 2D4OA 4KOSA 3UY5A 3PB8X 2FXFA 2ZEFA 1IOFA 1CPXA 5KTCA 4ZYQA 3CPXA 4R76A 5D8NA 1HEEA 3E0KA 4JJXA 2HV2A 1LOKA 2HQYA 4UFWA 1YVOA 4A31A 2OR4A 3IEHA 4Q7AA 3CXQA 3PZJA 4M6GA 4A33A 2R7HA 2ZEEA 5H86A 4RS2A 1XE4A 1RTQA 4P45A 1ELMP 4FUUA 2PJ4A 2O28A 2PJ5A 1XRYA 2VEZA 3ZZIA 3PBBA 2ANPA 2Q7BA 2C1CA 2J9AA 2JEWA 5D29A 3DDDA 3MRUA 3G3SA 1XJOA 5IV0A 3IJ3A 1ON0A 1LCPA 1IYLA 1F2PA 2J8NA 3HUVA 1YLEA 2Q0YA 4HNYB 4C2YA 4P44A 3K2KA 1X10A 4R3KA 4NSQA 1M4LA 4L8AA 4IAVA 1UFHA 1Z4EA 3FVLA 4GM5A 1GHEA 2PJ0A 1BAVA 2ZEGA 4A39A 3SI2A 4CRZB 1Y7RA 1YLOA 1M4IA 2K5TA 2NYQA 2Z11A 5K8PA 1DTDA 2I3CA 2VI7A 4OC3A 4P4EA 4B12A 1CX8A 2C27A 1V0CA 4CAVA 4CGLA 4ZY1A 2ZW5A 3DLJA 3IU1A 4F6AA 1CG2A 2AE6A 3GB0A 3NH4A 3GLJA 3WABA 1IOIA 2CTBA 2XEJA 4UA3A 2XEIA 3FH4A 3TTHA 5EMIA 5C82A 4A94A 3WC5A 5J8FA 1XMBA 4C2XA 4OC5A 5K8NA 2P0WA 4CAWA 3JTKA 1IIDA 3BI0A 5IB0A 2ZW7A 4MCQA 4CGMA 3D3SA 4NGQA 5IX3A 3ZJ0A 5E96A 3LD2A 4KSIA 4LUAA 4B5PA 4Z65A 4HKFA 3RZAA 5A27A 3TC8A 5CBMA 2HC9A 2Q51A 4KUAA 5J8CA 5LRGA 3S9MA 5G22A 2Q4ZA 4F0YA 1MK4A 4MHZA 4PXBA 4MXUA 1LAMA 1M1DA 4OC0A 1R43A 2R1IA 4RI1A 3FEDA 3IWGA 3G8WA 4OC2A 1QSMA 2C6CA 3S6GA 2H5MA 4AVBA 4UCNA 2PJ6A 3DNSA 3WT4A 4PSXA 5G20A 4Q38A 3QAHA 3JUWA 3K9TA 1DE4C 2ZEHA 3F0AA 4UFXA 4Y49B 5KTDA 1Z8TA 4K30A 4MFZA 3NH8A 4KVME 1M4GA 3H8FA 2PCUA 3VATA 3QB8A 1VHEA 4PXDA 3PRTA 3EXNA 5LRJA 1VIXA 2EBJA 1ELLP 4NJRA 4A37A 3TFYA 1S60A 3FF3A 3BHXA 1LAPA 3KKWA 3NA6A 5THWA 1TKHA 2G3TA 4BBHA 3PB9X 1Y0RA 3EC4A 4CGOA 4EVYA 5F46A 3TOAA 4MFKA 3B3SA 4JXQA 4ZGYB 2PJAA 3DSBA 2OZUA 2Q4YA 3DGVA 4MFJA 4OP4A 4X2TA 3NFZA 2PIZA 2O53A 1IICA 4UEZA 4BD9A 3FMCA 1FY7A 3LMSA 1TF8A 1ARLA 1CJWA 3PP9A 1CBXA 3FNCA 4DUKA 1MJBA 5DWNA 4F8ZA 1IGBA 3BXMA 4P4BA 4MBUA 3R9FA 3RBUA 2IMOA 2JBKA 2Q44A 5F49A 2ODFA 2JDCA 1VKCA 2YGWA 4PK3A 2V77A 1WWZA 2PIYA 3JVNA 5GCNA 2VBQA 4B6ZA 4CS0B 3KR5A 2PJ3A 3FXTA 4B11A 4E2AA 5CNPA 6CPAA 1LANA 3PB4X 4JXRA 1TKFA 2OU2A 4A2ZA 5JPHA 4P4FA 4OMEA 4ONUA 5K8MA 2Z0ZA 5I0CA 3SJXA 3D2PA 4HPSA 4X5KA 2PE3A 2FT0A 2BCOA 3B3TA 4AVAA 3PB6X 4A95A 1S7FA 2B3VA 4H6ZA 3SJEA 2C6PA 4QC6A 4JD6A 3W6SA 2PVWA 3CZXA 4XNHB 2Z3PA 1Z8WA 1XIXA 2NSMA 4UF4A 4QVTA 2P6EA 3TOBA 2PC1A 4WJBA 2PR1A 4OIWA 3B7IA 4R87A 2FE7A 3TO6A 2DXQA 2ABZA 4OADA 2GFQA 1ARMA 3WR7A 4FAIA 3D4UA 1I12A 2JEVA 3B2YA 1YR0A 2AJ6A 3SJGA 3TT2A 1KUXA 4IF5A 5F48A 4MFLA 2ZW6A 2ZENA 3QNVA 1EE3P 2OOTA 2OZHA 4CYQA 4R9MA 3D66A 4FD6A 2GU2A 3S6HA 1JWQA 4GXHA 2V8DA 4NCZA 4LQGA 3VARA 3T8WA 3IGRA 4R6TA 3FEEA 4CRYB 1XBUA 2I00A 4KLWA 4FD4A 3D7FA 3A9LA 2DPTA 4DJLA 1VHSA 3FIXA 1X12A 2B5GB 2GANA 2CIJA 2YNEA 1Q7LA 2CF4A 4XPDB 4UWJA 1Y0YA 4X8IA 3V38A 4NFRA 3EY5A 3TO7A 3F8KA 4A32A 5I4MA 4JLYA 3MN8A 4ZI6A 2PRQA 5LYLA 2HB6A 1GYTA 4PXCA 1NMTA 2JBJA 4Y49C 1ZG9A 2FIAA 2REEA 3RAMA 3GY9A 4OIDA 4ZY2A 2O4HA 3CPAA 1I21A 1AMPA 3QAYA 3FRMA 3PBEA 2V8GA 4BMHA 1YREA 1KUVA 1ZG7A 2IQ6A 4KORA 2P6FA 4YFJA 2QVPA 2ARHA 3BI1A 4UIAA 3IFEA 2AFWA 4KOWA 4MCRA 4ONWA 4NGMA 5EC4A 3F5BA 4M85A 1R57A 4EWTA 1BLLE 4FD7A 5K8OA 1CP6A 1KWMA 2C6GA 2PJ7A 5LYFA 4QBJA 4MHYA 1YW6A 5F47A 2QIRA 1YX0A 4UBRA 4UEEA 2B4DA 2PJ8A 3B3CA 1I1DA 1KUYA 1H8LA 3IO1A 1ZLIA 2AFZA 2B4DB 3D8PA 2BL1A 1IYKA 4F0XA 4HNXB 4UWIA 