1FUJA

Pr3 (myeloblastin)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
221
Chain Sequence
IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDILLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase (serine protease)
molecule keywords PR3
total genus 45
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.76: Myeloblastin.
pdb deposition date 1996-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fujA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fujA02
1A0LA 4X8SH 1T8MA 1IQNA 1HPGA 2A45B 3M3VA 5DP8A 5F8XA 2OQUA 3MO9A 2H9EH 3RXKA 3STJA 1KDQA 1NRPH 4I8HA 2OINA 1L0ZA 5HMAA 3A88A 1QQ4A 1TPAE 3UR9A 3BTQE 2Q6GA 1HLTH 1W8BH 2QAAA 1O2NA 1SI5H 2EI7A 1GHYH 5JBAS 1GJCB 2BQ7B 2Z9IA 4I32A 2PR3A 1C5VA 1S5SA 2FOEA 2G8TA 2HNTF 1GCDA 1XKBC 3R0FA 1LPGB 1SGQE 4CRFA 1OWJA 1BRCE 5BPEA 1GI6A 1HAGE 1O35A 3F9GA 3SZNA 3RU4T 3LU9B 1D3DB 3GY6A 1HJ9A 4E05H 3E0PB 3ZZ8A 2QXHA 2F83A 3MYWA 3URDA 1P2QA 1IOEA 1MBMA 4B2BA 1LDTT 2VH6A 2SGPE 4MPWA 1KY9A 2VIOA 1GBEA 1HCGA 1MKXK 1S84A 1E37B 2BLWA 3MOCA 3RXHA 2CF8H 3VB3A 2AERH 4K1SA 5EU8A 1EZQA 1BMNH 2JETB 1PPGE 2BDIA 1L4ZA 3RM0H 4UONA 4I8LA 4TWWA 1BCUH 2ZDNA 6CHAB 3BN9A 1C2EA 1KXBA 3F6UH 1CU1A 4HI3A 1GBJA 1AU8A 2A5KA 1WYKA 2THFB 4TYDA 3STIA 2VGCC 1GBCA 3C1KA 1GI4A 3FFGA 4Y7AA 1G9IE 1PPCE 4BAMB 5A8YA 3KHVA 1FAXA 4NCYA 2ESTE 1KLIH 1ZR0A 2SGQE 3MO3A 5EG4A 4DOQA 1BBRH 1TGTA 4ABBA 2BD2A 2BTCE 2P8OC 3MNXA 5LPRA 1JIRA 1TIOA 4KTCA 2XBXA 5A8ZA 1BZXE 3T26A 1GI0A 1BTPA 2TRMA 3GYMA 1DM4B 1YPKH 3EQ0H 3DA9B 1G37A 1HNEE 3OTJE 2Y7XA 4YTAA 1BDAA 3BTHE 5I46H 1NS3A 1CT4E 1DUAA 3GY5A 1M9UA 1K1MA 2R2MB 1TPPA 2BZ6H 2ALVA 2BHGA 4AYVB 1C5YB 1HB0B 2NWNA 3SU5A 1C1NA 1DITH 1YPEH 1ABIH 2VNTA 3ZZBA 3QGJA 1K1JA 1WCZA 1C1SA 1AIXH 1FQ3A 3UWJH 1YPJH 3V12A 1O5EH 4O3UA 2AMPA 1LMWB 1EXFA 2VVUA 3GCOA 2O8TA 3LONA 3DHKH 4B2AA 2J2UA 1P12E 2BMGB 2HPPH 1MU8B 1CHOF 1QY6A 4H6TA 4FU9A 2GMTB 2H9HA 1WBGB 2GCHG 2NU1E 4FXGH 2ODYB 4Y11E 4FUJA 4CRCA 3FZZA 4ZKRU 2AIQA 1FN8A 2ANYA 2STBE 2FIRH 4OS1A 3U1JB 1DFPA 1FUJA 2CJIA 1SB1H 1C2GA 4AGJA 1GHAG 2ZP0H 1HAVA 2F91A 1BTHH 1AKSA 1VCQA 3U9AH 1P03A 4NWLA 1WSSH 2CN0H 3AW0A 1GJ9B 3SJ9A 3QWCH 4INKA 3ZVFA 4JZ1A 2Q6DA 1MQ6A 4U32A 4XBCA 4Y8XA 1DT2A 5EPYA 4FU8A 4Y7BA 3U8TH 1GGDC 2V3OH 1QRZA 2A5IA 4ABHA 2ZFFH 3K6YA 1P2NA 3MMGA 3NKKA 4Z0KA 1MCVA 2FS9A 1H1BA 1HJ8A 3UWIA 3TNTA 2ZU2A 1N1LA 1P2MA 3UOPA 2HGTH 4E06H 1E35B 1SVPA 4MPUA 2XWAA 1C5XB 3V13A 3Q77A 2Y82A 1SQAA 3P8NA 1Z71A 7KMEH 1KYNA 1O32A 1H9IE 1HRTH 2ZTYA 4M7GA 4Y6DA 3SORA 2G51A 4DVAU 3PMAB 2ZDKA 1EAIA 2AYWA 2RA3A 1DXPA 2UWLA 3MH6A 4FUCA 1BTUA 4HZHA 4MLFB 5C20A 1C4V2 1W2KH 2BXUH 1MMJN 4CREA 1AB9B 1GBLA 1AI8H 3HKJB 1TLDA 1P04A 3GCHB 1O3BA 1BMLA 1PPEE 1O2SA 3QO6A 1PPZA 2FLBH 3TJNA 1NRSH 1P0SH 4K60A 3HGNA 1DLKB 4YESB 1WOFA 1GBTA 2PSYA 1EJNA 5FBEA 2ZO3H 2HVXA 2J38A 1G2MA 1TBZH 1RXPA 1WTGH 3A80A 3AAUA 3FAOA 2EI8A 1ZYOA 1JOUB 2BY9X 3KEEA 3RMOH 3S7HB 3RLYH 4OS4A 4AFUA 2BLOA 1BRBE 2OP9A 1NTPA 1GBAA 1Z1IA 3TGKE 3BSQA 5FX5A 1MTWA 2ZU3A 4INLA 2A32A 2BD3A 1OPHB 1ZSLA 1JRSA 3GY2A 3CS0A 1HAZB 1VJ9U 4D7FA 1XUHA 2XC0A 2WPJS 1ARBA 3A7YA 4SGAE 1MKWH 3CS7A 5E0HA 2BDHA 5F6MA 1E38B 3RXGA 1ZTKA 3GOVB 3U8OH 4LXBH 3M5NA 1KXFA 4X8VH 4IBLH 2GCTC 3U1IB 5A2MH 2ZU5A 8KME2 1V3XA 2HALA 2KAIA 1YLCA 3K65B 3H5CB 1NY22 4R8TB 1FI8A 2PV9B 2OC7A 4YO9A 3A7XA 3LGYA 2HNTC 2A4QA 1C5TA 4B73A 1C5PA 1HDTH 1TNIA 3A8CA 1TALA 2ZECA 1VCPA 3PO1B 5CE1A 1ELGA 2ZFSA 1C2DA 2Y5FA 2PHBA 5DP3A 1N6YA 4X2YA 3T5FH 3TLOA 2WPMS 1FN6A 4NFEA 3A86A 4GVUA 2FOBA 3KQEA 2GD4B 1LHCH 3VEQB 1W11U 3ZZDA 1TQ7B 1OP8A 3HPTB 3KCGH 1GMHG 3MNCA 1Y5BT 3BTME 1TX7A 2GZ7A 1OSSA 4ABGA 1UK4A 5H4IB 2ZDMA 1OWKA 2FEQH 3RUOA 3T27A 3BIVH 1BBRE 1Z8RA 2QXJA 1S83A 1O0DH 1LVOA 1VR1H 4I8GA 4ISHH 5EXNA 3BTDE 2P3UB 4VGCC 3PM3A 4NIVA 1NU9A 5GCHF 1IQKA 1LO6A 3JZ2B 2F9PA 2ZEBA 1GJAB 1FIWA 2FM2A 4ZXXH 1N8OB 4X0WU 1HV7A 1N8OC 2OQ5A 5FPTA 4AZ2B 4ASHA 1UTNA 2UUKB 1ZMJA 1P11E 1BJVA 1C5RA 4GPGA 4IW4E 1QBOA 4KTUA 3K2UA 2H2ZA 2ZWLH 2XC4A 6ESTA 5A8XA 5CHAC 1LHFH 1XUKA 1OP2A 2ZKSA 1O3KA 4JYTA 1O3LA 1FPHH 2F3CE 1C4U2 4RKJB 1WAYB 2P94A 2RA0A 2Y7ZA 1O3NA 1UTMA 5JYIA 2BM2A 3AASA 1ABJH 1S6FA 3VB7A 1ANCA 2TPIZ 1S6HA 2B0FA 2W7UA 1D6RA 4K8BA 9ESTA 4Y76A 2DE8A 4A6LA 3TK9A 3SV9A 1EB1H 3NK8A 4X1SU 2BD7A 3UR6A 1SGPE 1GBHA 1CE5A 1NFWA 2A4OA 2C8XB 2AS9A 1EKBB 1KLJH 1SGRE 4X2VA 2A7CA 2GTBA 1VZQH 3A89A 2PGQB 4BOHA 1O3IA 3GCHC 1AKSB 3UIRA 2BDYA 1O2LA 1C2JA 3LGUA 1QIXB 2FX6A 1A0HB 1YGCH 2I6QA 3GICB 1CVWH 1SGIB 2RCEA 4X2WA 2Z9KA 1C5SA 1O3CA 3ZZ6A 3N7OA 4O3TA 1ANDA 1SOZA 2XWBI 4K3JA 3QTVH 4NSYA 1ZPZA 1CHOG 5FXLA 1F0RA 1CHGA 1P57B 1OYQA 2EI6A 4OS2A 2H6MA 1A5GH 4XFQA 3M37A 3CP7A 1AFEH 3GCTG 4I33A 3A82A 2ZGBH 1O2OA 4X8UH 1E0FD 3ZZ9A 4LOYH 2FX4A 1UO6A 3BEFB 3SU0A 4D7GA 3SOSA 2WPLS 3KQBA 2GDDA 2ZG0H 4BNRA 3SUDA 1BHXF 5C2ZA 2NU2E 4X2XA 4JMYA 3BTEE 1MD8A 1OWDA 3GY3A 1RD3B 3MU5A 3OU0A 5CMXH 2ZTXA 3SJOA 4B71A 1GI9B 1KIGH 4SGBE 1CGJE 1V2OT 3SO3A 1FMGA 1ZHMA 1SL3A 1MU6B 3UFAA 3MHWU 1Y3YA 1JXPA 1BTWA 1QTFA 1MBQA 1EPTC 2A31A 3UY9A 4MVNA 4JZFH 1RIWB 1F0UA 1HAHH 1AY6H 1ELVA 1ARCA 1C1OA 4JYUH 