1FVFA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
590
structure length
543
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYVEKEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEC1
publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 187
structure length 543
sequence length 590
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvfA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvfA03
3PUKA 5BUZA 4BX9A 4JEUA 1Y9JA 1FVHA 1MQSA 4BX8A 5BV0A 1FVFA 2XHEA 4CCAA 1EPUA 4JEHA 3C98A 4KMOA 4JC8A 3PUJA 5BV1A
chains in the Genus database with same CATH superfamily
4LOJA 2DSNA 3PGLA 1NIJA 4BKOA 4DZRA 1BVHA 1V0JA 5H9VA 3JR3A 2J6IA 4FJYA 1E5VA 1OKKD 4UE3S 2IU6A 3O82A 1FPPA 1OGJA 3R9MA 1SOUA 1O6BA 2SICE 1CXZA 3DSSA 4UHHA 1L9KA 1RHQA 2D4AA 2R00A 1RCTE 4BVAA 3KYJB 4W5HA 4LE1A 5CA0B 3BGVA 3HBMA 4KYOB 5ALEA 1QGDA 2OCYC 4TMVA 1IHDA 1V95A 2GO1A 1P77A 3F5SA 2ZRAA 5FTKA 2HV8A 2VT6A 3JYLA 1BX3A 4RADA 1N2SA 5K4AA 4DLKA 1RJ9B 5F5LA 3ZHZA 4BO3A 2X4LA 3TB4A 2H1OA 5P21A 3GZ1A 3PB3A 1C7JA 3U56A 4RYLA 2ONJA 5K7SA 3NHYA 1OX6A 2Q5QA 3BJEA 3FCUB 3A05A 1TPYA 3VU9B 1WPXA 3VDQA 5EXSA 3GCXA 1JHYA 1E2IA 5AW7A 3GC6A 3LCJA 1DSSG 5TMEA 2LRHA 2QY6A 5JI2E 5DYNA 4PPGA 2PT6A 4AUEA 1JEDA 4JV5B 1A5ZA 3QPBA 4E6HA 2HF9A 1O5MA 3DEJA 3M1YA 3T9CA 3M4NA 4LHVA 3GN1A 1RBYA 4ND7A 4DY4A 4YCCA 3WNQA 2WEKA 1E79D 3CUEF 3BCHA 4KYUA 5IVDA 1ZUIA 3PE3A 4NE9A 4R6XA 1U2QA 4MGYR 4XQ9A 1TRKA 3QB2A 1H2EA 1QGUA 5CLLA 1IHXA 4MUXA 4HV4A 4KGZA 3ES9A 2QT1A 4TLDA 3NC0C 1B4DA 1D2HA 5I9LA 5DT2A 3D2LA 3VZCA 4KMSA 3IVAA 3TWVA 4FNOA 5TPWA 1IXYA 2RAVA 3AR7A 4G81A 4TSRA 5FZRA 3VAAA 1CDDA 5AKXA 3LJKA 2XNDD 5DBHX 1CZUA 3T8YA 4EBAG 4JENA 3N70A 1Z73A 1CUUA 2HHJA 3GZNB 4M4SA 2WJWA 1Y7HA 2IY9A 4LF9B 4Y6RA 2MSWA 1J97A 1YL5A 1M2JA 5DN9A 3RADC 3RS7A 2W6CX 2Y3AA 3LBIA 4KR2A 1NSYA 3A8TA 3KOZA 3UGQA 4TL6A 1ACJA 3LE8A 1QH0A 3NHWA 2ZUSA 3L6BA 3F0TA 1D04A 2YBEA 3B1WA 1KQGA 4MVJE 3AL0C 2X19A 3HKEA 2LP4Y 1FXSA 4TLCA 1CQIA 4DC0A 1H3FA 4DE5A 3V55A 3GCWA 2OUIA 4M3NA 