4ZBGA 2WSAA 2B58A 2FS5A 1S7LA 5IB9A 2CNSA 2I79A 1YVKA 2B3UA 4MMOA 2XEGA 3W6XA 2AFXA 1ZLHA 2EWBA 3KHXA 2DF5A 4R3LA 2PJ1A 5FVJA 3B3WA 3PFOA 2QECA 4MHDA 1Q2DA 1NSAA 3B3VA 4MCSA 2HUZA 2ZPAA 1B6BA 3R9EA 4DNCA 4X3RA 4P4IA 4B13A 3GIUA 2CNTA 3I1UA 5LRKA 3NH5A 1MJAA 4R7MA 1F57A 4FWUA 4MY0A 1UWYA 1S7KA 3H8EA 4M6IA 4XNHC 5JH9A 2CTCA 4IUSA 3D68A 3C26A 4XPKA 2JLMA 1L0CA 2FIWA 2F7VA 2B4BA 3OWCA 4R8FA 3EO4A 4AXVA 8CPAA 4BINA 4IK2A 4MJ8A 7CPAA 1YQEA 3FJUA 4NGRA 4R57A 1Z8XA 2VZYA 1S3ZA 3IWWA 4MFPA 4CPAA 2NMTA 1HDQA 5KTAA 2G0BA 3LODA 4ZY0A 2WPWA 4JZ0A 3S9LA 4JWPA 2OH1A 4FBEA 1VGYA 4C68A 3KASA 5F09A 2PSWA 4OLLA 3PEIA 3PGPA 1XMTA 3VH9A 2IL4A 1Z4RA 2ZW4A 4B10A 4PV6A 4G1PA 2G9DA 2REFA 3SJFA 2CY2A 4KOUA 4C2ZA 2GLFA 4XPDC 5AG6A 3T9YA 3D7GA 2BOAA 2AFMA 4IHMA 3SHPA 1JQGA 3CXSA 3FB3A 4OKOA 3KR4A 4CGPA 1PUAA 3LWUA 1K4JA 2PQ8A 2FVGA 3D2MA 3BJ8A 4EFDA 3S9NA 3D7DA 1BPNA 4A30A 3R95A 3PFEA 2PJCA 1LRZA 1BPMA 1Y9WA 4W9YA 4C7IA 1MJ9A 1WK4A 2EK8A 4CYOA 1P0HA 1RO5A 4TNUA 1F2OA 2WYRA 3FECA 3ISZA 1YK3A 3H4QA
chains in the Genus database with same CATH topology
5HVFA 2EK9A 3HLPA 3KI9A 4OC1A 4PPZA 4YU9A 2PJ2A 2V8VA 1TXRA 1FNOA 4MHPA 1QQ9A 2POKA 3SI0A 2AFUA 5DS0A 3H8GA 1CP7A 5HXDA 1PCAA 4YWYA 5JM6A 2VL1A 4K3NA 1R3NA 5CPAA 5HVHA 4P10A 2RFHA 2QJ8A 2IJZA 2QYVA 3ISXA 4F9VA 3B35A 4JYWA 1VHOA 1YMEA 2PJ9A 4NGSA 3FECA 3KGQA 3L2NA 4UIBA 1QMUA 2RB7A 3WC7A 3KZWA 5J1QA 4MCPA 2DEAA 1PYTB 5JGFA 1LFWA 4OC4A 3PB7X 2BO9A 2ZEOA 4PQAA 2Q43A 2PJBA 1TKJA 4NJQA 3SI1A 4A38A 3KL9A 4H2KA 4P6YA 4ZX9A 5K8MA 1XFOA 3TX8A 2V8HA 4TWEA 1Z2LA 4RUHA 5HVGA 1YSJA 1ZG8A 4P4DA 2ZOFA 4MHNA 1Z5RA 1Z8LA 4DYOA 2GLJA 3FX6A 5LYDA 4MRIA 4NGPA 1OBRA 2XEFA 3IIBA 4NGTA 2WZNA 3D7HA 4O23A 1IY7A 2GREA 5ELYA 4ZX8A 2PVVA 5LYIA 3GUXA 4EMEA 4P4JA 4UEFA 2ZELA 1AYEA 3KHZA 3JRUA 1HDUA 1CPSA 4WWVA 4PXEA 4NGNA 3IC1A 1Y7EA 1FT7A 3V7ZA 3KQZA 3N5FA 3CDXA 2F8HA 3CT9A 3WC6A 2ZOGA 2ZEMA 4F9UA 2AFOA 2AFSA 2ZEPA 3D67A 1YW4A 1TF9A 3KQXA 3PB8X 2ZEFA 1CPXA 4ZYQA 3CPXA 4R76A 5D8NA 1HEEA 1LOKA 2OR4A 3IEHA 4Q7AA 2ZEEA 1RTQA 4P45A 1ELMP 4FUUA 2PJ4A 2PJ5A 1XRYA 3PBBA 2ANPA 2C1CA 2J9AA 2JEWA 5D29A 3MRUA 1XJOA 3IJ3A 1LCPA 1F2PA 3HUVA 4P44A 3K2KA 1M4LA 4IAVA 3FVLA 4GM5A 2PJ0A 1BAVA 2ZEGA 4A39A 3SI2A 1YLOA 2NYQA 5K8PA 1DTDA 2I3CA 4OC3A 4P4EA 1CX8A 4ZY1A 3DLJA 1CG2A 3NH4A 3GB0A 3GLJA 3WABA 2CTBA 2XEJA 2XEIA 3FH4A 4A94A 3WC5A 1XMBA 5K8NA 4OC5A 3BI0A 4NGQA 4KSIA 4Z65A 5CBMA 3RZAA 3TC8A 2HC9A 2Q51A 5LRGA 3S9MA 2Q4ZA 4MHZA 4PXBA 4MXUA 1LAMA 4OC0A 1R43A 3FEDA 4OC2A 2C6CA 3WT4A 2PJ6A 3K9TA 1DE4C 2ZEHA 3NH8A 3H8FA 2PCUA 3VATA 1VHEA 4PXDA 3PRTA 5LRJA 1VIXA 4NJRA 1ELLP 4A37A 3FF3A 3BHXA 1LAPA 3NA6A 5THWA 1TKHA 3PB9X 1Y0RA 3B3SA 2PJAA 3DGVA 4OP4A 4X2TA 3NFZA 2PIZA 2O53A 4UEZA 4BD9A 3FMCA 3LMSA 1TF8A 1ARLA 4DUKA 4F8ZA 1CBXA 1IGBA 3BXMA 4P4BA 3RBUA 2IMOA 2JBKA 2V77A 2PIYA 4B6ZA 3KR5A 2PJ3A 6CPAA 1LANA 3PB4X 1TKFA 4P4FA 4OMEA 3SJXA 2PE3A 2BCOA 3B3TA 3PB6X 3SJEA 2C6PA 2PVWA 2NSMA 4UF4A 4WJBA 4OIWA 3B7IA 4FAIA 2ABZA 1ARMA 3D4UA 3B2YA 3SJGA 2ZENA 3QNVA 1EE3P 2OOTA 3D66A 2GU2A 2V8DA 4LQGA 3VARA 3T8WA 4R6TA 3FEEA 1XBUA 3D7FA 4DJLA 2CIJA 1Q7LA 2CF4A 1Y0YA 4X8IA 3V38A 4NFRA 5I4MA 3MN8A 4ZI6A 