1TNKA 3OSYA 3QUMP 3MNSA 1PQAA 1UTPA 3BG4B 4GHQA 1TONA 2RDLA 2YOLA 3SGAE 1THRH 4AG2A 5DP7A 2J4IA 4D9RA 1SBWA 2W3IA 1YPMH 1ELBA 3ATMA 1QBNA 2C93B 1BTZA 1X7AC 2QF3A 2OLGA 2TGAA 3LGVA 1DS2E 2XBWA 1K1OA 3FANA 4DIHH 3NXPA 4IMZA 1HXEH 1TABE 1YPHE 1K28D 5FCRA 1YCPH 5C67A 3H7OA 1C5LH 4FUEA 5GPIB 3BV9B 2ZA5A 1J14A 1HGTH 1DWEH 1GHWH 3ATWA 3ITIA 2G52A 1AUJA 3P95A 2LPRA 1BMMH 2BDAA 1J9CH 4VGCB 1FIZA 2W26A 1IQMA 5DP9A 3GDUA 1BTXA 1C5WB 2ZFTA 3Q3KA 1PPBH 1QURH 1TOMH 5DKMA 3S9AA 2IPHA 3TITA 6CHAC 3OYPA 1QHRB 3KNXA 1XVMA 3UNSA 1IQJA 3ZZ3A 1YLDA 4I31A 4I7YH 2P3TB 5E2OA 3DT0H 4IC5A 2JH6D 1TOCB 1C5MD 3A7WA 3EYDA 5AFYH 2GZ8A 1NM6A 1ZJKA 3PLKA 1BRAA 2Q1JA 4KGAA 1EZXC 3RXBA 2BY8X 1P10A 3QZRA 1TE0A 2ZCLP 3HK6B 1RJXB 1SQOA 4ZKSU 3RXJA 4ISIH 5DJ7A 1ZRBA 3BTFE 3E8LA 4UD9H 4YZUA 3UNRA 1GDUA 4F4OC 1BA8B 1ETTH 1HIAB 3EA7A 3GCTF 1DY8A 1C1RA 1C4Y2 1NO9H 2B8OH 1Q2WA 4NGAH 1HAXB 1RTKA 1G32B 1YPGH 1TNLA 3FVFB 2OD3B 2DUCA 1QRWA 1O2QA 4ISOA 4BXSA 3ZVGA 2JH0D 2OC1A 1P2JA 4K69A 1EJMA 4O9VA 1INCA 3VGCC 3VPKA 5FPYA 4FUFA 4CRAA 3LGWA 1ETSH 1V2ST 3PWCA 1JMOH 4I8JA 5T3HA 3PO1C 3SI4H 1T4VH 2XW9A 2HWLB 1W7XH 2W7SA 1HIAA 4CBNA 4Y0YE 3RXLA 1T8OA 4GCHF 2VWLA 1QQUA 3RXTA 1KDQB 1O3MA 1O2VA 2EA3A 2BVRH 2WV5A 1ESTA 3E90B 2VIPA 1TNHA 2GX4A 1WTHD 4OGXA 4BTTB 1ZJDA 2BY6X 3P8GA 4NA7A 1GJBB 3P70B 5C5OA 1QB1A 4WVPE 1F7ZA 2ZHFH 1GHVH 4Y71A 1A4WH 1O2JA 5LH8A 2W5EA 1S0QA 3RU4D 1EASA 1TGSZ 2J94A 3ZZ4A 2TIOA 4DJZB 4Y8ZA 1V2WT 4NIXA 2FLRH 1LVYA 1GVLA 2ZQ1A 1GJ6A 3SHCH 4KP0A 2BVXH 1BQYA 1QR3E 1RTFB 3SUFA 1AQ7A 1VGCB 3RXFA 1HJAB 7LPRA 4AFSA 3TGJE 2GGVB 3RM2H 1QJ1B 1LVMA 1XUFA 1KLTA 1XMNB 4HTCH 1RRKA 3MNBA 2D8WA 4ZHLU 3ELAH 2J95A 1GWAA 3SU6A 1C1QA 2CMYA 3AW1A 2ALPA 3M5MA 1SMFE 2BQ6B 3U8RH 1PFXC 1MCTA 5E8EH 2H5DA 3QGNB 4B2CA 7ESTE 1O2ZA 1TX8A 2FXRA 2VIQA 4I8KA 1K1IA 2ZI2H 4THNH 3SNBA 1MQ5A 4GSOA 4CRGA 5FHTA 2GVFA 1GMCG 4WJG2 2ZHWH 1YPLH 4NIWA 3SN8A 1UTOA 1UCYE 2ZU1A 5PTPA 1BOQA 2ZGHA 3UOUA 5FX6A 1Z8GA 1AWFH 5EXMA 1SGNE 4K1TA 1L1GA 2PLXA 3SV7A 4ISNA 2ZPQA 4X1PU 2AGGX 1O2TA 1K22H 1O31A 3MH7A 5GJ4B 2ZCHP 3SNAA 2V3HH 2Z94A 4TWYA 3SV6A 1LHDH 4IS5A 5LPEA 2D2DA 1O3FA 1L1JA 2A0QB 3RXQA 1A5IA 1V2NT 1UTJA 1P8VC 5HYOA 4YT7H 1N6XA 1YCPM 3T2NA 2ZGXH 4GCHG 3ATKA 4NA8A 2AEIH 4MQAA 3TNSA 3SW2B 5GCHG 2O9QA 4CH2B 1QA7A 1BHXB 1PJPA 1O5AB 1Z8JB 4MG3A 3V3MA 1O3HA 2QGRA 1TB6H 7GCHG 6LPRA 2OC8A 1CSOE 1J8AA 2TGPZ 1D3TB 1YCPK 3AVZA 2SGEE 4MDSA 1NROH 2QYIA 3DFLA 4GLYA 1DANH 1Z1JA 3RC5A 1O2PA 2P93A 1CBWC 3P8OA 3B8JA 1QNJA 2J34A 3VB6A 3TVJB 2AGEX 5T6DA 4KTSA 1K1PA 1ANEA 4OS6A 1WUNH 3A87A 1JWTA 5FPSA 2QC2A 3LGIA 4A1VA 1O5BB 4E7NA 4FVDA 3E3TA 1XUJA 1FDPA 4UFFH 1JRTA 2IOTA 1DWCH 1TX6A 1CGIE 4AFZA 2ZU4A 2SGAA 5JBTA 2ZPSA 2WYGA 3SU4A 3ZYDA 2C90B 3QX5H 2ASUB 2Y80A 4H6SB 2QXIA 4ZMAH 3I78A 1GGDB 4JYVH 2ULLA 1ZHRA 1C2HA 3B9FH 1UK3A 2IN2A 1Z6EA 2WYJA 1FY4A 2C8ZB 1C5NH 3BTTE 3JZ1B 2XRCA 1VJAU 3A8AA 1SHHB 2ZHDA 3P17H 2ZHEH 3GDSA 1YC0A 2VIDA 2FODA 4JCNA 2XBVA 2HNTE 1LPKB 3PROA 1ANBA 1DXWA 2F9VA 1O2HA 3PB1E 5AHGH 1AFQC 2FOCA 1ZMLA 3UNQA 1W10U 2C8WB 2C8YB 4DIIH 1FLEE 2OCVB 4UEHH 1A46H 5A0AE 1DY9A 4MNYA 3SHAH 3L6PA 1CO7E 1NN6A 3U69H 3M35A 2FOFA 1S0RA 3ODDA 3ZZ7A 1THPB 3D49H 4CH8B 2ZZUH 2STAE 1YP9A 4WXVA 4LZ1H 1GCTB 2FPZA 3E91A 1KXEA 1A2CH 4UFGH 3S0NA 2QF0A 3T62A 2PTNA 1SGTA 1NRRH 3MH5A 2ILNA 1EPTA 1AB9C 4A7IB 4D76A 1CT0E 1GBIA 3LIWA 1FAKH 3SU2A 3MI4A 3FP8E 4LK4A 4BAHB 2EEKA 1LHGH 4FUGA 1Z6JH 4ABJA 3LJJA 1O38A 4ISLA 1EX3A 1G2LA 1IHSH 2PKSB 1OP0A 1BBRK 1DWBH 2BXTH 1KTTB 2R2WU 2JETC 4R0IA 1VITH 4BANB 2BD4A 4YLQH 1P2KA 4B74A 3SGBE 4B75A 2B9LA 1YPHC 3D65E 4NSVA 1UVUH 4XSKU 2O8UA 2ZDLA 3LC5A 1SLXB 1P2OA 2SGFE 1XUGA 3TK6A 4XDEA 1ZSKA 1F0TA 1EB2A 1DDJA 3NUMA 4NFFA 1XKAC 2R0KA 2F9NA 2TGDA 4CHAC 2F9OA 4ESTE 2VGCB 4RKOB 1NRNH 2ZFRH 4Y8YA 2QIQA 5LGOA 2VB0A 2ZF0H 2ANMH 3DD2H 1H9HE 1W3CA 1O5CB 1C5OH 3IITA 1P05A 1KSNA 1LQDB 3R3GB 1C2IA 3LJOA 2BD9A 3QDZB 5HGGA 1JIMA 3M7QA 1GL0E 2BX3A 3W94A 3Q00A 3SQHE 3V7TA 1EZSC 1MTSA 1V2MT 1AZ8A 1GJ7B 2HOBA 1K2I1 5DO4H 3EGKH 3BG8A 1O5DH 1SGCA 5T6GA 1PPFE 4OGYA 2VWOA 1GBKA 3RDZA 1LCYA 1UHBB 1PQ8A 5AVDA 1O33A 4BTUB 3SU3A 1PYTC 3H7TA 1CA0B 1F5LA 3LH1A 2Y6TA 5T6FA 1TA6A 1O2XA 1ZZZA 5FBIA 1CA0C 1TPOA 4ABEA 1BJUA 3M7TA 1ZLRA 3O8RA 3SJ8A 2FWWA 4BXWA 3M61U 1EAXA 3KN2A 1FZZA 1QL8A 4MPXA 3LH3A 4FUBA 4O97A 1JBUH 3K9XB 4WH6A 2OXSA 1VCWA 5JBBS 3A8DA 5HXFA 2BY5X 3HATH 1AVGH 1TPSA 1MTVA 4TY6A 1FNIA 1K9OE 4AYYB 4DURA 4X8TH 3LPRA 3GDVA 1O3PB 3ATIA 1AN1E 1RTLA 1NC6A 2P59A 1TWXB 1LKBA 3G01A 1TNJA 3GY8A 4YT6H 3RXVA 1ZRKA 2VH0A 1E34B 2BOKA 1YKTA 1ELCA 1ELEE 4MNWA 2VU8E 3PWBA 2YNAA 2FMJA 2HPQH 3M5OA 5DP5A 1WV7H 5EXLA 8ESTE 4MNVA 3UQVA 1GI8B 1BUIA 1ZGIA 3F9HA 4H42U 1Z8IB 4TPYA 2YNBA 1G3EA 2G81E 3TK5A 1SLUB 1VITF 3SI3H 2GDEH 1GDQA 2NU3E 3VFEA 1EPTB 3RXSA 4WXIA 3TH4H 3E16B 1GJ5H 3BF6H 1RIWC 1FY5A 4WH8A 2XBYA 3QTOH 1DUEA 3I29A 4WMEA 4INHA 1AHTH 1O2WA 3Q76A 1YM0A 1WQVH 3T28A 1F0SA 1LPZB 1HUTH 2FTLE 5LPFA 1F2SE 2DE9A 3A83A 4MTBA 3IG6B 2A7HA 1QJ7B 1EUFA 5ABWA 2BZAA 1L1NA 1A7SA 5EW2H 2OBOA 5K7RA 3URCA 4Q80A 3RMLH 1B0FA 1FY1A 1LTOA 4DGJA 4UFEH 