4C87A 3GG2A 3ZY4A 1RM4A 1XG5A 2X13A 2ZI5A 1IOWA 3FRJA 2DKFA 2H9IA 3LXUX 3AERB 5KSYA 3DQZA 2J5KA 4R83A 1G5IA 3C7TA 3KFLA 4G5FA 4F1JA 3A1SA 3QK7A 1H3NA 1XTIA 4I9FA 3WJ1A 4NAVA 3T1YB 3VPGA 1G38A 1O9HA 3AJDA 1XDBA 1BW9A 4QG3A 3LCRA 4I3HA 1AS3A 5DIZA 4IOKA 1TW2A 1RYEA 3PSHA 4TM7A 1CRWG 2GPAA 5TB5A 3KVNA 3NG1A 1LQUA 1AMNA 1KI7A 3OD1A 3ZWXA 4J2OA 4MRMB 3M0EA 1Q0TA 4KO3S 4FLHA 3C72A 3WMGA 1XDSA 5A62A 1Z39A 4FIZA 4B76A 3KEAA 4JR0A 1JFFA 4L0QA 3P9NA 4NZNA 3WL8A 1SCDA 4ZK2A 2P4UA 3B38A 3R7FA 3WVNA 2AMFA 3C3EA 4E6EA 3M49A 5HOEA 2C0MA 1T9ZA 3OQ6A 1EHIA 1EXNA 3VR1A 1YRHA 3WRXA 2JKYA 3L16A 3TM4A 4U0JA 3K6SA 2L2QA 5FWXA 1VPEA 4Q9JA 4NDZA 4QYTA 4H9GA 1MJFA 4HP8A 5AJLA 1ZJ5A 1HYQA 2QFCA 4LYEA 3E1SA 4BTAA 3AF1A 4BNLA 1KDRA 1E2DA 1X86B 3NHAA 3PTAA 3O9MA 2HU5A 1AKQA 2VYVA 4QM6A 4PWZA 2EF0A 2ENWA 4MUAA 1DPFA 1MPXA 3TMKA 3QP9A 1TAHA 4QSHA 2CUKA 3EG5A 1B15A 1X7XA 4DG9A 3WLKX 5CRIA 1N36B 4PIVA 4GMLA 3FZYA 4Y6CA 2VK2A 2VZLA 5TPZD 4J0HA 1SNYA 2UUOA 1G16A 4X00A 4X8OA 4ZAWA 3DDNA 2R60A 2WVIA 3V00A 1A9QA 3LCMA 4PCVA 1M0TA 5C4MA 2AVPA 4TYMA 3DMPA 4G0WA 3KOYA 2WQ6A 3H5WA 3RJ5A 1RI5A 4AMGA 5DH9A 3KQWA 4FGLA 1S8FA 1Y9AA 2B6NA 4KR9A 4LS3A 4AKIA 1W4ZA 3LZDA 1BSVA 4YJHA 4YDWA 4ZI7F 4BLTA 4RTSA 1HQDA 2IZZA 4K88A 3Q8MA 3IQDB 5TX7A 4M9UA 1KT1A 4CKWA 2XD4A 1XBTA 5HJEA 4RJKA 1FX0B 1P2BA 5TQJA 2JK0A 3AS4A 4R68A 5TRTA 5ENZA 3M4YA 2PUCA 1E6EA 1LSSA 5IVPA 3HDHA 4OXIA 3KBBA 1PEDA 1YXMA 2D7JA 3CQGB 3QXGA 3P0HA 1HNXB 3EDOA 3PVSA 3E03A 4I36A 3GRZA 5K4HA 2FFHA 4C22A 3AF6A 1T26A 4ZC8A 1DC6A 2CXRA 4C6HA 2M6LA 1OYYA 1WKCA 2YMMA 3O8QA 4HRYA 2HN9A 4LJAA 3QLVA 5LBTA 2PH1A 2GF2A 2F1RA 5IYZF 3HCWA 1V8PA 4GLBA 3RNOA 5CNJA 2EFDB 2ZI4A 3BERA 3FSEA 4JL8A 1N77A 2P2NA 2NC9A 1WPQA 4ZO6A 4OAPA 2PZLA 1W4CA 3BIOA 2BZ1A 1SKYE 2PRIA 4QYIB 2F90A 2Y77A 2GZ2A 5LX8A 2FLVA 2XF8A 1N5RA 4G1VA 1DELA 3S8YA 2C94A 3HCCA 2R2AA 1FMTA 5L3ZA 1V8DA 2UZ0A 1JEEA 2P9IG 3OE7A 4RFLA 4JSTA 4HQRA 3IOMA 2B69A 1OIVA 5LD2C 4JVMA 4Q7KA 5KVCA 3S1AB 4UUOA 3ETDA 4N6OA 2QSJA 1P7ZA 3NVAA 3HJBA 3CLKA 