2PRQA 2HB6A 1GYTA 4PXCA 2JBJA 1ZG9A 3RAMA 4OIDA 4ZY2A 2O4HA 3CPAA 1AMPA 3PBEA 2V8GA 1ZG7A 2IQ6A 2QVPA 3BI1A 4UIAA 3IFEA 2AFWA 4MCRA 4NGMA 4ONWA 4EWTA 1BLLE 5K8OA 1CP6A 1KWMA 2C6GA 2PJ7A 5LYFA 4MHYA 1YW6A 4UEEA 2PJ8A 3B3CA 3IO1A 1H8LA 1ZLIA 2AFZA 5IB9A 4MMOA 2XEGA 2AFXA 1ZLHA 2EWBA 3KHXA 2PJ1A 3B3WA 3PFOA 1NSAA 3B3VA 4MCSA 4X3RA 4P4IA 3I1UA 5LRKA 3NH5A 4R7MA 1F57A 4FWUA 1UWYA 3H8EA 5JH9A 2CTCA 3D68A 2F7VA 4R8FA 4AXVA 8CPAA 4IK2A 7CPAA 3FJUA 4NGRA 3IWWA 4CPAA 1HDQA 4ZY0A 4JZ0A 3S9LA 4FBEA 1VGYA 5F09A 3KASA 3PEIA 3VH9A 4G1PA 2G9DA 3SJFA 2GLFA 3D7GA 2BOAA 2AFMA 4IHMA 1JQGA 4OKOA 3KR4A 3LWUA 2FVGA 4EFDA 3S9NA 3D7DA 1BPNA 3PFEA 2PJCA 1BPMA 4W9YA 2EK8A 4TNUA 1F2OA 2WYRA 4MCQA 3ISZA 2ZEDA 5LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HVF A;  2EK9 A;  3HLP A;  3KI9 A;  4OC1 A;  4PPZ A;  4YU9 A;  2PJ2 A;  2V8V A;  1TXR A;  1FNO A;  4MHP A;  1QQ9 A;  2POK A;  3SI0 A;  2AFU A;  5DS0 A;  3H8G A;  1CP7 A;  5HXD A;  1PCA A;  4YWY A;  5JM6 A;  2VL1 A;  4K3N A;  1R3N A;  5CPA A;  5HVH A;  4P10 A;  2RFH A;  2QJ8 A;  2IJZ A;  2QYV A;  3ISX A;  4F9V A;  3B35 A;  4JYW A;  1VHO A;  1YME A;  2PJ9 A;  4NGS A;  3FEC A;  3KGQ A;  3L2N A;  4UIB A;  1QMU A;  2RB7 A;  3WC7 A;  3KZW A;  5J1Q A;  4MCP A;  2DEA A;  1PYT B;  5JGF A;  1LFW A;  4OC4 A;  3PB7 X;  2BO9 A;  2ZEO A;  4PQA A;  2Q43 A;  2PJB A;  1TKJ A;  4NJQ A;  3SI1 A;  4A38 A;  3KL9 A;  4H2K A;  4P6Y A;  4ZX9 A;  5K8M A;  1XFO A;  3TX8 A;  2V8H A;  4TWE A;  1Z2L A;  4RUH A;  5HVG A;  1YSJ A;  1ZG8 A;  4P4D A;  2ZOF A;  4MHN A;  1Z5R A;  1Z8L A;  4DYO A;  2GLJ A;  3FX6 A;  5LYD A;  4MRI A;  4NGP A;  1OBR A;  2XEF A;  3IIB A;  4NGT A;  2WZN A;  3D7H A;  4O23 A;  1IY7 A;  2GRE A;  5ELY A;  4ZX8 A;  2PVV A;  5LYI A;  3GUX A;  4EME A;  4P4J A;  4UEF A;  2ZEL A;  1AYE A;  3KHZ A;  3JRU A;  1HDU A;  1CPS A;  4WWV A;  4PXE A;  4NGN A;  3IC1 A;  1Y7E A;  1FT7 A;  3V7Z A;  3KQZ A;  3N5F A;  3CDX A;  2F8H A;  3CT9 A;  3WC6 A;  2ZOG A;  2ZEM A;  4F9U A;  2AFO A;  2AFS A;  2ZEP A;  3D67 A;  1YW4 A;  1TF9 A;  3KQX A;  3PB8 X;  2ZEF A;  1CPX A;  4ZYQ A;  3CPX A;  4R76 A;  5D8N A;  1HEE A;  1LOK A;  2OR4 A;  3IEH A;  4Q7A A;  2ZEE A;  1RTQ A;  4P45 A;  1ELM P;  4FUU A;  2PJ4 A;  2PJ5 A;  1XRY A;  3PBB A;  2ANP A;  2C1C A;  2J9A A;  2JEW A;  5D29 A;  3MRU A;  1XJO A;  3IJ3 A;  1LCP A;  1F2P A;  3HUV A;  4P44 A;  3K2K A;  1M4L A;  4IAV A;  3FVL A;  4GM5 A;  2PJ0 A;  1BAV A;  2ZEG A;  4A39 A;  3SI2 A;  1YLO A;  2NYQ A;  5K8P A;  1DTD A;  2I3C A;  4OC3 A;  4P4E A;  1CX8 A;  4ZY1 A;  3DLJ A;  1CG2 A;  3NH4 A;  3GB0 A;  3GLJ A;  3WAB A;  2CTB A;  2XEJ A;  2XEI A;  3FH4 A;  4A94 A;  3WC5 A;  1XMB A;  5K8N A;  4OC5 A;  3BI0 A;  4NGQ A;  4KSI A;  4Z65 A;  5CBM A;  3RZA A;  3TC8 A;  2HC9 A;  2Q51 A;  5LRG A;  3S9M A;  2Q4Z A;  4MHZ A;  4PXB A;  4MXU A;  1LAM A;  4OC0 A;  1R43 A;  3FED A;  4OC2 A;  2C6C A;  3WT4 A;  2PJ6 A;  3K9T A;  1DE4 C;  2ZEH A;  3NH8 A;  3H8F A;  2PCU A;  3VAT A;  1VHE A;  4PXD A;  3PRT A;  5LRJ A;  1VIX A;  4NJR A;  1ELL P;  4A37 A;  3FF3 A;  3BHX A;  1LAP A;  3NA6 A;  5THW A;  1TKH A;  3PB9 X;  1Y0R A;  3B3S