5C1XA 3RXIA 5L2YH 5EPNA 5C1UA 3VB5A 1EZUC 1C2KA 2Z7FE 3D62A 2ZGCA 6GCHF 1O2RA 1K1LA 4Y79A 3RXMA 5G4BA 1GCTC 1A3EH 3TIUA 1G36A 2Z3EA 1HBTH 1EP6A 1TRMA 2FI3E 3MU4A 1H8DH 1TFXA 1W13U 2ZIQH 4Q2KA 4NA9H 1SGFG 2VVVA 2D26C 4WMDA 1LVBA 2A2QH 2QA9E 1ZPBA 5J4SA 1IQEA 4D8NA 1AO5A 1Y3XA 2A5AA 3L33A 3BTWE 1OWIA 5A0CA 1GHZA 4MPVA 2A4GA 2Y5HA 2C4FH 1MTUA 3SQEE 3ZZ5A 2AMQA 2FP7B 3RC4A 3TGIE 3QZQA 1PYTD 1D6WA 2C3SA 2AMDA 1DE7H 3EAJA 4ABIA 2G00A 4NZQA 4K1EA 3LGTA 1U6QA 2R0LA 3SV8A 1IQHA 4XBBA 2V6NA 5L6NH 1SLVB 2FYRA 6GCHG 3LDXH 3NCLA 2ZFPH 5TJXA 3F1SB 3SNCA 1TA2A 2JH5D 2PKAB 1GJ8B 1Y3UA 3OY5U 2F9UA 4J1YA 4B76A 5EQQA 4X6OA 3SBKA 1SR5C 5IYTA 3RXAA 3O8DA 1GBBA 1ZOMA 4RN6A 2BB4A 2ODPA 5JB9S 1BIOA 3SU1A 2WUBA 1TRYA 1ZTJA 1FXYA 1ACBE 3UQOA 2KAIB 1KXAA 1QGFA 3EA9A 3U98H 2GCTB 1BB0B 1KXDA 1T8LA 3RXDA 1IQFA 3FP7E 1DSUA 1ELFA 3PMBB 1GJDB 4GUXA 1GVZA 2EC9H 3NPSA 4PROA 3PLBA 1MH0A 3PYHA 3A85A 1P2IA 3NZIA 1ESAA 2GV6A 1RFNA 1UVSH 2BY7X 4X6NA 4K2YA 4AGKA 3RXUA 1O3OA 1GDNA 4TY7A 5ESBA 1V6DA 3RC6A 5A0BA 1O3GA 2PGBB 2AFQB 2R3YA 2G5VA 3P6ZB 1THSH 2Z9JA 4ZKNU 3S9CA 1GI1A 4BAOB 3SV2H 4YOIA 1O3EA 5EODA 1HAYB 1OXGA 3RXOA 1TQ0B 3I77A 2UUFB 4FU7A 1BMAA 1ZMNA 2HRVA 2W3KA 2P16A 1F5KU 1FV9A 3CENA 1RS0A 8LPRA 4JZEH 1SC8U 1UVTH 3MFJA 1W7GH 1HAOH 2PUXB 3MU8A 3NWUA 3EA8A 2QY0B 1VGCC 1UK2A 1GL1A 3B23B 1P09A 1QL7A 2ZPRA 1AE8H 3QN7A 3GCNA 2O8MA 1C9PA 1MUEB 1WQSA 2UUYA 1NFUA 1T4UH 2O8LA 2ZNKH 1MD7A 5GIBA 3TJOA 2ZCKP 3A84A 1W12U 2SFAA 1A61H 5L30H 2PKAA 1DSTA 3VB4A 2AH4X 1O2GH 1OKXA 1GMHF 4IN2A 2ZDVH 4MNXA 4E7RG 1Y5UT 4JK5A 1AD8H 1Y3VA 2OC0A 4U30A 4UFDH 2R3UA 4UE7H 1TAWA 3ZV8A 4XBDA 3SNEA 4A92A 1ZHPA 3ZVDA 4AN7A 1QCPA 1F92A 1IHTH 1LHEH 1A0JA 1J16A 3RXEA 1D3QB 1UCYH 2B7DH 4HFPB 4X1NU 4CHAB 5HM2A 2BVSH 1GMDG 1O37A 4HGCA 4X1QU 1SQTA 4BAQB 1HAPH 4NZLA 4X6MA 1IAUA 3MU1A 3K6ZA 3SJKA 5JPMH 1ZGVA 1AVWA 2PW8H 1TGBA 2CHAB 1O2KA 1UHBA 2GKVE 3A7ZA 3ENSB 5L2ZH 1Y59T 4KKDA 1XM1A 3A8BA 2A7JA 5DGJA 1O3JA 1P06A 2A4RA 1IQGA 1OYTH 3E1XB 2AGIX 1GBDA 2VINA 3V0XA 1T8NA 2QV1A 2QXGA 3M3SA 3HGPA 1DLEA 4LZ4B 4BTIB 1OWHA 1NPMA 2ANKH 2FESH 1GJ4H 1GMCF 3RXPA 2RG3A 3Q3YA 1QRXA 2TBSA 1TGCA 5AFZH 5HM9A 3C27B 5C3NA 1L2EA 2H1UA 2CF9H 2WPHS 2XCFA 2A2XH 2PFEA 1MZAA 1P3CA 1B5GH 2FZZA 1QB6A 2ZFQH 1SFQB 2GZ9A 1CT2E 1AMHA 2BOHB 1C5QA 2BDCA 4U01A 2OTVA 3HKIB 5IDKA 1UVPA 2VVCA 2K1QA 1SGYE 3LOXA 1H4WA 3IWMA 4IGDA 1G3BA 2Z3CA 1DOJA 2Y5GA 2GMTC 1XXFA 1V2RT 1O30A 5DPAA 1MAYA 2WPIS 3SUEA 1J17T 3TJUA 4FVBA 4Y0ZE 5GXPA 1HAVB 4AB8A 1BT7A 1GI3A 3FZDA 2V0BA 1O2IA 1UTLM 3UREA 5BRRE 5ESTE 1OWEA 1T7CA 1V2QT 1MKWK 3S9BA 4DG4A 2PSXA 1GVKB 3EDXB 4FUIA 3SGQE 3LC3A 3A7VA 2UWPA 7GCHF 1W0YH 5SGAE 2SNWA 4U2WA 1P02A 4NIYA 2CXVA 2ZHQH 4ZROA 3SUGA 1IQLA 1ETRH 2P95A 8GCHF 4AORA 1C1VH 3ZYEA 4Q7YA 1T32A 1XXDA 2PUQH 5EW1H 1O3AA 2HLCA 4DCDA 2F9BH 3T25A 3TU7H 5TCCA 1Q3XA 2FTMA 3P8FA 2UWOA 1UTQA 1GHBF 4CR5A 1GMDF 2XNIA 3PMHB 1O2YA 4IC6A 3RMNH 1ELAA 2G4TA 4NWKA 3DUXH 2BD8A 1V2JT 1GHAF 4Y10E 1UJ1A 3ZVEA 2D1JA 2M5TA 3A7TA 1EOJA 1P9UA 1BRUP 1SG8B 5F03A 1C9TA 1O2MA 1SHYA 4AX9H 1TMUH 1OX1A 3RP2A 1SOTA 1O34A 3O8CA 3UTUH 5AF9H 4NG9H 1L4DA 1ID5H 3SJIA 1D9IA 4O03A 1NZQH 3TPIZ 2SNVA 1EP5A 1GI2A 5JB8S 1AWHB 3PMJA 4GHTA 4YM9A 4Q7XA 3S69A 2ZQ2A 3LT3A 4XE4A 5A09A 4GAWA 1ELTA 1KXCA 4OS5A 2ZTZA 1FY3A 2ODQA 1PQ7A 4TPIZ 1O36A 2PKSC 1CA8B 5F8TA 3E6PH 1QA0A 1C2MA 2V35A 4RSPA 1NESE 2FOGA 3OX7U 4FUDA 1G3DA 1TYNA 4KELA 1HAIH 3KF2A 1C5UA 1S81A 1MTNC 2ANWA 1LQEA 1DWDH 3ATLA 2BLQA 4ABDA 1B0EA 1QBVH 1ELDE 1MTNB 2FOHA 2PWXA 1CBWB 3RLWH 2FO9A 1Z7KA 4X6PA 3BIUH 2FDAA 1A1RA 3F9FA 4DT7B 5GWZA 4H4FA 2NU0E 1S85A 3KQCA 3ZVBA 1TBQH 1EOLA 1GG6C 4ZUHA 2NU4E 3HK3B 1AGJA 1CQQA 4ZXYH 3VXFH 1GPZA 2VWNA 1HXFH 5GDSH 3QLPH 1WU1A 3F68H 4ZHMU 2P8OB 1DX5M 2ZDAH 3S7KB 3ODFA 2SGDE 1EAUA 2UUJB 1O2UA 2H5CA 1UMAH 2Q6FA 1V2UT 2WPKS 1ZTLA 4ZKOU 1HFDA 3RXCA 3TJVA 1ORFA 4Z6AH 3D23A 4XOJA 1MAXA 1AZZA 3VGCB 4AB9A 2WV4A 2Z6BD 3TH3H 4DY7B 5DP4A 4QT8C 4OS7A 1MZDA 5E0GA 1T31A 5FCKA 3KQDA 2TGTA 1YF4A 3ZZCA 2BX4A 1C1WH 4YLUA 3MWIU 2FS8A 3ESTA 5EQRA 3FP6E 5B6OA 4IMQA 1AFQB 1P9SA 3RXRA 1YYY1 3ZZAA 1NRQH 3QK1A 4UDWH 1HYLA 1SFIA 1C1UH 2LNCA 3ZV9A 5TCAA 3AAVA 1V2LT 3GY4A 2XCNA 1XUIA 4FUHA 4DW2U 5I25A 4AOQA 1Q31A 1Y3WA 2OBQA 2PTCE 2O8WA 3M7UA 1QFKH 1H8IH 1V2KT 1PQ5A 2I6SA 1C1MA 4ZH8A 3GY7A 1GBMA 2VIVA 2CV3A 1LKAA 3A81A 4CR9A 2P3FH 1K21H 3M36A 1Y5AT 3MH4A 2WUCA 4AG1A 1P01A 2VWMA 2G4UA 1NFYA 8GCHG 3MTYA 2BDBA 1DICA 3F9EA 4K8YA 4ZHAA 1HJAC 4J2YB 1FY8E 1TGNA 2J9NA 1XVOA 3MO6A 4WMFA 1TBRH 1NU7B 1A3BH 3GYLB 1SGDE 2GT8A 1FJSA 1EJAA 3M3TA 1AUTC 1EAWA 1NFXA 4F49A 5FAHA 1OS8A 5EGMA 2BLVA 1BITA 3PTNA 1F5RA 2GP9B 1O3DA 4A1TA 1UVOA 2ZGJA 1SSXA 2Y81A 1UCYK 1DPOA 5E2PA 2XYAA 1ZSJA 3BG4C 5CHAB 1ESBA 3BTGE 1TMBH 3LKWA 1G30B 3UPEA 1C5ZB 5EOKA 3UUZA 9LPRA 4IN1A 1O5GH 2FOAA 2VIWA 3BTKE 1C1PA 2XC5A 2GT7A 1FPCH 1ZPCA 4JZIA 5J4QA 3E0NB 4YOGA 3L3TA 4JK6A 1EQ9A 5C1YA 3VXEH 4X1RU 1QJ6B 5DG6A 1W0ZU 1RGQA 1VITG 2FI4E 1GI7B 1NT1A 3ZVAA 1C2FA 2CHAC 1K1NA 2H9TH 1IQIA 2G5NA 2GV7A 1QL9A 2FOMB 1FONA 2BD5A 3M5LA 3TH2H 3EE0B 2OUAA 4CRBA 2GCHF 5K0HA 1Y8TA 2J92A 1QB9A 2VJ1A 1GBFA 4CBOA 1KTSB 1YBWA 2R9PA 3W95A 2BYAX 2FI5E 2QN5T 3T29A 5DP6A 1C2LA 1S82A 2XXLA 2BDGA 1J15A 1SGEE 1OOKB 1UTKA 1XX9A 1EATA 5EQSA 1GHBG 1B7XB 3WY8A 1DVAH 3RU4E 1PPHE 1GHXH 2FYQA 4WWYA 1P3EA 2XTTB 5JBCS 3PLPA 4CRDA 3DFJA 1SGFA 2Z3DA 1TMTH 4WY3A 4WF8A 2Z9GA 4ABAA 3BEIB 4AFQA 1V2PT 2B5TB 1D3PB 4K5ZA 1SPJA 2A1DB 5JDUB 1TNGA 4ZAEA 4A1XA 4ABFA 4Q7ZA 2CGAA 1D4PB 2Z9LA 1GG6B 5DK1A 2G55A 1V2VT 3PTBA 4A5TS 4D9QA 1GI5A 2WINI 3ZVCA 1A5HA 3PV4A 1V2TT 3SNDA 4YOJA 1G3CA 1AE5A 1O5FH 2IJOB 3KL6A 2JKHA 1MKXH 3KGPA 1C1TA 1H9LB 2AIPA 5C5NA 3GISB 3MU0A 5E0JA 3P92A 1BTYA 3OY6U 2QCYA 1TRNA 1CGHA 1AVXA 4B1TA 4JZDH 5ETXA 4BAKB 2BQWB 1SLWB 1E36B 3RMMH 3O8BA 1O39A 1W14U 3KIDU 3Q3XA 3BEUA 5F8ZA 2ZC9H