2R5WA 4PZPA 1J09A 5B3JC 1WOYA 3JWGA 1VLVA 1LDYA 1OX5A 2AE1A 3K1AA 3I2HA 1XZQA 4UMDA 4MIYA 5LMCA 1V16B 1SUCA 4B6EA 1BU9A 1CTQA 4R81A 5DHFA 1VCOA 3MCWA 5AN8A 1I0LA 1E1NA 3EDQA 1SEPA 3EEFA 2VYVD 2GK6A 3CRZA 1TJ5A 4P36A 4A0SA 1U2TA 1YIOA 4C07A 2C96A 5GJCA 2PT5A 5B1YA 4KN6A 3BYZA 2PGLA 2Y4TA 2GROB 4BC1A 3SM3A 1VBMA 4ZT6A 4FZ3A 3ER9A 3OJXA 3RRMA 4EKGA 3D7LA 3HA2A 4K1LA 3KKOA 4HBGA 3BUAA 5TSDA 4PNHA 2QGFA 3SVTA 4GPIB 1WBJB 4N3AA 2CVOA 3GW4A 2WD9A 2WVJA 5C8VA 3SEQA 1RACA 4QGFA 5AARA 3OTOB 3S7TA 2EF1A 3HKCA 1SD1A 3P9RA 2D1RA 1KZPA 4QWWA 2VWPA 2FR0A 1SY7A 3ZIUA 2P9TA 1PJSA 2OV8A 2VWQA 4GOOD 1VDZA 5E7JA 3SS9X 1RKVA 4BO1A 4J75A 2BIFA 1XD9A 5JFOA 4F06A 3D2BA 3HV0A 4PC1A 3N8DA 5J23A 1A76A 1EWTA 2VSOA 3CG4A 1PDVA 1G20A 4HWRA 2NU7B 4PS1A 4RBNA 1GZUA 3PG5A 2CZCA 2EAUA 1JPNA 3W1EA 1R12A 4U0UA 2XYQA 1UDRA 2P6MA 2PNFA 5K01A 3GGGA 4ATGA 5LYJA 4JP2A 2PUDA 1UC8A 4M38A 5I9SA 4G0MA 1FUUA 2ACKA 2UVPA 1SM4A 3K70D 3VO1A 3BFXA 3RM3A 5EXTA 3DCNA 2XYRA 3UAOA 2M1XA 4HS2A 2Z58A 2F3QA 2O8EA 1UMCA 1V1RB 5ITSA 3OE7D 1TUIA 3HCAA 2QTTA 5FI5A 2X6TA 4B73A 1G64A 3O83A 3NZEA 5IKXA 2OCCE 1I51A 1I2AA 2C77A 2HB6A 5LKAA 1DX6A 2WG0A 5ALKA 3NCHA 2R6AA 3OTIA 1N0WA 2HA5A 4C4TA 4MHSA 1XTUA 3BQ9A 3M89A 2XTMA 3V2UA 4PLGA 3DF9A 4JJZA 3Q4AB 3TRKA 2CFIA 3NS7A 3AY6A 4IQFA 1JQKA 3RAEC 3KL4A 2E6UX 3OMLA 3WB0A 2AN3A 3PFKA 1LLDA 3EYAA 3SBEA 4I9HA 4CMKA 1P5FA 2VVTA 1YGYA 1DTEA 2CNBA 1WVIA 3QF4A 3H5RA 3D3MA 3TK1A 1VDMA 5CT6A 1A9XB 3WFJA 2EX4A 3ENVA 2I4NA 1PT6A 1RI4A 1N1GA 4GC9A 3S27A 1ZH6A 4LBVA 1KK0A 2TECE 4AC9A 3SCZA 1RCUA 3M9XA 1TK2A 5LCWC 4C0QC 3EH1A 2L0IA 4D9MA 3UCFA 3AF5A 4HAXA 4PHCA 3E34A 4A6EA 1COZA 3IJPA 2QMQA 2A86A 4Q6BA 1QKJA 4QXOA 2Q0SA 1Y89A 4Q3EA 3J81k 1MR3F 3CH6A 5HM6A 2F8YA 1MAHA 1LFDB 3DDZX 3TQIA 1DIOB 4CLEA 2NLOA 3GLTA 1VLHA 2G4CA 4LHZA 2IXFA 3NM4A 1OUVA 5COAA 3IELA 3FUJA 5BWMA 3G9UA 5U4QA 3Q7EA 1KZGB 5DHRA 2BCJQ 3T7IA 4CF6A 2AFHB 1R5JA 2V6JA 1KQOA 5JECA 3TI7A 3ASFA 1XPJA 2V98A 3OOHA 5B1SA 2PZMA 3L7DA 621PA 4CM8A 1IY9A 3FLEA 4M88A 1BQ4A 