A;  2PJA A;  3DGV A;  4OP4 A;  4X2T A;  3NFZ A;  2PIZ A;  2O53 A;  4UEZ A;  4BD9 A;  3FMC A;  3LMS A;  1TF8 A;  1ARL A;  4DUK A;  4F8Z A;  1CBX A;  1IGB A;  3BXM A;  4P4B A;  3RBU A;  2IMO A;  2JBK A;  2V77 A;  2PIY A;  4B6Z A;  3KR5 A;  2PJ3 A;  6CPA A;  1LAN A;  3PB4 X;  1TKF A;  4P4F A;  4OME A;  3SJX A;  2PE3 A;  2BCO A;  3B3T A;  3PB6 X;  3SJE A;  2C6P A;  2PVW A;  2NSM A;  4UF4 A;  4WJB A;  4OIW A;  3B7I A;  4FAI A;  2ABZ A;  1ARM A;  3D4U A;  3B2Y A;  3SJG A;  2ZEN A;  3QNV A;  1EE3 P;  2OOT A;  3D66 A;  2GU2 A;  2V8D A;  4LQG A;  3VAR A;  3T8W A;  4R6T A;  3FEE A;  1XBU A;  3D7F A;  4DJL A;  2CIJ A;  1Q7L A;  2CF4 A;  1Y0Y A;  4X8I A;  3V38 A;  4NFR A;  5I4M A;  3MN8 A;  4ZI6 A;  2PRQ A;  2HB6 A;  1GYT A;  4PXC A;  2JBJ A;  1ZG9 A;  3RAM A;  4OID A;  4ZY2 A;  2O4H A;  3CPA A;  1AMP A;  3PBE A;  2V8G A;  1ZG7 A;  2IQ6 A;  2QVP A;  3BI1 A;  4UIA A;  3IFE A;  2AFW A;  4MCR A;  4NGM A;  4ONW A;  4EWT A;  1BLL E;  5K8O A;  1CP6 A;  1KWM A;  2C6G A;  2PJ7 A;  5LYF A;  4MHY A;  1YW6 A;  4UEE A;  2PJ8 A;  3B3C A;  3IO1 A;  1H8L A;  1ZLI A;  2AFZ A;  5IB9 A;  4MMO A;  2XEG A;  2AFX A;  1ZLH A;  2EWB A;  3KHX A;  2PJ1 A;  3B3W A;  3PFO A;  1NSA A;  3B3V A;  4MCS A;  4X3R A;  4P4I A;  3I1U A;  5LRK A;  3NH5 A;  4R7M A;  1F57 A;  4FWU A;  1UWY A;  3H8E A;  5JH9 A;  2CTC A;  3D68 A;  2F7V A;  4R8F A;  4AXV A;  8CPA A;  4IK2 A;  7CPA A;  3FJU A;  4NGR A;  3IWW A;  4CPA A;  1HDQ A;  4ZY0 A;  4JZ0 A;  3S9L A;  4FBE A;  1VGY A;  5F09 A;  3KAS A;  3PEI A;  3VH9 A;  4G1P A;  2G9D A;  3SJF A;  2GLF A;  3D7G A;  2BOA A;  2AFM A;  4IHM A;  1JQG A;  4OKO A;  3KR4 A;  3LWU A;  2FVG A;  4EFD A;  3S9N A;  3D7D A;  1BPN A;  3PFE A;  2PJC A;  1BPM A;  4W9Y A;  2EK8 A;  4TNU A;  1F2O A;  2WYR A;  4MCQ A;  3ISZ A;  2ZED A;  5LYL A; 
#chains in the Genus database with same CATH topology
 1A2Z A;  5AG7 A;  5HVF A;  2Z3M A;  2EK9 A;  1Q2C A;  1S7N A;  1QST A;  3HLP A;  4NXY A;  2Z3O A;  3KI9 A;  4OC1 A;  4PPZ A;  4YU9 A;  2J8R A;  2PJ2 A;  2V8V A;  3LAC A;  1TXR A;  1FNO A;  2Q7S A;  4MHP A;  3VWD A;  1QQ9 A;  3DR6 A;  1BO4 A;  3TE4 A;  2POK A;  2B5G A;  3SI0 A;  1P4N A;  4I49 A;  4MY3 A;  2AFU A;  2Z3L A;  4UCP A;  5DS0 A;  3H8G A;  3SXO A;  1CP7 A;  1N71 A;  4XPL A;  5HXD A;  5ISV A;  1PCA A;  4YWY A;  3R96 A;  5JM6 A;  3EFA A;  1NSL A;  2VL1 A;  4K3N A;  2Q4V A;  1R3N A;  2WPX A;  5CPA A;  3R1K A;  4CAE A;  4P10 A;  2RFH A;  5HVH A;  4E0A A;  2QJ8 A;  4Q36 A;  4H89 A;  2EUI A;  2IJZ A;  2QYV A;  3ISX A;  3IU2 A;  1S5K A;  2QML A;  5DWM A;  4F9V A;  3B35 A;  4JYW A;  1M4D A;  1OZP A;  1VHO A;  1YME A;  2PJ9 A;  4KLV A;  4KSF A;  4NGS A;  2BUE A;  4ORF A;  4AG9 A;  3KGQ A;  3TCV A;  4YRH A;  2R8V A;  2JDD A;  2Q04 A;  4E8O A;  4C7H A;  1CM0 A;  3BJ7 A;  3L2N A;  1XF8 A;  4UFV A;  5A28 A;  2D4P A;  1QMU A;  4UIB A;  2PRB A;  2PR8 A;  2RB7 A;  5AG5 A;  3WC7 A;  3KZW A;  5J1Q A;  4MCP A;  2DEA A;  1PYT B;  3I9S A;  3TO9 A;  4MI4 A;  2YND A;  5JGF A;  2VZZ A;  3I3G A;  2DPS A;  5HMN A;  5BWA B;  1LFW A;  4J3G A;  4OC4 A;  3PB7 X;  4QUS A;  4CAF A;  2BO9 A;  2BEI A;  4KS9 A;  