chains in the Genus database with same CATH superfamily
1A0LA 4X8SH 1T8MA 1IQNA 1HPGA 2A45B 3M3VA 5DP8A 5F8XA 2OQUA 3MO9A 2H9EH 3RXKA 3STJA 1KDQA 1NRPH 4I8HA 2OINA 1L0ZA 5HMAA 3A88A 5EJ1A 1QQ4A 1TPAE 3UR9A 3BTQE 2Q6GA 2YMSC 1HLTH 1W8BH 2QAAA 1O2NA 1SI5H 2EI7A 1GHYH 5JBAS 1GJCB 2BQ7B 2Z9IA 4I32A 2PR3A 1C5VA 1S5SA 2FOEA 2G8TA 2HNTF 1GCDA 1XKBC 3R0FA 1LPGB 1SGQE 4CRFA 1OWJA 1BRCE 3OTPA 5BPEA 1GI6A 1HAGE 1O35A 3F9GA 3SZNA 3RU4T 3LU9B 1D3DB 3GY6A 1HJ9A 4E05H 3E0PB 3ZZ8A 2QXHA 2F83A 3MYWA 3URDA 1P2QA 1IOEA 1MBMA 4B2BA 1LDTT 2VH6A 2SGPE 4MPWA 1KY9A 2VIOA 1GBEA 1HCGA 1MKXK 1S84A 1E37B 2BLWA 3MOCA 3RXHA 2CF8H 3VB3A 2AERH 4K1SA 5EU8A 1EZQA 1BMNH 2JETB 1PPGE 2BDIA 1L4ZA 3RM0H 4UONA 4I8LA 4TWWA 1BCUH 2ZDNA 6CHAB 3BN9A 1C2EA 1KXBA 3F6UH 1CU1A 4HI3A 1GBJA 1AU8A 2A5KA 1WYKA 2THFB 4TYDA 3STIA 2VGCC 1GBCA 3C1KA 1GI4A 3FFGA 4Y7AA 1G9IE 1PPCE 3OE7D 4BAMB 5A8YA 4FOUC 3KHVA 1FAXA 4NCYA 2ESTE 1KLIH 1ZR0A 2SGQE 3MO3A 5EG4A 4DOQA 1BBRH 1TGTA 4ABBA 3WW7A 2BD2A 2BTCE 2P8OC 3MNXA 5LPRA 1JIRA 1TIOA 4KTCA 2XBXA 5A8ZA 1BZXE 3T26A 1GI0A 1BTPA 2TRMA 3GYMA 1DM4B 1YPKH 3EQ0H 3DA9B 1G37A 1HNEE 3OTJE 2Y7XA 4YTAA 1BDAA 3BTHE 5I46H 1NS3A 1CT4E 1DUAA 3GY5A 1M9UA 1K1MA 2R2MB 1TPPA 2BZ6H 2ALVA 2BHGA 4AYVB 1C5YB 1HB0B 2NWNA 3FOAA 3SU5A 1C1NA 1DITH 1YPEH 1ABIH 2VNTA 3ZZBA 3QGJA 1K1JA 1WCZA 3CNRA 1C1SA 1AIXH 1K0HA 1FQ3A 3UWJH 1YPJH 4TSFD 1O5EH 3V12A 4O3UA 4RI0A 2AMPA 1LMWB 3KYGA 1EXFA 2VVUA 3GCOA 2O8TA 3LONA 3DHKH 4B2AA 2J2UA 1P12E 2BMGB 2HPPH 2KCAA 1MU8B 1CHOF 1QY6A 4H6TA 4FU9A 2GMTB 2H9HA 1WBGB 2GCHG 2AHME 2NU1E 4FXGH 2ODYB 4Y11E 2CK3D 4FUJA 4CRCA 3FZZA 4ZKRU 2AIQA 1FN8A 2ANYA 1SKYE 2STBE 2FIRH 4OS1A 3U1JB 1DFPA 1FUJA 2CJIA 1SB1H 1C2GA 4AGJA 1GHAG 2ZP0H 1HAVA 2F91A 1BTHH 1AKSA 1VCQA 3U9AH 1P03A 4NWLA 1WSSH 2CN0H 3AW0A 1GJ9B 3SJ9A 3QWCH 4INKA 3ZVFA 4JZ1A 2Q6DA 1MQ6A 4U32A 4XBCA 4Y8XA 1DT2A 5EPYA 4FU8A 4Y7BA 3U8TH 1GGDC 2V3OH 1QRZA 2A5IA 4ABHA 3OFND 2ZFFH 3K6YA 1W0JD 1P2NA 3MMGA 3NKKA 4Z0KA 1MCVA 2FS9A 1H1BA 1HJ8A 4P00A 3UWIA 3TNTA 2ZU2A 1N1LA 1P2MA 3UOPA 2HGTH 4E06H 1E35B 1SVPA 3WWBA 4MPUA 2XWAA 1C5XB 3V13A 3Q77A 2Y82A 1SQAA 3P8NA 1Z71A 7KMEH 1KYNA 1O32A 1H9IE 1HRTH 2ZTYA 4M7GA 4Y6DA 3SORA 2G51A 4DVAU 2J5UA 3PMAB 2ZDKA 1EAIA 2AYWA 2RA3A 1DXPA 2UWLA 3MH6A 4FUCA 1BTUA 4HZHA 4MLFB 5C20A 1C4V2 1W2KH 2BXUH 3PRBA 1MMJN 4CREA 5C94A 1AB9B 1GBLA 1AI8H 3HKJB 1TLDA 1P04A 3GCHB 1O3BA 1BMLA 1NBME 3SYJA 1PPEE 1O2SA 3QO6A 1PPZA 2J98B 2FLBH 3TJNA 1NRSH 1P0SH 4K60A 3HGNA 2K0QA 1DLKB 4YESB 1WOFA 1GBTA 2PSYA 5CDFE 1EJNA 5FBEA 2ZO3H 2HVXA 2J38A 1G2MA 1TBZH 1RXPA 1WTGH 3A80A 3AAUA 3FAOA 2EI8A 1ZYOA 1JOUB 2BY9X 3KEEA 3RMOH 3S7HB 3RLYH 4OS4A 4AFUA 2BLOA 1BRBE 2OP9A 1NTPA 1GBAA 1Z1IA 3TGKE 3BSQA 5FX5A 1MTWA 2WHXA 2ZU3A 2LELA 4INLA 2A32A 2BD3A 1OPHB 1ZSLA 1JRSA 3GY2A 3CS0A 1HAZB 1VJ9U 4D7FA 1XUHA 2XC0A 2WPJS 1ARBA 3A7YA 4SGAE 1MKWH 3CS7A 5E0HA 2BDHA 5F6MA 1E38B 3RXGA 1ZTKA 3GOVB 3U8OH 4XD7D 4LXBH 3M5NA 1KXFA 4X8VH 2F4LA 2GCTC 4IBLH 3U1IB 5A2MH 2ZU5A 8KME2 1V3XA 2HALA 2KAIA 1YLCA 2WSSD 3K65B 3H5CB 1NY22 4R8TB 1FI8A 2PV9B 2OC7A 4YO9A 3A7XA 3LGYA 2HNTC 2A4QA 1C5TA 4B73A 1C5PA 1HDTH 1TNIA 3A8CA 1TALA 2ZECA 1VCPA 3N99A 3PO1B 5CE1A 1ELGA 2ZFSA 1C2DA 2Y5FA 2PHBA 5DP3A 1N6YA 4X2YA 3T5FH 3TLOA 2WPMS 1FN6A 4NFEA 3A86A 4GVUA 2FOBA 3KQEA 2GD4B 1LHCH 3VEQB 1W11U 3ZZDA 1TQ7B 1OP8A 3HPTB 3KCGH 1GMHG 3MNCA 1Y5BT 3BTME 1TX7A 2GZ7A 1OSSA 2YMSB 4ABGA 1UK4A 5H4IB 2ZDMA 5EJLA 1OWKA 2FEQH 3RUOA 3T27A 3BIVH 1BBRE 1Z8RA 2QXJA 1S83A 1O0DH 1LVOA 1VR1H 4I8GA 4ISHH 5EXNA 3BTDE 2P3UB 4VGCC 3PM3A 4NIVA 1NU9A 3F2GA 5GCHF 1IQKA 1LO6A 3JZ2B 2F9PA 2ZEBA 1GJAB 1FIWA 2FM2A 4ZXXH 1N8OB 4X0WU 1HV7A 1N8OC 2EQNA 2OQ5A 5FPTA 4AZ2B 4ASHA 1UTNA 2UUKB 1ZMJA 1P11E 1BJVA 3ZIAD 1C5RA 4GPGA 4IW4E 1QBOA 4KTUA 3K2UA 2H2ZA 2ZWLH 2XC4A 6ESTA 5A8XA 5CHAC 1LHFH 1XUKA 1OP2A 2ZKSA 1O3KA 4JYTA 1O3LA 1FPHH 2F3CE 1C4U2 4RKJB 1WAYB 2P94A 3WWFA 2RA0A 2Y7ZA 3FO8D 1O3NA 1UTMA 5JYIA 2BM2A 3AASA 1ABJH 1S6FA 3VB7A 1ANCA 2TPIZ 1S6HA 2B0FA 2W7UA 1D6RA 4K8BA 9ESTA 4Y76A 2DE8A 4A6LA 3TK9A 3SV9A 1EB1H 3NK8A 4X1SU 2BD7A 3UR6A 1SGPE 1GBHA 1CE5A 1NFWA 2A4OA 2C8XB 2AS9A 1EKBB 1KLJH 1SGRE 4X2VA 2A7CA 2GTBA 1VZQH 4Q63A 3A89A 2PGQB 4BOHA 1O3IA 3GCHC 1AKSB 1EFRD 3UIRA 2BDYA 1O2LA 1C2JA 3LGUA 1QIXB 2FX6A 1A0HB 1YGCH 2I6QA 3GICB 1CVWH 1SGIB 2RCEA 4X2WA 2Z9KA 1C5SA 1O3CA 3ZZ6A 