5IJ9A 4C1NA 4CW7A 4B1FA 4C0KA 1G5QA 2EGUA 1JDUA 4LPSA 2XR1A 1N2CB 5COBA 1LW6E 4NEHB 4H4CA 4MUJA 2AFIE 2IFUA 3A4YA 4R2WA 3UWOA 1U3UA 2BR5A 4MUKA 1T2FA 5K09A 4RU1A 3OT1A 4E70A 3S8MA 2HF2A 2QQGA 1X13A 3WQBA 1U6KA 3TD6A 2FRVA 4HI8A 1KJYA 1XK7A 2O8VA 5EIWA 4OLJA 4FT2A 5JVDF 3ZOZA 2OV3A 1E8NA 4NYMQ 5HK8A 3BXOA 3I2JA 1YDWA 2IH2A 5FA8A 3TNLA 1V25A 3GB9A 3QELA 2WV7A 4PHHA 1UJKA 4UQXA 3W78A 3OF5A 5IMBA 4B4WA 4BAUA 4U2BA 1A77A 1CY7A 2Z2YA 4EKEA 3P9KA 2I9PA 4BGDA 2G8LA 3DEZA 1FNMA 3ICQB 4RD0A 5LQKA 3KWLA 3GF4A 1D2CA 2JIPA 3ZG6A 1RYNA 3GWGA 3FKSA 4TOIA 4JKOA 5M5BA 5CPFA 1QQAA 2FJPA 3W1WA 2C9YA 5DZSA 5EIAA 2J0QA 2YNMD 4YDRA 2YW2A 2XVYA 1HLDA 4MYTA 1GITA 4W5JA 2Y2VA 1KH3A 4KKXB 5IVHA 3D8UA 4C4XA 2N47A 3R0XA 4R3UC 5CMYA 3DA8A 4HO1X 4BBZA 1FBNA 4BL5A 2V59A 2F7SA 2MSNA 2PSJA 4QDZA 2F8XK 5DBEX 3DVQX 5GVRA 3RREA 2X3UA 2BN4A 4ZYZA 4BRZA 1MCZA 2ZUWA 3ZD9A 3QTBA 3MPUA 4MYSA 4L2LA 3H2YA 3BHIA 4P98A 1YNSA 4DDMA 4HGPA 4ZI7B 1U0BB 1DJMA 1YB2A 2DH6A 1GTVA 2GEDA 4Q15A 2CLKB 2OSBA 5EGSA 1H0KA 3HB0A 2VDKB 1URPA 1HSZA 1HG1A 4DTIA 1JG1A 1PL0A 1UEXC 1V71A 5I3CA 3I5PA 2H4HA 5T4HA 1RI3A 3IR6A 1BRMA 2WXOA 3ZHEB 3KL2A 3RF7A 1UWKA 3R7WB 3CVXA 3NONA 1E0DA 1T3SA 3HRHA 2BEUB 3GRRA 4J0QA 4CM7A 4GZ6A 3OKFA 3FIJA 4OXQA 1BJKA 2XMPA 2Y0BG 1IKND 2V8SE 3ICPA 4X7RA 2XTNA 3L4SO 2UYHA 4YJFB 1YWGO 4MGEA 2QZSA 1C0LA 5AI8A 2XCUA 2ZXEA 3X2FA 4Z7QB 1LRJA 3VR6A 4DDVA 2PRJA 5LFAA 1DC3A 3WGLA 1V3TA 3RC1A 5DCYA 5LQRA 2VDLB 5D7NA 2ECOA 5IZCC 3GV0A 3TWUA 3AI1A 3EEQA 3CQ9A 1NN3A 1A4XA 4WNIA 4N7MA 5LQMA 5H4HA 4RTQA 1ZHFA 3P2JA 4XWTA 2PNJA 2BGMA 1K8XB 2UUAB 4MWBA 4EZLA 3BE5A 4S24A 2X2OA 1B0ZA 5DHAA 4OLAA 4WUVA 5JH7A 5DBKA 4P92A 2BFNA 1WF6A 4NZMA 2FMHA 4Q02A 4NOJA 1DE0A 3WO1A 3QX3A 1H2BA 1L6RA 3UINC 1Y6ZA 1F5NA 2L0XA 4OOFA 3VHLB 2P0AA 4QYXA 4V1CB 2J4CA 4PGFA 2H1HA 3FKSD 2PYIA 4D2IA 2DBYA 2GPSA 1XZNA 4BP1A 3K96A 1G3NB 1PP4A 4BWFB 2OK7A 2VGXA 3BORA 4C14A 1E6MA 1AF7A 1NFQA 1U2ZA 4RF4A 4II3A 2R2LA 5G3YA 1ZXBA 4PX5A 2BELA 4YONB 2D2XA 4G3XA 4BGIA 1LC3A 1GL6A 2D13A 