4FD5 A;  2ZEO A;  4PQA A;  5H84 A;  3RNZ A;  2Q43 A;  2PJB A;  3B8G A;  1TKJ A;  4KOY A;  4NJQ A;  3SI1 A;  4AG7 A;  2CNM A;  2R98 A;  4A38 A;  2WUU A;  1PU9 A;  3FYN A;  3KL9 A;  4H2K A;  4P6Y A;  4ZX9 A;  1XFO A;  3RYO A;  3TX8 A;  2V8H A;  4QB9 A;  4TWE A;  1IU8 A;  1Z2L A;  4RUH A;  5HVG A;  1Z9U A;  3IWE A;  4GS4 A;  4M6H A;  3N7Z A;  2BSW A;  2X7B A;  1YSJ A;  2ATR A;  2VQY A;  1ZG8 A;  5HH1 A;  4B5O A;  3GYA A;  4U9Z A;  4P4D A;  2ZOF A;  4MHN A;  2YNC C;  2J8M A;  3P2F A;  2FL4 A;  2OZG A;  3BLN A;  1Z5R A;  4KVX A;  1B87 A;  3S6F A;  3T90 A;  4B5P B;  1Z8L A;  2P6G A;  4AVC A;  4PSW A;  3S6K A;  5EBV A;  4DYO A;  4NEX A;  4U9Y A;  2GLJ A;  4UCM A;  3FX6 A;  5AG4 A;  5LYD A;  4MRI A;  5G1Z A;  5AGE A;  1ZO0 A;  4AB7 A;  2Y0M A;  4KUB A;  4KSA A;  2CXA A;  3H5Z A;  4NGP A;  4RN7 A;  1OBR A;  2OB0 A;  2XEF A;  4MFQ A;  3IIB A;  3CXP A;  4CYP A;  4KOT A;  1Y9K A;  1U6M A;  4NGT A;  2WZN A;  2Z3K A;  1QSR A;  3D7H A;  4LQ6 A;  1IY7 A;  2GRE A;  4O23 A;  5ELY A;  4ZX8 A;  2PVV A;  2ZED A;  5LYI A;  3R9G A;  3NE7 A;  3GUX A;  4LX9 A;  4EME A;  4CGN A;  4P4J A;  2PDO A;  1XEB A;  2YNC A;  1RXT A;  4L89 A;  2ZEL A;  4UEF A;  3SXN A;  5JQ4 A;  2ZXV A;  1AYE A;  3KHZ A;  1XOV A;  3JRU A;  5C88 A;  1HDU A;  3W91 A;  1YGH A;  3GKR A;  1CPS A;  4NF1 A;  2KCW A;  2GE3 A;  4WWV A;  2EO8 A;  3NE8 A;  2A4N A;  4PXE A;  2FSR A;  2VXK A;  1TIQ A;  2RC4 A;  1M44 A;  4II9 A;  4NGN A;  3K9U A;  4H6U A;  1BOB A;  1QSN A;  1QSO A;  4KOX A;  4KVO E;  4CAX A;  1IB1 E;  2FCK A;  2GIV A;  1Y7E A;  3IC1 A;  1FT7 A;  3V7Z A;  3KQZ A;  4B14 A;  3N5F A;  3CDX A;  2F8H A;  1J4J A;  2G3A A;  3CT9 A;  2ZOG A;  5G21 A;  2ZEM A;  3WC6 A;  1AUG A;  4F9U A;  3RO0 A;  3V8I A;  1Q2Y A;  2F5I A;  2AFO A;  4PK2 A;  4M3S A;  4HNW B;  4YGO A;  4U5Y A;  3VWE A;  2AFS A;  2ZEP A;  3D67 A;  4OAE A;  1YW4 A;  4KOV A;  3MGD A;  1TF9 A;  2Z3N A;  3P2H A;  1NE9 A;  1KZF A;  3FBU A;  1SQH A;  2EVN A;  4KZT A;  4CYN A;  3KQX A;  3DR8 A;  2Z10 A;  2D4O A;  4KOS A;  3UY5 A;  3PB8 X;  2FXF A;  2ZEF A;  1IOF A;  1CPX A;  5KTC A;  4ZYQ A;  3CPX A;  4R76 A;  5D8N A;  1HEE A;  3E0K A;  4JJX A;  2HV2 A;  1LOK A;  2HQY A;  4UFW A;  1YVO A;  4A31 A;  2OR4 A;  3IEH A;  4Q7A A;  3CXQ A;  3PZJ A;  4M6G A;  4A33 A;  2R7H A;  2ZEE A;  5H86 A;  4RS2 A;  1XE4 A;  1RTQ A;  4P45 A;  1ELM P;  4FUU A;  2PJ4 A;  2O28 A;  2PJ5 A;  1XRY A;  2VEZ A;  3ZZI A;  3PBB A;  2ANP A;  2Q7B A;  2C1C A;  2J9A A;  2JEW A;  5D29 A;  3DDD A;  3MRU A;  3G3S A;  1XJO A;  5IV0 A;  3IJ3 A;  1ON0 A;  1LCP A;  1IYL A;  1F2P A;  2J8N A;  3HUV A;  1YLE A;  2Q0Y A;  4HNY B;  4C2Y A;  4P44 A;  3K2K A;  1X10 A;  4R3K A;  4NSQ A;  1M4L A;  4L8A A;  4IAV A;  1UFH A;  1Z4E A;  3FVL A;  4GM5 A;  1GHE A;  2PJ0 A;  1BAV A;  2ZEG A;  4A39 A;  3SI2 A;  4CRZ B;  1Y7R A;  1YLO A;  1M4I A;  2K5T A;  2NYQ A;  2Z11 A;  5K8P A;  1DTD A;  2I3C A;  2VI7 A;  4OC3 A;  4P4E A;  4B12 A;  1CX8 A;  2C27 A;  1V0C A;  4CAV A;  4CGL A;  4ZY1 A;  2ZW5 A;  3DLJ A;  3IU1 A;  4F6A A;  1CG2 A;  2AE6 A;  3GB0 A;  3NH4 A;  3GLJ A;  3WAB A;  1IOI A;  2CTB A;  2XEJ A;  4UA3 A;  