3N7OA 4O3TA 1ANDA 1SOZA 2XWBI 4K3JA 3QTVH 4NSYA 1ZPZA 1CHOG 5FXLA 1F0RA 1CHGA 1P57B 1OYQA 2EI6A 4OS2A 2H6MA 1A5GH 4XFQA 3M37A 3CP7A 1AFEH 3GCTG 4I33A 3A82A 2ZGBH 5IK2D 1O2OA 4X8UH 1E0FD 3ZZ9A 4LOYH 2FX4A 1UO6A 3BEFB 3SU0A 4D7GA 3SOSA 2WPLS 3KQBA 2GDDA 2ZG0H 4BNRA 3SUDA 1BHXF 5C2ZA 2NU2E 4X2XA 4JMYA 3BTEE 1MD8A 1OWDA 3GY3A 1RD3B 3MU5A 3OU0A 3AK5A 3NRLA 5CMXH 2ZTXA 3SJOA 4B71A 1GI9B 1KIGH 4SGBE 5EJZA 5EIYA 1CGJE 1V2OT 3SO3A 1FMGA 1ZHMA 1SL3A 1MU6B 3UFAA 3MHWU 1Y3YA 1JXPA 1BTWA 1QTFA 1MBQA 4I86A 1EPTC 2A31A 3UY9A 4MVNA 4JZFH 1RIWB 1F0UA 1HAHH 1AY6H 1ELVA 3DSPA 1ARCA 1C1OA 3OAAD 4JYUH 1TNKA 3OSYA 1NBMD 3QUMP 3MNSA 1PQAA 1UTPA 3BG4B 4GHQA 1TONA 2RDLA 2YOLA 3SGAE 1THRH 4AG2A 5DP7A 2J4IA 4D9RA 1SBWA 2W3IA 1YPMH 1ELBA 3ATMA 1QBNA 5HIYA 2C93B 1BTZA 1X7AC 2QF3A 2OLGA 2TGAA 3LGVA 3F3BA 1DS2E 2XBWA 1K1OA 3FANA 4DIHH 3NXPA 4IMZA 1HXEH 1TABE 3MQKC 1YPHE 1K28D 5FCRA 1YCPH 5C67A 3H7OA 1C5LH 4FUEA 5GPIB 2J98A 3BV9B 2ZA5A 1J14A 1HGTH 1DWEH 1GHWH 2QF4A 3ATWA 3ITIA 2G52A 1AUJA 3P95A 2LPRA 1BMMH 2BDAA 1J9CH 4VGCB 1FIZA 2W26A 1IQMA 5DP9A 3GDUA 1BTXA 1C5WB 2ZFTA 3Q3KA 1PPBH 1QURH 1TOMH 3N7EA 5DKMA 1W0KD 3S9AA 2IPHA 3N7DA 3TITA 6CHAC 2WZQA 2HVYB 3OYPA 1QHRB 3KNXA 1XVMA 3UNSA 1IQJA 3ZZ3A 4DT4A 1YLDA 4I31A 4I7YH 2P3TB 5E2OA 3DT0H 4IC5A 2JH6D 1TOCB 1C5MD 3A7WA 3EYDA 5AFYH 2GZ8A 1NM6A 1ZJKA 3PLKA 1BRAA 2Q1JA 4KGAA 1EZXC 3RXBA 2BY8X 1P10A 3QZRA 1TE0A 2ZCLP 3HK6B 1RJXB 1SQOA 4ZKSU 3RXJA 4ISIH 5DJ7A 1ZRBA 3BTFE 3E8LA 4UD9H 4YZUA 3UNRA 1GDUA 3EE7A 4F4OC 4Z1MD 1BA8B 1ETTH 1HIAB 3EA7A 3GCTF 1DY8A 1C1RA 1C4Y2 1NO9H 2B8OH 1Q2WA 4NGAH 1HAXB 1RTKA 1G32B 1YPGH 1TNLA 3FVFB 2OD3B 2DUCA 1QRWA 1O2QA 4ISOA 2W6ID 4BXSA 3ZVGA 2JH0D 2OC1A 1P2JA 4K69A 1EJMA 4O9VA 1INCA 3VGCC 3VPKA 5FPYA 4FUFA 4CRAA 3LGWA 1ETSH 1V2ST 3PWCA 1JMOH 4I8JA 5T3HA 3PO1C 3SI4H 1T4VH 2XW9A 2HWLB 1W7XH 2W7SA 1HIAA 4CBNA 4Y0YE 3RXLA 1T8OA 4GCHF 2VWLA 1QQUA 3RXTA 1KDQB 1O3MA 1O2VA 2EA3A 2BVRH 2WV5A 1ESTA 3E90B 2VIPA 1TNHA 2GX4A 1WTHD 4OGXA 4BTTB 1ZJDA 2BY6X 3P8GA 4NA7A 4ACAA 1GJBB 3P70B 5C5OA 1QB1A 4WVPE 1F7ZA 2QE7D 2JIZD 2ZHFH 1GHVH 4Y71A 1A4WH 1O2JA 5LH8A 2W5EA 1S0QA 3RU4D 1EASA 1TGSZ 2J94A 3ZZ4A 2TIOA 4DJZB 3PV2A 4Y8ZA 1V2WT 4NIXA 2FLRH 1LVYA 1GVLA 2ZQ1A 1GJ6A 3SHCH 4KP0A 2BVXH 1BQYA 1QR3E 1RTFB 3SUFA 1AQ7A 1VGCB 3RXFA 1HJAB 7LPRA 4AFSA 3TGJE 2GGVB 3RM2H 1QJ1B 1LVMA 1XUFA 1KLTA 4RT0A 1XMNB 4HTCH 1RRKA 3MNBA 2D8WA 2XNDD 4ZHLU 3ELAH 2J95A 1GWAA 3SU6A 1C1QA 5T1VA 1WDIA 2CMYA 2V3MA 3AW1A 2ALPA 3M5MA 1SMFE 2BQ6B 3U8RH 1PFXC 1MCTA 5E8EH 2H5DA 3QGNB 4B2CA 7ESTE 1O2ZA 1TX8A 2FXRA 2VIQA 4I8KA 1K1IA 2ZI2H 4THNH 3SNBA 1MQ5A 4GSOA 4CRGA 5FHTA 2GVFA 1GMCG 4WJG2 2ZHWH 1YPLH 4NIWA 3SN8A 1UTOA 1UCYE 2ZU1A 5PTPA 1BOQA 2ZGHA 3UOUA 5FX6A 1Z8GA 1AWFH 5EXMA 1SGNE 4K1TA 1L1GA 2PLXA 3OEHD 4TT3D 3SV7A 4ISNA 2ZPQA 4X1PU 2AGGX 1O2TA 1K22H 1O31A 3MH7A 5GJ4B 3UB0A 2ZCHP 3SNAA 2V3HH 2Z94A 4TWYA 3SV6A 1LHDH 4IS5A 5LPEA 2D2DA 1O3FA 1L1JA 2A0QB 3RXQA 3F0OA 1A5IA 1V2NT 1UTJA 1P8VC 4XRNA 5HYOA 4YT7H 1N6XA 1YCPM 3T2NA 2ZGXH 4GCHG 3ATKA 4NA8A 2AEIH 4MQAA 3TNSA 3SW2B 5GCHG 2O9QA 4CH2B 1QA7A 1BHXB 1PJPA 1O5AB 1Z8JB 4MG3A 3V3MA 1O3HA 2QGRA 1TB6H 7GCHG 6LPRA 2OC8A 1CSOE 1J8AA 2TGPZ 1D3TB 1YCPK 3AVZA 3PRDA 2SGEE 4MDSA 4HG6A 1NROH 2QYIA 3DFLA 4GLYA 1DANH 1Z1JA 3RC5A 1O2PA 2P93A 1CBWC 3P8OA 3B8JA 1QNJA 2J34A 3VB6A 3TVJB 2AGEX 5T6DA 4KTSA 1K1PA 1ANEA 2KZ4A 4OS6A 1WUNH 3A87A 1JWTA 5FPSA 2QC2A 3LGIA 4A1VA 1O5BB 4E7NA 4FVDA 3E3TA 1XUJA 3F2FA 1FDPA 4UFFH 4ZCNA 1JRTA 2IOTA 1DWCH 1TX6A 1CGIE 3DCLA 4AFZA 2ZU4A 2SGAA 5JBTA 2ZPSA 2WYGA 3SU4A 3ZYDA 2C90B 3QX5H 2ASUB 2Y80A 4H6SB 2QXIA 4ZMAH 3I78A 1GGDB 4JYVH 2ULLA 1ZHRA 1C2HA 3B9FH 1UK3A 2IN2A 1Z6EA 2WYJA 1FY4A 2C8ZB 1C5NH 3BTTE 3JZ1B 1VJAU 1COWD 2XRCA 3A8AA 1SHHB 2ZHDA 3P17H 2ZHEH 3GDSA 1YC0A 2VIDA 2FODA 4JCNA 2XBVA 2HNTE 1LPKB 3PROA 1ANBA 1DXWA 2F9VA 1O2HA 3PB1E 5AHGH 1AFQC 2FOCA 1ZMLA 1YLNA 3UNQA 1W10U 2C8WB 2C8YB 4DIIH 1FLEE 2OCVB 4UEHH 3PV5A 1A46H 5A0AE 1DY9A 4MNYA 3SHAH 5KEDA 3L6PA 1CO7E 1NN6A 3U69H 3M35A 2FOFA 1S0RA 3ODDA 3ZZ7A 1THPB 3D49H 4CH8B 2ZZUH 2STAE 1YP9A 4WXVA 4LZ1H 1GCTB 2FPZA 2QF5A 3E91A 1KXEA 1A2CH 4UFGH 3S0NA 2QF0A 3T62A 2PTNA 1SGTA 1NRRH 3MH5A 3OEED 2ILNA 1EPTA 1AB9C 4A7IB 4D76A 1CT0E 1GBIA 3LIWA 1FAKH 3SU2A 3MI4A 3FP8E 1BMFD 4LK4A 4BAHB 5CHBA 2EEKA 1LHGH 4FUGA 1Z6JH 4ABJA 3LJJA 1O38A 4ISLA 1EX3A 1G2LA 1IHSH 2PKSB 1OP0A 1BBRK 1DWBH 2BXTH 1KTTB 2R2WU 2JETC 4R0IA 1VITH 4BANB 2BD4A 4YLQH 1P2KA 4B74A 3SGBE 4B75A 2B9LA 1YPHC 3D65E 4NSVA 1UVUH 4XSKU 2O8UA 2ZDLA 3LC5A 1SLXB 4RT1A 1P2OA 2SGFE 1XUGA 2WPDD 3TK6A 4XDEA 1ZSKA 1F0TA 1EB2A 1DDJA 4OM9A 3NUMA 4NFFA 1XKAC 2R0KA 2F9NA 2TGDA 3UAIC 4CHAC 2F9OA 4ESTE 2VGCB 4RKOB 1NRNH 2ZFRH 4Y8YA 2QIQA 5LGOA 2VB0A 2ZF0H 2ANMH 2PP6A 3DD2H 1H9HE 1W3CA 1O5CB 1C5OH 3IITA 1P05A 1KSNA 1LQDB 3R3GB 1C2IA 3LJOA 2BD9A 3QDZB 5HGGA 1JIMA 3M7QA 1GL0E 2BX3A 3W94A 3Q00A 3SQHE 3V7TA 1EZSC 2HLDD 1MTSA 1V2MT 1AZ8A 1GJ7B 2HOBA 1K2I1 5DO4H 3EGKH 3BG8A 1O5DH 1SGCA 5T6GA 1OHHD 1PPFE 4OGYA 2VWOA 1GBKA 3RDZA 1LCYA 1UHBB 1PQ8A 5AVDA 1O33A 4BTUB 3SU3A 2JDID 1PYTC 3H7TA 1CA0B 1F5LA 3LH1A 2Y6TA 5T6FA 1TA6A 1O2XA 1ZZZA 5FBIA 1CA0C 1TPOA 4ABEA 1BJUA 3M7TA 1ZLRA 3O8RA 3SJ8A 2FWWA 4BXWA 3M61U 1EAXA 3KN2A 1FZZA 3GS9A 1QL8A 4MPXA 3LH3A 4FUBA 4O97A 1JBUH 3K9XB 4WH6A 2OXSA 1VCWA 5JBBS 3A8DA 5HXFA 2BY5X 3HATH 1AVGH 1TPSA 1MTVA 3F2HA 4TY6A 1FNIA 1K9OE 4AYYB 1UW7A 4DURA 4X8TH 3LPRA 3GDVA 1O3PB 3ATIA 1AN1E 1SQRA 1RTLA 1NC6A 3VG8A 2P59A 1TWXB 1LKBA 3G01A 1TNJA 3GY8A 4YT6H 4P02A 3RXVA 4F48B 1ZRKA 1E34B 2BOKA 1YKTA 2VH0A 1ELCA 1ELEE 4MNWA 2VU8E 3PWBA 2YNAA 2FMJA 2HPQH 3M5OA 5DP5A 1WV7H 5EXLA 8ESTE 4MNVA 3UQVA 4B6FA 1GI8B 1BUIA 1ZGIA 3F9HA 4H42U 1Z8IB 4TPYA 2YNBA 1G3EA 2G81E 3TK5A 3DSGA 1SLUB 1VITF 1WXRA 3SI3H 2GDEH 1GDQA 5B6LA 2NU3E 3VFEA 1EPTB 3RXSA 4WXIA 3TH4H 3E16B 1GJ5H 3BF6H 1RIWC 1FY5A 4WH8A 2XBYA 3QTOH 1DUEA 3I29A 4WMEA 2KCPA 4INHA 1AHTH 1O2WA 2F43B 3Q76A 1YM0A 1WQVH 3T28A 1F0SA 1LPZB 1HUTH 2FTLE 5LPFA 1F2SE 2DE9A 3A83A 4MTBA 1KMHB 3IG6B 1FX0B 2A7HA 1QJ7B 1EUFA 5ABWA 2BZAA 1L1NA 1A7SA 5EW2H 2OBOA 2EY4C 5K7RA 3URCA 4Q80A 3RMLH 1B0FA 1FY1A 1LTOA 4DGJA 4UFEH 5C1XA 3RXIA 5L2YH 5EPNA 5C1UA 3VB5A 5FL7D 1EZUC 1C2KA 2Z7FE 3D62A 4AC9A 2ZGCA 6GCHF 1O2RA 1K1LA 4Y79A 4ACBA 3RXMA 5G4BA 1GCTC 1A3EH 3TIUA 1G36A 2Z3EA 1HBTH 1EP6A 1TRMA 2FI3E 3MU4A 1H8DH 1TFXA 1W13U 2ZIQH 4Q2KA 4NA9H 1SGFG 2VVVA 2D26C 4WMDA 1LVBA 2A2QH 2QA9E 1ZPBA 5J4SA 2KCYA 1IQEA 2L6OA 4D8NA 1AO5A 1Y3XA 2A5AA 3L33A 3BTWE 1OWIA 5A0CA 3FKSD 2V7QD 1GHZA 4MPVA 2A4GA 2Y5HA 2C4FH 1MTUA 3SQEE 3ZZ5A 2AMQA 2FP7B 3RC4A 3F0PA 3TGIE 3QZQA 1PYTD 1D6WA 2C3SA 2AMDA 1DE7H 3EAJA 4ABIA 2G00A 4NZQA 2W6JD 4K1EA 3LGTA 1U6QA 2R0LA 3SV8A 1IQHA 4XBBA 2V6NA 5L6NH 1SLVB 2FYRA 5HKKD 6GCHG 3LDXH 3NCLA 2ZFPH 5TJXA 3F1SB 3SNCA 1TA2A 2JH5D 2PKAB 1GJ8B 1Y3UA 3OY5U 2F9UA 4J1YA 4B76A 5EQQA 4X6OA 3SBKA 1SR5C 5IYTA 3RXAA 4Q4LA 3O8DA 1GBBA 1ZOMA 4RN6A 2BB4A 2ODPA 5JB9S 1BIOA 2YMSD 3SU1A 2WUBA 1TRYA 1ZTJA 1FXYA 1ACBE 3UQOA 2KAIB 1KXAA 1QGFA 3EA9A 3U98H 2GCTB 1BB0B 1KXDA 1T8LA 3RXDA 1IQFA 3FP7E 1DSUA 1ELFA 3PMBB 1GJDB 4GUXA 1GVZA 2EC9H 3NPSA 4PROA 3PLBA 1MH0A 3PYHA 3A85A 1P2IA 3NZIA 1ESAA 2GV6A 1RFNA 1UVSH 2BY7X 4X6NA 4K2YA 4AGKA 1S6LA 3RXUA 1O3OA 1GDNA 4TY7A 5ESBA 1V6DA 3RC6A 5A0BA 1O3GA 2PGBB 2AFQB 2R3YA 2G5VA 3P6ZB 1THSH 2Z9JA 4ZKNU 5DSFA 2K8IA 3S9CA 1GI1A 4BAOB 3SV2H 4YOIA 1O3EA 5EODA 1HAYB 1OXGA 3RXOA 1TQ0B 3I77A 2UUFB 4FU7A 1BMAA 1ZMNA 2HRVA 2W3KA 2P16A 1F5KU 1FV9A 3CENA 1RS0A 8LPRA 4JZEH 4B6EA 1SC8U 1UVTH 3MFJA 1W7GH 1HAOH 2PUXB 3MU8A 3NWUA 3EA8A 2QY0B 1VGCC 1UK2A 1GL1A 3B23B 1P09A 1QL7A 2ZPRA 5KECA 1AE8H 3QN7A 3GCNA 2O8MA 1C9PA 1MUEB 1WQSA 2UUYA 1NFUA 1T4UH 2O8LA 2ZNKH 1MD7A 5GIBA 3TJOA 2ZCKP 3A84A 1W12U 2SFAA 1A61H 5L30H 2PKAA 2GJGA 5HIZA 1DSTA 3VB4A 2AH4X 1O2GH 1OKXA 1GMHF 4IN2A 2ZDVH 4MNXA 4E7RG 1Y5UT 4JK5A 1AD8H 4ASUD 1Y3VA 2J97A 2OC0A 4U30A 4UFDH 2R3UA 4UE7H 2RFKC 1TAWA 3ZV8A 4XBDA 3SNEA 4A92A 2IJD1 1ZHPA 3ZVDA 4AN7A 1QCPA 1F92A 1IHTH 3DSOA 1LHEH 1A0JA 1J16A 3RXEA 1D3QB 1UCYH 2B7DH 4HFPB 4X1NU 4CHAB 5HM2A 2BVSH 1GMDG 1O37A 4HGCA 4X1QU 1SQTA 4BAQB 1HAPH 2L74A 4NZLA 4X6MA 5C0UA 1IAUA 2XOKD 3MU1A 3K6ZA 3SJKA 5JPMH 1ZGVA 5GNDA 1AVWA 2PW8H 1TGBA 2CHAB 1O2KA 1UHBA 2GKVE 3A7ZA 3ENSB 5L2ZH 1Y59T 4KKDA 1XM1A 3A8BA 2A7JA 5DGJA 1O3JA 1P06A 2A4RA 4YXWD 1IQGA 1OYTH 3E1XB 2AGIX 1GBDA 2VINA 2WV9A 3V0XA 1T8NA 2QV1A 2QXGA 3M3SA 3HGPA 1DLEA 4LZ4B 4BTIB 1OWHA 1YY3A 1NPMA 2ANKH 2FESH 1GJ4H 1GMCF 3RXPA 2RG3A 3Q3YA 1QRXA 2TBSA 1TGCA 5AFZH 5HM9A 3C27B 5C3NA 1L2EA 2H1UA 2CF9H 2WPHS 2XCFA 2A2XH 2PFEA 1MZAA 1P3CA 1B5GH 2FZZA 1E1RD 1QB6A 4F55A 2ZFQH 1SFQB 2GZ9A 1CT2E 1AMHA 2BOHB 1C5QA 2BDCA 4U01A 2VBCA 2OTVA 3HKIB 5IDKA 1UVPA 2VVCA 2K1QA 1SGYE 3LOXA 1H4WA 3IWMA 4IGDA 1G3BA 2Z3CA 1DOJA 2Y5GA 2GMTC 1XXFA 1V2RT 1O30A 5DPAA 1MAYA 2WPIS 3SUEA 1J17T 3TJUA 4FVBA 4Y0ZE 5GXPA 1HAVB 4AB8A 3SZEA 1BT7A 1GI3A 5F53A 3FZDA 2V0BA 1O2IA 1UTLM 3FN8A 3UREA 5BRRE 5ESTE 1OWEA 1T7CA 1V2QT 1MKWK 3S9BA 4DG4A 2PSXA 1GVKB 3EDXB 2KFWA 4FUIA 3SGQE 2KCOA 3LC3A 3A7VA 2UWPA 7GCHF 1W0YH 5SGAE 2SNWA 4U2WA 1P02A 4NIYA 2CXVA 2ZHQH 4ZROA 3SUGA 1IQLA 1ETRH 2P95A 8GCHF 4AORA 1C1VH 3ZYEA 4Q7YA 1VKYA 5KGOA 1T32A 1XXDA 2PUQH 3U28C 5EW1H 1O3AA 2HLCA 4DCDA 2F9BH 3T25A 3TU7H 5TCCA 1Q3XA 2FTMA 3P8FA 2UWOA 1UTQA 1GHBF 4CR5A 1GMDF 2XNIA 3PMHB 1O2YA 4IC6A 3RMNH 1ELAA 2G4TA 4NWKA 3DUXH 2BD8A 1V2JT 1GHAF 4Y10E 1UJ1A 3ZVEA 2D1JA 2LP6A 2M5TA 3A7TA 1EOJA 1P9UA 1BRUP 1SG8B 5F03A 5C0TA 1C9TA 1O2MA 1SHYA 4AX9H 1TMUH 5C17A 1OX1A 3RP2A 1SOTA 1O34A 3O8CA 1H8ED 3UTUH 5AF9H 4NG9H 1L4DA 1ID5H 3SJIA 1D9IA 4O03A 1NZQH 3TPIZ 2SNVA 1EP5A 1GI2A 5JB8S 1AWHB 3PMJA 4GHTA 4YM9A 4Q7XA 3S69A 2ZQ2A 3LT3A 4XE4A 5A09A 4GAWA 1ELTA 1KXCA 4OS5A 2ZTZA 1FY3A 2ODQA 1PQ7A 4TPIZ 1O36A 2PKSC 1CA8B 5F8TA 3E6PH 1QA0A 1C2MA 2V35A 4RSPA 1NESE 2FOGA 3OX7U 4FUDA 1G3DA 1TYNA 4KELA 1HAIH 3KF2A 1C5UA 1S81A 1MTNC 2ANWA 1LQEA 3W1EA 1DWDH 3ATLA 2BLQA 4ABDA 1B0EA 1QBVH 1ELDE 1MTNB 2FOHA 2PWXA 1CBWB 3RLWH 2FO9A 1Z7KA 4X6PA 3BIUH 2FDAA 1A1RA 3F9FA 4DT7B 5GWZA 5DN6D 4H4FA 2NU0E 1S85A 3KQCA 3KQ5A 3ZVBA 1TBQH 1EOLA 1GG6C 4ZUHA 2NU4E 3HK3B 1AGJA 1CQQA 2KR7A 4ZXYH 3VXFH 1GPZA 2VWNA 1HXFH 4M9FA 5GDSH 2JJ1D 3QLPH 