5EIFA 4JFAA 4MKTA 4URYR 4CQNA 2RGWA 2IOYA 3LQQA 4Z86A 1Z3IX 4WZBE 2HJRA 2AUNA 5CT8A 4N5HX 2FPPB 4EY6A 1PV2A 4LISA 3RYIA 1O95A 4E85A 4OGLA 4J6FA 4KREA 1SQ0A 2Q9AA 4UVEA 3ZGYA 2P8SA 3B60A 5E76A 1RCFA 4C01A 4RQIA 1L5YA 1WSBA 4UEKA 3A9VA 3K72B 2JLXA 2DHRA 3A6HA 4BBAA 2A5FA 3WS7A 4DJAA 1GA6A 2W6IA 2WA1A 3C3QA 3I2KA 1YAHA 1JVNA 1LTXA 1CX9B 2Q5OA 1JH9A 1QNLA 4M0DA 3UG6A 4NECA 4UKDA 4KE8A 3DZGA 4MO2A 5JJ7A 1E5DA 2YHIB 1ESNA 3KSDO 1JSCA 5EWJB 3PLRA 2VPQA 4BNXA 2GKOA 4V39A 2R6R1 4FJZA 5FR2A 2B2CA 2ZIXA 1IWPB 5CRVA 1GTMA 1YS2X 4PYKA 1D7AA 5ED4A 1QBKC 3NHFA 2VAMA 4CKYA 2X8JA 1Y8CA 2UXDB 4W5TA 3GDGA 1XPOA 2OZPA 4BWVA 4IMJB 1UKCA 2FO1E 3DM9B 4RACA 3VR6D 1GSAA 4I17A 4D41A 4XDZA 3KKQA 1Y3IA 2NSZA 2FYTA 5CLJA 4KLAA 2JHAA 2VDJA 1JLLA 4TTJA 4ZAVA 5AVVA 1WB5A 5E6UB 1JDBC 2HUNA 3ESKA 1FLVA 4IXDA 1I1NA 4A2PA 4WNGA 3PRJA 4N7BA 1H4VB 3CVQA 4JLJA 2EYUA 4I08A 2CUNA 4AZSA 4Q4HA 4JLUA 3SXJA 3KZKA 4ENVA 1KOJA 2XGMA 2HZ7A 4JYMA 3GP3A 1KLXA 3U48A 1NW3A 1K6EA 3T5CA 2FHPA 5ALRA 2JAOA 1RWQA 1XTSA 5ENVA 5A0TA 3LOPA 5C4GB 3WK7A 2HMWA 4F1SA 4RDIA 4Y9SA 4TXNA 1CY8A 3TOVA 2ZBVA 3BWCA 3ZQKA 1G5FA 2R6JA 3FGOA 3AMVA 5BN3B 5KS2A 1PR4A 4TM8A 4NOMA 4G1FA 3AM3A 3T4UA 2OZLA 2FNAA 1Z7BA 5DYWA 2YFYA 3W4JA 2FEZA 5DE3A 4I81A 2YJ6A 2IDKA 2Q8QA 4KFSA 5IXJA 4C3UA 5TIIA 1DTSA 4BO7A 1N6KA 3I5YA 2H2HA 2C82A 2B7BA 1BWQA 4MIOA 4MV5A 5FUQA 1BU5A 4QFBA 2AC4A 3FUVA 7REQA 3DL2A 3B6ZA 1O95D 3OG9A 3WQHA 4PXAA 2M32A 2JI8A 3L77A 1OLSB 2PZ8A 3D3KA 2I1VB 5CLIA 3T5XA 2I3BA 3NTQA 3L0CA 1EP9A 2HLDA 3WSWA 4W7IA 2FEMA 4OVUA 1C4WA 1NXWA 1U5AA 2II6A 2W6ID 1VM6A 1M5UA 2FEOA 4ZEWA 3LJ3A 3E23A 3UICA 3D9LA 3U5TA 3APFA 4ILIA 4U5QA 2OB2A 3RS9A 4E31A 3K1JA 1RWXA 3AXTA 3AB3A 4HLLA 4RA9A 3Q5DA 1DQZA 5FUWA 3A1EA 3OFJA 2OCKA 5F4ZA 3PDIB 4KYVA 3GYZA 2NAFA 1NVTA 3C5CA 2ZQZA 5EZYA 1DXHA 4P32A 2YVLA 1IHUA 5EIBE 1RJFA 4CLDA 4J4TA 2Q2WA 2GCPA 1C3XA 1P5QA 3RVOA 4L73A 2AKAB 4J8FA 4B84A 4JJGA 1E77A 1SC4A 3PQCA 5FWQA 2R0QC 3TR5A 3FZEA 2CUZA 4RZQA 3JATB 3BZUA 3TIVA 1BE0A 1XCBA 5JVDB 3OOJA 1DQPA 