2XEI A;  3FH4 A;  3TTH A;  5EMI A;  5C82 A;  4A94 A;  3WC5 A;  5J8F A;  1XMB A;  4C2X A;  4OC5 A;  5K8N A;  2P0W A;  4CAW A;  3JTK A;  1IID A;  3BI0 A;  5IB0 A;  2ZW7 A;  4MCQ A;  4CGM A;  3D3S A;  4NGQ A;  5IX3 A;  3ZJ0 A;  5E96 A;  3LD2 A;  4KSI A;  4LUA A;  4B5P A;  4Z65 A;  4HKF A;  3RZA A;  5A27 A;  3TC8 A;  5CBM A;  2HC9 A;  2Q51 A;  4KUA A;  5J8C A;  5LRG A;  3S9M A;  5G22 A;  2Q4Z A;  4F0Y A;  1MK4 A;  4MHZ A;  4PXB A;  4MXU A;  1LAM A;  1M1D A;  4OC0 A;  1R43 A;  2R1I A;  4RI1 A;  3FED A;  3IWG A;  3G8W A;  4OC2 A;  1QSM A;  2C6C A;  3S6G A;  2H5M A;  4AVB A;  4UCN A;  2PJ6 A;  3DNS A;  3WT4 A;  4PSX A;  5G20 A;  4Q38 A;  3QAH A;  3JUW A;  3K9T A;  1DE4 C;  2ZEH A;  3F0A A;  4UFX A;  4Y49 B;  5KTD A;  1Z8T A;  4K30 A;  4MFZ A;  3NH8 A;  4KVM E;  1M4G A;  3H8F A;  2PCU A;  3VAT A;  3QB8 A;  1VHE A;  4PXD A;  3PRT A;  3EXN A;  5LRJ A;  1VIX A;  2EBJ A;  1ELL P;  4NJR A;  4A37 A;  3TFY A;  1S60 A;  3FF3 A;  3BHX A;  1LAP A;  3KKW A;  3NA6 A;  5THW A;  1TKH A;  2G3T A;  4BBH A;  3PB9 X;  1Y0R A;  3EC4 A;  4CGO A;  4EVY A;  5F46 A;  3TOA A;  4MFK A;  3B3S A;  4JXQ A;  4ZGY B;  2PJA A;  3DSB A;  2OZU A;  2Q4Y A;  3DGV A;  4MFJ A;  4OP4 A;  4X2T A;  3NFZ A;  2PIZ A;  2O53 A;  1IIC A;  4UEZ A;  4BD9 A;  3FMC A;  1FY7 A;  3LMS A;  1TF8 A;  1ARL A;  1CJW A;  3PP9 A;  1CBX A;  3FNC A;  4DUK A;  1MJB A;  5DWN A;  4F8Z A;  1IGB A;  3BXM A;  4P4B A;  4MBU A;  3R9F A;  3RBU A;  2IMO A;  2JBK A;  2Q44 A;  5F49 A;  2ODF A;  2JDC A;  1VKC A;  2YGW A;  4PK3 A;  2V77 A;  1WWZ A;  2PIY A;  3JVN A;  5GCN A;  2VBQ A;  4B6Z A;  4CS0 B;  3KR5 A;  2PJ3 A;  3FXT A;  4B11 A;  4E2A A;  5CNP A;  6CPA A;  1LAN A;  3PB4 X;  4JXR A;  1TKF A;  2OU2 A;  4A2Z A;  5JPH A;  4P4F A;  4OME A;  4ONU A;  5K8M A;  2Z0Z A;  5I0C A;  3SJX A;  3D2P A;  4HPS A;  4X5K A;  2PE3 A;  2FT0 A;  2BCO A;  3B3T A;  4AVA A;  3PB6 X;  4A95 A;  1S7F A;  2B3V A;  4H6Z A;  3SJE A;  2C6P A;  4QC6 A;  4JD6 A;  3W6S A;  2PVW A;  3CZX A;  4XNH B;  2Z3P A;  1Z8W A;  1XIX A;  2NSM A;  4UF4 A;  4QVT A;  2P6E A;  3TOB A;  2PC1 A;  4WJB A;  2PR1 A;  4OIW A;  3B7I A;  4R87 A;  2FE7 A;  3TO6 A;  2DXQ A;  2ABZ A;  4OAD A;  2GFQ A;  1ARM A;  3WR7 A;  4FAI A;  3D4U A;  1I12 A;  2JEV A;  3B2Y A;  1YR0 A;  2AJ6 A;  3SJG A;  3TT2 A;  1KUX A;  4IF5 A;  5F48 A;  4MFL A;  2ZW6 A;  2ZEN A;  3QNV A;  1EE3 P;  2OOT A;  2OZH A;  4CYQ A;  4R9M A;  3D66 A;  4FD6 A;  2GU2 A;  3S6H A;  1JWQ A;  4GXH A;  2V8D A;  4NCZ A;  4LQG A;  3VAR A;  3T8W A;  3IGR A;  4R6T A;  3FEE A;  4CRY B;  1XBU A;  2I00 A;  4KLW A;  4FD4 A;  3D7F A;  3A9L A;  2DPT A;  4DJL A;  1VHS A;  3FIX A;  1X12 A;  2B5G B;  2GAN A;  2CIJ A;  2YNE A;  1Q7L A;  2CF4 A;  4XPD B;  4UWJ A;  1Y0Y A;  4X8I A;  3V38 A;  4NFR A;  3EY5 A;  3TO7 A;  3F8K A;  4A32 A;  5I4M A;  4JLY A;  3MN8 A;  4ZI6 A;  2PRQ A;  5LYL A;  2HB6 A;  1GYT A;  4PXC A;  1NMT A;  2JBJ A;  4Y49 C;  1ZG9 A;  2FIA A;  2REE A;  3RAM A;  3GY9 A;  4OID A;  4ZY2 A;  2O4H A;  3CPA A;  1I21 A;  1AMP A;  3QAY A;  3FRM A;  3PBE A;  2V8G A;  4BMH A;  1YRE A;  1KUV A;  1ZG7 A;  2IQ6 A;  4KOR A;  2P6F A;  4YFJ A;  2QVP A;  2ARH A;  3BI1 A;  4UIA A;  3IFE A;  2AFW A;  4KOW A;  4MCR A;  4ONW A;  4NGM A;  5EC4 A;  3F5B A;  4M85 A;  1R57 A;  4EWT A;  1BLL E;  4FD7 A;  5K8O A;  1CP6 A;  1KWM A;  2C6G A;  2PJ7 A;  5LYF A;  4QBJ A;  4MHY A;  1YW6 A;  5F47 A;  2QIR A;  1YX0 A;  4UBR A;  4UEE A;  2B4D A;  2PJ8 A;  3B3C A;  1I1D A;  1KUY A;  1H8L A;  3IO1 A;  1ZLI A;  2AFZ A;  2B4D B;  3D8P A;  2BL1 A;  1IYK A;  4F0X A;  4HNX B;  4UWI A;  4ZBG A;  2WSA A;  2B58 A;  2FS5 A;  1S7L A;  5IB9 A;  2CNS A;  2I79 A;  1YVK A;  2B3U A;  4MMO A;  2XEG A;  3W6X A;  2AFX A;  1ZLH A;  2EWB A;  3KHX A;  2DF5 A;  4R3L A;  2PJ1 A;  5FVJ A;  3B3W A;  3PFO A;  2QEC A;  4MHD A;  1Q2D A;  1NSA A;  3B3V A;  4MCS A;  2HUZ A;  2ZPA A;  1B6B A;  3R9E A;  4DNC A;  4X3R A;  4P4I A;  4B13 A;  3GIU A;  2CNT A;  3I1U A;  5LRK A;  3NH5 A;  1MJA A;  4R7M A;  1F57 A;  4FWU A;  4MY0 A;  1UWY A;  1S7K A;  3H8E A;  4M6I A;  4XNH C;  5JH9 A;  2CTC A;  4IUS A;  3D68 A;  3C26 A;  4XPK A;  2JLM A;  1L0C A;  2FIW A;  2F7V A;  2B4B A;  3OWC A;  4R8F A;  3EO4 A;  4AXV A;  8CPA A;  4BIN A;  4IK2 A;  4MJ8 A;  7CPA A;  1YQE A;  3FJU A;  4NGR A;  4R57 A;  1Z8X A;  2VZY A;  1S3Z A;  3IWW A;  4MFP A;  4CPA A;  2NMT A;  1HDQ A;  5KTA A;  2G0B A;  3LOD A;  4ZY0 A;  2WPW A;  4JZ0 A;  3S9L A;  4JWP A;  2OH1 A;  4FBE A;  1VGY A;  4C68 A;  3KAS A;  5F09 A;  2PSW A;  4OLL A;  3PEI A;  3PGP A;  1XMT A;  3VH9 A;  2IL4 A;  1Z4R A;  2ZW4 A;  4B10 A;  4PV6 A;  4G1P A;  2G9D A;  2REF A;  3SJF A;  2CY2 A;  4KOU A;  4C2Z A;  2GLF A;  4XPD C;  5AG6 A;  3T9Y A;  3D7G A;  2BOA A;  2AFM A;  4IHM A;  3SHP A;  1JQG A;  3CXS A;  3FB3 A;  4OKO A;  3KR4 A;  4CGP A;  1PUA A;  3LWU A;  1K4J A;  2PQ8 A;  2FVG A;  3D2M A;  3BJ8 A;  4EFD A;  3S9N A;  3D7D A;  1BPN A;  4A30 A;  3R95 A;  3PFE A;  2PJC A;  1LRZ A;  1BPM A;  1Y9W A;  4W9Y A;  4C7I A;  1MJ9 A;  1WK4 A;  2EK8 A;  4CYO A;  1P0H A;  1RO5 A;  4TNU A;  1F2O A;  2WYR A;  3FEC A;  3ISZ A;  1YK3 A;  3H4Q A; 
#chains in the Genus database with same CATH homology
 5HVF A;  2EK9 A;  3HLP A;  3KI9 A;  4OC1 A;  4PPZ A;  4YU9 A;  2PJ2 A;  2V8V A;  1TXR A;  1FNO A;  4MHP A;  1QQ9 A;  2POK A;  3SI0 A;  2AFU A;  5DS0 A;  3H8G A;  1CP7 A;  5HXD A;  1PCA A;  4YWY A;  5JM6 A;  2VL1 A;  4K3N A;  1R3N A;  5CPA A;  5HVH A;  4P10 A;  2RFH A;  2QJ8 A;  2IJZ A;  2QYV A;  3ISX A;  4F9V A;  3B35 A;  4JYW A;  1VHO A;  1YME A;  2PJ9 A;  4NGS A;  3FEC A;  3KGQ A;  3L2N A;  4UIB A;  1QMU A;  2RB7 A;  3WC7 A;  3KZW A;  5J1Q A;  4MCP A;  2DEA A;  1PYT B;  5JGF A;  1LFW A;  4OC4 A;  3PB7 X;  2BO9 A;  2ZEO A;  4PQA A;  2Q43 A;  2PJB A;  1TKJ A;  4NJQ A;  3SI1 A;  4A38 A;  3KL9 A;  4H2K A;  4P6Y A;  4ZX9 A;  5K8M A;  1XFO A;  3TX8 A;  2V8H A;  4TWE A;  1Z2L A;  4RUH A;  5HVG A;  1YSJ A;  1ZG8 A;  4P4D A;  2ZOF A;  4MHN A;  1Z5R A;  1Z8L A;  4DYO A;  2GLJ A;  3FX6 A;  5LYD A;  4MRI A;  4NGP A;  1OBR A;  2XEF A;  3IIB A;  4NGT A;  2WZN A;  3D7H A;  4O23 A;  1IY7 A;  2GRE A;  5ELY A;  4ZX8 A;  2PVV A;  5LYI A;  3GUX A;  4EME A;  4P4J A;  4UEF A;  2ZEL A;  1AYE A;  3KHZ A;  3JRU A;  1HDU A;  1CPS A;  4WWV A;  4PXE A;  