1WU1A 3F68H 4ZHMU 2P8OB 1DX5M 2ZDAH 3S7KB 3ODFA 2SGDE 1EAUA 2UUJB 1O2UA 2H5CA 1UMAH 2Q6FA 1V2UT 2WPKS 1ZTLA 4ZKOU 1HFDA 3RXCA 3TJVA 1ORFA 2M2AA 4Z6AH 3D23A 4XOJA 1MAXA 1AZZA 3VGCB 4AB9A 2WV4A 2Z6BD 3TH3H 4DY7B 5DP4A 4QT8C 4OS7A 1E79D 1MZDA 5E0GA 1T31A 5FCKA 3KQDA 2TGTA 1YF4A 3ZZCA 2BX4A 1C1WH 4YLUA 3MWIU 2FS8A 3ESTA 5EQRA 3FP6E 5B6OA 4IMQA 1AFQB 1P9SA 3RXRA 1YYY1 3ZZAA 1NRQH 3QK1A 4UDWH 1HYLA 1SFIA 1C1UH 2LNCA 1YWUA 3ZV9A 5TCAA 3AAVA 1V2LT 3GY4A 2XCNA 1XUIA 4FUHA 4DW2U 5I25A 4AOQA 2KX4A 1Q31A 1Y3WA 2OBQA 2PTCE 2O8WA 3M7UA 1QFKH 1H8IH 1V2KT 1PQ5A 2I6SA 1C1MA 4ZH8A 3GY7A 1GBMA 2VIVA 2CV3A 1LKAA 3A81A 4CR9A 2P3FH 1K21H 3M36A 1Y5AT 3MH4A 2WUCA 4AG1A 1P01A 2VWMA 2G4UA 1NFYA 8GCHG 3MTYA 2BDBA 1DICA 3F9EA 4K8YA 4ZHAA 1HJAC 4J2YB 1FY8E 1TGNA 2J9NA 1XVOA 3MO6A 4WMFA 3KYFA 1TBRH 1NU7B 1A3BH 3GYLB 1SGDE 2GT8A 1FJSA 1MABB 1EJAA 3M3TA 1AUTC 1EAWA 1H8HD 1NFXA 4F49A 5FAHA 1OS8A 5EGMA 2BLVA 1BITA 3PTNA 1F5RA 2GP9B 1O3DA 4A1TA 1UVOA 2ZGJA 1SSXA 2Y81A 1UCYK 1DPOA 5E2PA 2XYAA 1ZSJA 3BG4C 5CHAB 1ESBA 3H09A 3BTGE 1TMBH 3LKWA 1G30B 3UPEA 1C5ZB 5EOKA 3UUZA 9LPRA 4IN1A 1O5GH 2FOAA 2VIWA 3BTKE 1C1PA 2XC5A 2GT7A 1QZ8A 1FPCH 1ZPCA 4JZIA 4FETA 5J4QA 3E0NB 4YOGA 2IPQX 3L3TA 4JK6A 2JJ2D 1EQ9A 5C1YA 3VXEH 4X1RU 1QJ6B 5DG6A 1W0ZU 1RGQA 2OK5A 1VITG 2FI4E 1GI7B 1NT1A 3ZVAA 1C2FA 2CHAC 1K1NA 2H9TH 1IQIA 2G5NA 2GV7A 1QL9A 2FOMB 1FONA 2BD5A 3M5LA 3TH2H 3EE0B 2OUAA 4CRBA 2GCHF 5K0HA 1Y8TA 2J92A 1QB9A 2VJ1A 1GBFA 4CBOA 1KTSB 1YBWA 2R9PA 3W95A 2BYAX 2FI5E 2QN5T 3T29A 5DP6A 1C2LA 1S82A 2XXLA 2BDGA 1J15A 1SGEE 1OOKB 1UTKA 1XX9A 2KM0A 1EATA 5EQSA 1GHBG 1B7XB 3WY8A 1DVAH 3RU4E 1PPHE 1GHXH 2FYQA 4WWYA 1P3EA 2XTTB 5JBCS 3PLPA 4CRDA 3DFJA 1SGFA 2Z3DA 1E1QD 1TMTH 4WY3A 4WF8A 2Z9GA 4ABAA 3BEIB 4AFQA 1V2PT 2B5TB 1D3PB 4K5ZA 2RDEA 1SPJA 2A1DB 5JDUB 1TNGA 4ZAEA 4A1XA 4ABFA 4Q7ZA 2CGAA 1D4PB 2Z9LA 1GG6B 5DK1A 2G55A 1V2VT 3PTBA 4A5TS 4D9QA 1GI5A 2WINI 3ZVCA 1A5HA 3PV4A 1V2TT 3SNDA 4YOJA 1G3CA 1AE5A 1O5FH 2IJOB 3KL6A 2JKHA 1MKXH 3KGPA 1C1TA 1H9LB 2AIPA 5C5NA 3GISB 3MU0A 5E0JA 3P92A 1BTYA 3OY6U 2QCYA 1TRNA 1CGHA 1AVXA 4B1TA 4JZDH 5ETXA 4BAKB 2BQWB 1SLWB 1E36B 3RMMH 3O8BA 1O39A 1W14U 3KIDU 3Q3XA 3BEUA 5F8ZA 2ZC9H
chains in the Genus database with same CATH topology
1A0LA 4X8SH 1T8MA 1IQNA 1HPGA 2A45B 3M3VA 5DP8A 5F8XA 2OQUA 3MO9A 2H9EH 3RXKA 3STJA 1KDQA 1NRPH 4I8HA 2OINA 1L0ZA 5HMAA 3A88A 1QQ4A 1TPAE 3UR9A 3BTQE 2Q6GA 1HLTH 1W8BH 2QAAA 1O2NA 1SI5H 2EI7A 1GHYH 5JBAS 1GJCB 2BQ7B 2Z9IA 4I32A 2PR3A 1C5VA 1S5SA 2FOEA 2G8TA 2HNTF 1GCDA 1XKBC 3R0FA 1LPGB 1SGQE 4CRFA 1OWJA 1BRCE 5BPEA 1GI6A 1HAGE 1O35A 3F9GA 3SZNA 3RU4T 3LU9B 1D3DB 3GY6A 1HJ9A 4E05H 3E0PB 3ZZ8A 2QXHA 2F83A 3MYWA 3URDA 1P2QA 1IOEA 1MBMA 4B2BA 1LDTT 2VH6A 2SGPE 4MPWA 1KY9A 2VIOA 1GBEA 1HCGA 1MKXK 1S84A 1E37B 2BLWA 3MOCA 3RXHA 2CF8H 3VB3A 2AERH 4K1SA 5EU8A 1EZQA 1BMNH 2JETB 1PPGE 2BDIA 1L4ZA 3RM0H 4UONA 4I8LA 4TWWA 1BCUH 2ZDNA 6CHAB 3BN9A 1C2EA 1KXBA 3F6UH 1CU1A 4HI3A 1GBJA 1AU8A 2A5KA 1WYKA 2THFB 4TYDA 3STIA 2VGCC 1GBCA 3C1KA 1GI4A 3FFGA 4Y7AA 1G9IE 1PPCE 4BAMB 5A8YA 3KHVA 1FAXA 4NCYA 2ESTE 1KLIH 1ZR0A 2SGQE 3MO3A 5EG4A 4DOQA 1BBRH 1TGTA 4ABBA 2BD2A 2BTCE 2P8OC 3MNXA 5LPRA 1JIRA 1TIOA 4KTCA 2XBXA 5A8ZA 1BZXE 3T26A 1GI0A 1BTPA 2TRMA 3GYMA 1DM4B 1YPKH 3EQ0H 3DA9B 1G37A 1HNEE 3OTJE 2Y7XA 4YTAA 1BDAA 3BTHE 5I46H 1NS3A 1CT4E 1DUAA 3GY5A 1M9UA 1K1MA 2R2MB 1TPPA 2BZ6H 2ALVA 2BHGA 4AYVB 1C5YB 1HB0B 2NWNA 3SU5A 1C1NA 1DITH 1YPEH 1ABIH 2VNTA 3ZZBA 3QGJA 1K1JA 1WCZA 1C1SA 1AIXH 1FQ3A 3UWJH 1YPJH 3V12A 1O5EH 4O3UA 2AMPA 1LMWB 1EXFA 2VVUA 3GCOA 2O8TA 3LONA 3DHKH 4B2AA 2J2UA 1P12E 2BMGB 2HPPH 1MU8B 1CHOF 1QY6A 4H6TA 4FU9A 2GMTB 2H9HA 1WBGB 2GCHG 2NU1E 4FXGH 2ODYB 4Y11E 4FUJA 4CRCA 3FZZA 4ZKRU 2AIQA 1FN8A 2ANYA 2STBE 2FIRH 4OS1A 3U1JB 1DFPA 1FUJA 2CJIA 1SB1H 1C2GA 4AGJA 1GHAG 2ZP0H 1HAVA 2F91A 1BTHH 1AKSA 1VCQA 3U9AH 1P03A 4NWLA 1WSSH 2CN0H 3AW0A 1GJ9B 3SJ9A 3QWCH 4INKA 3ZVFA 4JZ1A 2Q6DA 1MQ6A 4U32A 4XBCA 4Y8XA 1DT2A 5EPYA 4FU8A 4Y7BA 3U8TH 1GGDC 2V3OH 1QRZA 2A5IA 4ABHA 2ZFFH 3K6YA 1P2NA 3MMGA 3NKKA 4Z0KA 1MCVA 2FS9A 1H1BA 1HJ8A 3UWIA 3TNTA 2ZU2A 1N1LA 1P2MA 3UOPA 2HGTH 4E06H 1E35B 1SVPA 4MPUA 2XWAA 1C5XB 3V13A 3Q77A 2Y82A 1SQAA 3P8NA 1Z71A 7KMEH 1KYNA 1O32A 1H9IE 1HRTH 2ZTYA 4M7GA 4Y6DA 3SORA 2G51A 4DVAU 3PMAB 2ZDKA 1EAIA 2AYWA 2RA3A 1DXPA 2UWLA 3MH6A 4FUCA 1BTUA 4HZHA 4MLFB 5C20A 1C4V2 1W2KH 2BXUH 1MMJN 4CREA 1AB9B 1GBLA 1AI8H 3HKJB 1TLDA 1P04A 3GCHB 1O3BA 1BMLA 1PPEE 1O2SA 3QO6A 1PPZA 2FLBH 3TJNA 1NRSH 1P0SH 4K60A 3HGNA 1DLKB 4YESB 1WOFA 1GBTA 2PSYA 1EJNA 5FBEA 2ZO3H 2HVXA 2J38A 1G2MA 1TBZH 1RXPA 1WTGH 3A80A 3AAUA 3FAOA 2EI8A 1ZYOA 1JOUB 2BY9X 3KEEA 3RMOH 3S7HB 3RLYH 4OS4A 4AFUA 2BLOA 1BRBE 2OP9A 1NTPA 1GBAA 1Z1IA 3TGKE 3BSQA 5FX5A 1MTWA 2ZU3A 4INLA 2A32A 2BD3A 1OPHB 1ZSLA 1JRSA 3GY2A 3CS0A 1HAZB 1VJ9U 4D7FA 1XUHA 2XC0A 2WPJS 1ARBA 3A7YA 4SGAE 1MKWH 3CS7A 5E0HA 2BDHA 5F6MA 1E38B 3RXGA 1ZTKA 3GOVB 3U8OH 4LXBH 3M5NA 1KXFA 4X8VH 4IBLH 2GCTC 3U1IB 5A2MH 2ZU5A 8KME2 1V3XA 2HALA 2KAIA 1YLCA 3K65B 3H5CB 1NY22 4R8TB 1FI8A 2PV9B 2OC7A 4YO9A 