4P4SA 3D4LA 3UJ8A 3SQMA 3DE1X 4Y18A 3ISVA 2O50A 1L4UA 2PS9A 3FPLA 1G5PA 1E3QA 4DVJA 5T8KA 3WDSA 4TKVA 2FSVC 4Q39A 1NVVQ 3ZVKA 3GJTA 3VX3A 4WPGA 4DV4B 1YB1A 2D8MA 3LLMA 3PQ2A 2NXEA 1ONNA 1U3WA 1DAMA 2J3DA 4JHXA 2AZXA 3KETA 3AVWA 5D3KA 4Z68A 1X8LA 5MN5A 1B8PA 2GZSA 2HO4A 4MVJG 5DPMA 3R3WA 3Q4GA 4NESA 3BK7A 3ZV6A 5B6PA 1FPQA 1XMPA 1RJGA 1HC7A 3TZCA 4KWEA 3BBLA 2PGDA 3FRHA 4LY9A 3OD5A 4HTAA 3REFA 4HEA1 3FSRA 1LTKA 3ZHYA 4NE2A 5JANA 2YXNA 1DC8A 3O2QB 5D85A 3T1VA 2P8JA 2JBAA 3TN7A 1HH4A 1QDEA 3G2KA 5CK4A 5L3SB 2F0YA 3QOWA 3JQBA 2NNLD 3JQGB 4LJ5A 1U7TA 3GJ4A 4GXQA 4JQZA 2J85A 4LXHA 2ZUCA 4U2KA 1SH7A 4MW6A 1O1RA 4TWZA 2C5SA 1QVWA 5E1DA 3SJZA 2PQ6A 5E38A 2I1QA 4AKEA 1Y4SA 3K0KA 4F1WA 2AWOA 5H7XA 5AJXA 2P0EA 4BEWA 1QCCA 2HLDD 2Q3HA 5BT9A 3DMTC 4I6JA 5KJMA 1ZBQA 2H54A 4JI2B 1N3IA 2BWJA 5CDGA 3L07A 3UWPA 2OOEA 3RS4A 3VR5H 2QTLA 4NMHA 1R0BA 4N39A 4DDTA 1S3IA 5CFPA 3QMWA 1YDHA 3QPCA 1U5CA 2KCKA 2ERYA 2H57A 1E62A 2FXIA 4FYPA 4JYCA 2CL7X 3V1YA 4AB1A 3ZYZA 1W29A 4JXZA 1LGYA 1RHMA 4OLHA 2CFCA 2B34A 3S68A 2GDZA 3KV1A 2VP6A 3JWEA 6AT1A 4OYHA 2E4YA 1TVCA 2FEPA 3WB1A 1YQQA 4RSRA 5LNK6 2YJ5A 3O8DA 5TS3A 3R5HA 4DLPA 4GNRA 1X15A 3KG2A 4EX6A 1R0XA 2OILA 1D1PA 1M7BA 5C0OE 2FE1A 2ATVA 1D7OA 2WC1A 1IBMB 1I4OA 1BD4A 2DRIA 4H7PA 1WXHA 2JCGA 3QV2A 4BAZA 1KI6A 4PS8A 4RAOA 2AFIB 3EJ6A 5AR1A 4DX1A 4UTVA 1LX6A 2EC5A 5DMHA 3VQTA 1LLCA 3KUKA 3JARA 3IYLW 1FDRA 3B2EA 1HUQA 3D7RA 3U37A 4M87A 1MJGA 2WZBA 4DN6A 3RFTA 2IX3A 2CVFA 4EHFA 2MJLA 4UDXX 1U0HC 1N2IA 2IYWA 3TDNA 4R16A 2J5RA 5FT9A 4GH5A 1CFJA 3PEVB 3DFFA 3KTFA 4YRMA 2LAIA 1H6PA 2PR2A 3LXRA 2OK8A 2ZCVA 1NMYA 4QDUA 1JILA 3THWB 1VPWA 3EHQA 4AIFA 3NRJA 4H6VA 2I91A 3ANXA 5ENNA 4IEEA 1W581 4MPRA 4OAQA 1Y7IA 3V46A 2WWWA 4INOA 1WQ3A 4E2YA 4QFVA 1W9MA 1CFZA 1AU9A 2D74A 4D6PA 2IOQA 1JNYA 4FGJA 3TO5A 3RYCB 1YQDA 4XUGB 4RENA 3IH5A 3X1JA 1G3IA 1UBUS 2ZWOA 3ZE6A 5AM4A 2C04A 2ORIA 4XCVA 1M6YA 3U9TA 4MMYB 4KIUA 5HYVA 4GZ3A 3ABIA 1XRRA 4ZO7A 4IIJF 3Q85A 4BZXA 2XAAA 1NT2A 3NXKA 2GRJA 1PFQA 3CHMA 