4NGN A;  3IC1 A;  1Y7E A;  1FT7 A;  3V7Z A;  3KQZ A;  3N5F A;  3CDX A;  2F8H A;  3CT9 A;  3WC6 A;  2ZOG A;  2ZEM A;  4F9U A;  2AFO A;  2AFS A;  2ZEP A;  3D67 A;  1YW4 A;  1TF9 A;  3KQX A;  3PB8 X;  2ZEF A;  1CPX A;  4ZYQ A;  3CPX A;  4R76 A;  5D8N A;  1HEE A;  1LOK A;  2OR4 A;  3IEH A;  4Q7A A;  2ZEE A;  1RTQ A;  4P45 A;  1ELM P;  4FUU A;  2PJ4 A;  2PJ5 A;  1XRY A;  3PBB A;  2ANP A;  2C1C A;  2J9A A;  2JEW A;  5D29 A;  3MRU A;  1XJO A;  3IJ3 A;  1LCP A;  1F2P A;  3HUV A;  4P44 A;  3K2K A;  1M4L A;  4IAV A;  3FVL A;  4GM5 A;  2PJ0 A;  1BAV A;  2ZEG A;  4A39 A;  3SI2 A;  1YLO A;  2NYQ A;  5K8P A;  1DTD A;  2I3C A;  4OC3 A;  4P4E A;  1CX8 A;  4ZY1 A;  3DLJ A;  1CG2 A;  3NH4 A;  3GB0 A;  3GLJ A;  3WAB A;  2CTB A;  2XEJ A;  2XEI A;  3FH4 A;  4A94 A;  3WC5 A;  1XMB A;  5K8N A;  4OC5 A;  3BI0 A;  4NGQ A;  4KSI A;  4Z65 A;  5CBM A;  3RZA A;  3TC8 A;  2HC9 A;  2Q51 A;  5LRG A;  3S9M A;  2Q4Z A;  4MHZ A;  4PXB A;  4MXU A;  1LAM A;  4OC0 A;  1R43 A;  3FED A;  4OC2 A;  2C6C A;  3WT4 A;  2PJ6 A;  3K9T A;  1DE4 C;  2ZEH A;  3NH8 A;  3H8F A;  2PCU A;  3VAT A;  1VHE A;  4PXD A;  3PRT A;  5LRJ A;  1VIX A;  4NJR A;  1ELL P;  4A37 A;  3FF3 A;  3BHX A;  1LAP A;  3NA6 A;  5THW A;  1TKH A;  3PB9 X;  1Y0R A;  3B3S A;  2PJA A;  3DGV A;  4OP4 A;  4X2T A;  3NFZ A;  2PIZ A;  2O53 A;  4UEZ A;  4BD9 A;  3FMC A;  3LMS A;  1TF8 A;  1ARL A;  4DUK A;  4F8Z A;  1CBX A;  1IGB A;  3BXM A;  4P4B A;  3RBU A;  2IMO A;  2JBK A;  2V77 A;  2PIY A;  4B6Z A;  3KR5 A;  2PJ3 A;  6CPA A;  1LAN A;  3PB4 X;  1TKF A;  4P4F A;  4OME A;  3SJX A;  2PE3 A;  2BCO A;  3B3T A;  3PB6 X;  3SJE A;  2C6P A;  2PVW A;  2NSM A;  4UF4 A;  4WJB A;  4OIW A;  3B7I A;  4FAI A;  2ABZ A;  1ARM A;  3D4U A;  3B2Y A;  3SJG A;  2ZEN A;  3QNV A;  1EE3 P;  2OOT A;  3D66 A;  2GU2 A;  2V8D A;  4LQG A;  3VAR A;  3T8W A;  4R6T A;  3FEE A;  1XBU A;  3D7F A;  4DJL A;  2CIJ A;  1Q7L A;  2CF4 A;  1Y0Y A;  4X8I A;  3V38 A;  4NFR A;  5I4M A;  3MN8 A;  4ZI6 A;  2PRQ A;  2HB6 A;  1GYT A;  4PXC A;  2JBJ A;  1ZG9 A;  3RAM A;  4OID A;  4ZY2 A;  2O4H A;  3CPA A;  1AMP A;  3PBE A;  2V8G A;  1ZG7 A;  2IQ6 A;  2QVP A;  3BI1 A;  4UIA A;  3IFE A;  2AFW A;  4MCR A;  4NGM A;  4ONW A;  4EWT A;  1BLL E;  5K8O A;  1CP6 A;  1KWM A;  2C6G A;  2PJ7 A;  5LYF A;  4MHY A;  1YW6 A;  4UEE A;  2PJ8 A;  3B3C A;  3IO1 A;  1H8L A;  1ZLI A;  2AFZ A;  5IB9 A;  4MMO A;  2XEG A;  2AFX A;  1ZLH A;  2EWB A;  3KHX A;  2PJ1 A;  3B3W A;  3PFO A;  1NSA A;  3B3V A;  4MCS A;  4X3R A;  4P4I A;  3I1U A;  5LRK A;  3NH5 A;  4R7M A;  1F57 A;  4FWU A;  1UWY A;  3H8E A;  5JH9 A;  2CTC A;  3D68 A;  2F7V A;  4R8F A;  4AXV A;  8CPA A;  4IK2 A;  7CPA A;  3FJU A;  4NGR A;  3IWW A;  4CPA A;  1HDQ A;  4ZY0 A;  4JZ0 A;  3S9L A;  4FBE A;  1VGY A;  5F09 A;  3KAS A;  3PEI A;  3VH9 A;  4G1P A;  2G9D A;  3SJF A;  2GLF A;  3D7G A;  2BOA A;  2AFM A;  4IHM A;  1JQG A;  4OKO A;  3KR4 A;  3LWU A;  2FVG A;  4EFD A;  3S9N A;  3D7D A;  1BPN A;  3PFE A;  2PJC A;  1BPM A;  4W9Y A;  2EK8 A;  4TNU A;  1F2O A;  2WYR A;  4MCQ A;  3ISZ A;  2ZED A;  5LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...