3A7XA 3LGYA 2HNTC 2A4QA 1C5TA 4B73A 1C5PA 1HDTH 1TNIA 3A8CA 1TALA 2ZECA 1VCPA 3PO1B 5CE1A 1ELGA 2ZFSA 1C2DA 2Y5FA 2PHBA 5DP3A 1N6YA 4X2YA 3T5FH 3TLOA 2WPMS 1FN6A 4NFEA 3A86A 4GVUA 2FOBA 3KQEA 2GD4B 1LHCH 3VEQB 1W11U 3ZZDA 1TQ7B 1OP8A 3HPTB 3KCGH 1GMHG 3MNCA 1Y5BT 3BTME 1TX7A 2GZ7A 1OSSA 4ABGA 1UK4A 5H4IB 2ZDMA 1OWKA 2FEQH 3RUOA 3T27A 3BIVH 1BBRE 1Z8RA 2QXJA 1S83A 1O0DH 1LVOA 1VR1H 4I8GA 4ISHH 5EXNA 3BTDE 2P3UB 4VGCC 3PM3A 4NIVA 1NU9A 5GCHF 1IQKA 1LO6A 3JZ2B 2F9PA 2ZEBA 1GJAB 1FIWA 2FM2A 4ZXXH 1N8OB 4X0WU 1HV7A 1N8OC 2OQ5A 5FPTA 4AZ2B 4ASHA 1UTNA 2UUKB 1ZMJA 1P11E 1BJVA 1C5RA 4GPGA 4IW4E 1QBOA 4KTUA 3K2UA 2H2ZA 2ZWLH 2XC4A 6ESTA 5A8XA 5CHAC 1LHFH 1XUKA 1OP2A 2ZKSA 1O3KA 4JYTA 1O3LA 1FPHH 2F3CE 1C4U2 4RKJB 1WAYB 2P94A 2RA0A 2Y7ZA 1O3NA 1UTMA 5JYIA 2BM2A 3AASA 1ABJH 1S6FA 3VB7A 1ANCA 2TPIZ 1S6HA 2B0FA 2W7UA 1D6RA 4K8BA 9ESTA 4Y76A 2DE8A 4A6LA 3TK9A 3SV9A 1EB1H 3NK8A 4X1SU 2BD7A 3UR6A 1SGPE 1GBHA 1CE5A 1NFWA 2A4OA 2C8XB 2AS9A 1EKBB 1KLJH 1SGRE 4X2VA 2A7CA 2GTBA 1VZQH 3A89A 2PGQB 4BOHA 1O3IA 3GCHC 1AKSB 3UIRA 2BDYA 1O2LA 1C2JA 3LGUA 1QIXB 2FX6A 1A0HB 1YGCH 2I6QA 3GICB 1CVWH 1SGIB 2RCEA 4X2WA 2Z9KA 1C5SA 1O3CA 3ZZ6A 3N7OA 4O3TA 1ANDA 1SOZA 2XWBI 4K3JA 3QTVH 4NSYA 1ZPZA 1CHOG 5FXLA 1F0RA 1CHGA 1P57B 1OYQA 2EI6A 4OS2A 2H6MA 1A5GH 4XFQA 3M37A 3CP7A 1AFEH 3GCTG 4I33A 3A82A 2ZGBH 1O2OA 4X8UH 1E0FD 3ZZ9A 4LOYH 2FX4A 1UO6A 3BEFB 3SU0A 4D7GA 3SOSA 2WPLS 3KQBA 2GDDA 2ZG0H 4BNRA 3SUDA 1BHXF 5C2ZA 2NU2E 4X2XA 4JMYA 3BTEE 1MD8A 1OWDA 3GY3A 1RD3B 3MU5A 3OU0A 5CMXH 2ZTXA 3SJOA 4B71A 1GI9B 1KIGH 4SGBE 1CGJE 1V2OT 3SO3A 1FMGA 1ZHMA 1SL3A 1MU6B 3UFAA 3MHWU 1Y3YA 1JXPA 1BTWA 1QTFA 1MBQA 1EPTC 2A31A 3UY9A 4MVNA 4JZFH 1RIWB 1F0UA 1HAHH 1AY6H 1ELVA 1ARCA 1C1OA 4JYUH 1TNKA 3OSYA 3QUMP 3MNSA 1PQAA 1UTPA 3BG4B 4GHQA 1TONA 2RDLA 2YOLA 3SGAE 1THRH 4AG2A 5DP7A 2J4IA 4D9RA 1SBWA 2W3IA 1YPMH 1ELBA 3ATMA 1QBNA 2C93B 1BTZA 1X7AC 2QF3A 2OLGA 2TGAA 3LGVA 1DS2E 2XBWA 1K1OA 3FANA 4DIHH 3NXPA 4IMZA 1HXEH 1TABE 1YPHE 1K28D 5FCRA 1YCPH 5C67A 3H7OA 1C5LH 4FUEA 5GPIB 3BV9B 2ZA5A 1J14A 1HGTH 1DWEH 1GHWH 3ATWA 3ITIA 2G52A 1AUJA 3P95A 2LPRA 1BMMH 2BDAA 1J9CH 4VGCB 1FIZA 2W26A 1IQMA 5DP9A 3GDUA 1BTXA 1C5WB 2ZFTA 3Q3KA 1PPBH 1QURH 1TOMH 5DKMA 3S9AA 2IPHA 3TITA 6CHAC 3OYPA 1QHRB 3KNXA 1XVMA 3UNSA 1IQJA 3ZZ3A 1YLDA 4I31A 4I7YH 2P3TB 5E2OA 3DT0H 4IC5A 2JH6D 1TOCB 1C5MD 3A7WA 3EYDA 5AFYH 2GZ8A 1NM6A 1ZJKA 3PLKA 1BRAA 2Q1JA 4KGAA 1EZXC 3RXBA 2BY8X 1P10A 3QZRA 1TE0A 2ZCLP 3HK6B 1RJXB 1SQOA 4ZKSU 3RXJA 4ISIH 5DJ7A 1ZRBA 3BTFE 3E8LA 4UD9H 4YZUA 3UNRA 1GDUA 4F4OC 1BA8B 1ETTH 1HIAB 3EA7A 3GCTF 1DY8A 1C1RA 1C4Y2 1NO9H 2B8OH 1Q2WA 4NGAH 1HAXB 1RTKA 1G32B 1YPGH 1TNLA 3FVFB 2OD3B 2DUCA 1QRWA 1O2QA 4ISOA 4BXSA 3ZVGA 2JH0D 2OC1A 1P2JA 4K69A 1EJMA 4O9VA 1INCA 3VGCC 3VPKA 5FPYA 4FUFA 4CRAA 3LGWA 1ETSH 1V2ST 3PWCA 1JMOH 4I8JA 5T3HA 3PO1C 3SI4H 1T4VH 2XW9A 2HWLB 1W7XH 2W7SA 1HIAA 4CBNA 4Y0YE 3RXLA 1T8OA 4GCHF 2VWLA 1QQUA 3RXTA 1KDQB 1O3MA 1O2VA 2EA3A 2BVRH 2WV5A 1ESTA 3E90B 2VIPA 1TNHA 2GX4A 1WTHD 4OGXA 4BTTB 1ZJDA 2BY6X 3P8GA 4NA7A 1GJBB 3P70B 5C5OA 1QB1A 4WVPE 1F7ZA 2ZHFH 1GHVH 4Y71A 1A4WH 1O2JA 5LH8A 2W5EA 1S0QA 3RU4D 1EASA 1TGSZ 2J94A 3ZZ4A 2TIOA 4DJZB 4Y8ZA 1V2WT 4NIXA 2FLRH 1LVYA 1GVLA 2ZQ1A 1GJ6A 3SHCH 4KP0A 2BVXH 1BQYA 1QR3E 1RTFB 3SUFA 1AQ7A 1VGCB 3RXFA 1HJAB 7LPRA 4AFSA 3TGJE 2GGVB 3RM2H 1QJ1B 1LVMA 1XUFA 1KLTA 1XMNB 4HTCH 1RRKA 3MNBA 2D8WA 4ZHLU 3ELAH 2J95A 1GWAA 3SU6A 1C1QA 2CMYA 3AW1A 2ALPA 3M5MA 1SMFE 2BQ6B 3U8RH 1PFXC 1MCTA 5E8EH 2H5DA 3QGNB 4B2CA 7ESTE 1O2ZA 1TX8A 2FXRA 2VIQA 4I8KA 1K1IA 2ZI2H 4THNH 3SNBA 1MQ5A 4GSOA 4CRGA 5FHTA 2GVFA 1GMCG 4WJG2 2ZHWH 1YPLH 4NIWA 3SN8A 1UTOA 1UCYE 2ZU1A 5PTPA 1BOQA 2ZGHA 3UOUA 5FX6A 1Z8GA 1AWFH 5EXMA 1SGNE 4K1TA 1L1GA 2PLXA 3SV7A 4ISNA 2ZPQA 4X1PU 2AGGX 1O2TA 1K22H 1O31A 3MH7A 5GJ4B 2ZCHP 3SNAA 2V3HH 2Z94A 4TWYA 3SV6A 1LHDH 4IS5A 5LPEA 2D2DA 1O3FA 1L1JA 2A0QB 3RXQA 1A5IA 1V2NT 1UTJA 1P8VC 5HYOA 4YT7H 1N6XA 1YCPM 3T2NA 2ZGXH 4GCHG 3ATKA 4NA8A 2AEIH 4MQAA 3TNSA 3SW2B 5GCHG 2O9QA 4CH2B 1QA7A 1BHXB 1PJPA 1O5AB 1Z8JB 4MG3A 3V3MA 1O3HA 2QGRA 1TB6H 7GCHG 6LPRA 2OC8A 1CSOE 1J8AA 2TGPZ 1D3TB 1YCPK 3AVZA 2SGEE 4MDSA 1NROH 2QYIA 3DFLA 4GLYA 1DANH 1Z1JA 3RC5A 1O2PA 2P93A 1CBWC 3P8OA 3B8JA 1QNJA 2J34A 3VB6A 3TVJB 2AGEX 5T6DA 4KTSA 1K1PA 1ANEA 4OS6A 1WUNH 3A87A 1JWTA 5FPSA 2QC2A 3LGIA 4A1VA 1O5BB 4E7NA 4FVDA 3E3TA 1XUJA 1FDPA 4UFFH 1JRTA 2IOTA 1DWCH 1TX6A 1CGIE 4AFZA 2ZU4A 2SGAA 5JBTA 2ZPSA 2WYGA 3SU4A 3ZYDA 2C90B 3QX5H 2ASUB 2Y80A 4H6SB 2QXIA 4ZMAH 3I78A 1GGDB 4JYVH 2ULLA 1ZHRA 1C2HA 3B9FH 1UK3A 2IN2A 1Z6EA 2WYJA 1FY4A 2C8ZB 1C5NH 3BTTE 3JZ1B 2XRCA 1VJAU 3A8AA 1SHHB 2ZHDA 3P17H 2ZHEH 3GDSA 1YC0A 2VIDA 2FODA 4JCNA 2XBVA 2HNTE 1LPKB 3PROA 1ANBA 1DXWA 2F9VA 1O2HA 3PB1E 5AHGH 1AFQC 2FOCA 1ZMLA 3UNQA 1W10U 2C8WB 2C8YB 4DIIH 1FLEE 2OCVB 4UEHH 1A46H 5A0AE 1DY9A 4MNYA 3SHAH 3L6PA 1CO7E 1NN6A 3U69H 3M35A 2FOFA 1S0RA 3ODDA 3ZZ7A 1THPB 3D49H 4CH8B 2ZZUH 2STAE 1YP9A 4WXVA 4LZ1H 1GCTB 2FPZA 3E91A 1KXEA 1A2CH 4UFGH 3S0NA 2QF0A 3T62A 2PTNA 1SGTA 1NRRH 3MH5A 2ILNA 1EPTA