3SVZA 3QWVA 1IUKA 1X7WA 2WU1A 4Q9KA 3QVUA 5AHRA 3STYA 4CBVA 1N5IA 5CU7A 3M6FA 3CNQS 1TYCA 3EVZA 2RK4A 2FQYA 4ECEA 2CDNA 2BEVB 3LQYA 4IEFB 2F9MA 4ZVRA 4Q82A 4HBDA 3UIEA 4TXMA 3G68A 1NAHA 4WLNA 3E82A 5EE9A 4FINA 2R5FA 2JIBA 3Q6NA 1OLUB 4BMVA 4F46A 4IDFA 3H1AA 3V97A 2Z2XA 3RODA 3TNYA 2C83A 2R1VB 2PJDA 2AVNA 1PR3A 3PV0A 3ZGLA 3JYQA 1KYTA 1XNFA 3FFAA 3FJ1A 4WZAB 3F73A 2HUPA 5CXSA 4ZN6A 4KXUA 3EZYA 5CYOA 2LNIA 3IDSA 4Y2QA 3SBDA 2OAGA 4AJJA 4F4DA 1WB6A 4ZFNA 4E12A 3RYHA 4WVFA 2V97A 1I2DA 2C29D 1E2UA 1N5KA 4LDNA 2PVPA 1XQVA 2O0LA 3A6ZA 5JSQA 2WICA 2GR9A 4O4LA 1SZCA 5HM8A 2OEPA 2NTYC 1M74A 5KJFA 3BTVA 2NU9A 1I7DA 2WMOA 4LRXA 5A23A 1USGA 4MH0R 4QJ3A 3WDMA 1QVAA 4HG2A 1XO1A 1KO4A 1AQJA 4GZ5A 3IP1A 3BG0B 3T5TA 1FDOA 5LMNB 3QSYA 2WE8A 2VOEA 2VHUA 2WTAA 2GK4A 2P3OA 3PR2B 4BECA 1B93A 4D82A 1KWKA 1YVPA 3RG8A 4FFLA 2B9VA 4TS9A 1RMQA 3LH5A 4RFSB 1NT4A 5A3RA 1DQSA 4IIBA 3B82A 2RKWA 3JCZA 4C4YA 2J3IA 1OH6A 1PZNA 5F33A 1D8AA 1NMSA 1Z13A 2HY7A 2BC9A 4X9XA 1VL5A 2VJQA 2JGKA 3DKKA 2AF4C 2VHQA 3ROMA 3E37A 4MPTA 3OLVA 4OP3A 2EWMA 1O89A 2WUGA 4EY3A 5DHTA 2XADA 3OJEA 3KZNA 2XUGA 3PUYA 5CDFA 3AEQB 1GR0A 4Y8VA 3WLLA 4U02A 1HNWB 3TL3A 1CV2A 1U7ZA 4ZU6X 4TXJA 3MAAC 3C3JA 3UM2A 5FI0B 2CZQA 3IPCA 4JVSB 1E1RA 4U2CA 2WPVA 1H6AA 1QIIA 2FETA 4ZA2A 4LGYA 4IOMA 5U4XA 5IW8A 4Q4LA 3K0EA 2M6RA 3FDJA 3FMVA 2RHCA 3LY9A 4B0ZA 4D81A 4FP7A 3FCOA 3I3NA 4N0EA 1WDWB 2WVAA 1WB9A 1QLHA 1LBHA 4QPNA 3WK8A 5DBFA 2WJVA 2UUBB 1M6VB 3GZ4A 3K0SA 5FH9A 2PUEA 3B3FA 3ASHA 3N0RA 2X6QA 4EG5A 1EFRA 3LGSA 3MWLA 4LERA 3ZJVA 1MTZA 3CRQA 4DR1B 3ZOKA 3G0DA 4P7BA 1MA0A 4RGBA 3LYAA 1BKSB 5F98A 2VXYA 3COPA 4IQGA 1GUYA 3KXDA 2AFHE 2WFZA 2PO7A 2I6HA 4C4ZA 3RO2A 2QRQA 3GJ3A 5TARA 1R6AA 3U7FB 4B6GA 3UK7A 3MOIA 4ISCA 3IQXA 2BUAA 1NATA 3TXMA 1OFTA 2J9XB 2HADA 3EQ2A 3RNLA 1YJBA 2RI6A 1IQUA 1RKQA 4UHBA 1N2CE 4DUIA 4DLNA 2JFUA 1CYEA 3I5UA 1XU9A 4D96A 1S70B 3S8EA 3UUWA 4K2HA 4WUTA 2ZSAA 4HEQA 1U28A 4RLQA 4IXWA 4QHTA 1NDQA 2QD2A 3WP1B 4G8JA 3CKYA 5IEBA 3OCXA 2G06A 5JAZA 2RGNC 1N6LA 2B1GA 3ZWAA 4IFIA 1QTIA 3IIJA 4PAMA 1YOBA 1R0CA 3N9IA 2PBFA 1OD6A 3KQMA 5JJ5A 1LPOA 4HB0A 2A0WA 3R5TA 5AKLA 2OTCA 4G11A 1V5EA 1TCBA 1M2WA 3HGTA 2OD7A 5KOJB 4LXQA 1E1MA 2IW3A 1J2JA 4D0GA 1DRVA 2QL7A 1N0IA 1GV1A 3MLEA 3R3YA 3M3DA 4CDRA 2FPXA 4S1TA 3HSSA 3ZBPA 3FMOB 3OURA 4UDNA 3I3OA 3K9NA 4ZHQF 3TGLA 4LDPA 2CD9A 3FHTA 4NXMB 5TMDA 3FTPA 4MR7A 4DJDC 1C9DB 3HCOA 4IG4A 3AIMA 2JKZA 1E1RD 3BK1A 5EY5B 1Y8ZA 4LOAA 5FRDA 2Y4NA 4O2LA 4PFKA 5TPZA 2JIDA 3OOEA 3ZIAA 4GI7A 2XQGA 4E2WA 4BB5A 1OFGA 2HH9A 3JTMA 4HDKA 3ZKJA 3JX9A 3K5HA 5JBIA 3E5HA 2RGCA 3TSCA 1MLDA 5KPJA 4B6PA 1XZBA 3ONKA 5EYPF 2XTZA 2IKQA 1T36B 1DFHA 1HO8A 2ZIRA 3E32A 1KQ3A 3FWHA 3PGJA 1EFRD 3VOSA 1T5BA 2VGYA 3FLBA 4Z8XA 1HDIA 1UPUA 3ZC3A 1CHDA 1W94A 2PAAA 2G6TA 2OOSA 1WKVA 4MW5A 1JXMA 5GIPE 2VTKA 3R0QA 3B13B 4KR0A 5EXPA 1KU6A 1P2UA 4KUHA 4JBNA 4G84A 2FZCA 4JBWA 4PZCA 3OLXA 4G0UA 1G8YA 2P65A 5LP6C 1U8FO 5IVKA 1T29A 1PUJA 4HZGA 3JW8A 4YCDA 4DDUA 1V48A 5JASA 5CYFA 4BNGA 1LF5A 2QBYA 2CB0A 1UMBA 2Z30A 1NL4A 4KPEC 1JHZA 5KWJA 2E0IA 2QN8A 3I4CA 3PFNA 3X3HA 2QRNA 5KQRA 2RC6A 4DV5B 4BKQA 4ERNA 3E1KA 1BE8A 3T3MB 4BDTA 2DWQA 2B4YA 5A4MS 2RJOA 3DBHB 3F5QA 1N4DA 4A0QA 3UHJA 2XQFA 2KX7A 2XA1A 4JOQA 4JU9A 3KQLA 2A3NA 1IMOA 4DMMA 5BV7A 1S2OA 1B0UA 1P9NA 1WX1A 4P5EA 3ZWYA 1NBME 1XA0A 1WCV1 4Q3OA 4YNDA 2NU6B 3PRKE 2WKRA 2PVSA 3KZOA 4GX0A 1GPDG 3D0QA 4YJ2F 3THYA 2ZCJA 1NW6A 5F5NA 4L5IA 2FUKA 1Z7YA 4R05A 2QGNA 4B4DA 4LK3A 1J4AA 4HH0A 2I7XA 1E7VA 4ENTA 4Q6WA 4BS9A 4RNDB 2F2TA 3A31A 4LVOA 4KVMA 2BHSA 5LQNA 2GRUA 4J3NA 2P75A 1VL2A 1NC3A 1KY5A 4ARVA 2PRSA 4TZKA 4A9AA 4YK7A 1TQDA 4X85A 2Q3DA 3LNTA 1XLTA 3DE5X 5F4BA 4ER6A 1RLTA 3FYCA 5F23A 3PDNA 1DUVG 3W34A 4UBNA 3JQAA 4YBZA 2LZ0A 3LCUA 5D0OD 4IIJB 1YA4A 1XDDA 1Q5PA 1TM2A 3ABRB 3G49A 1DOAA 2WTXA 1QFJA 3ISJA 1N8NA 3ZWDA 3VO2A 4RPKA 4G6ZA 5CCEA 2W2OA 3I3SR 1K27A 4HNUA 2D06A 2X0JA 2X0EA 4FK8A 2QF7A 3NVDA 3ZIAD 2NQ2C 5IM4A 5A06A 1BX0A 1T0JB 3LGAA 4HTFB 1DDIA 3TZQA 1G18A 1SXQA 3GJ8A 1J2RA 5E2AA 4F4CA 3NORA 5JSKA 5J5VA 5J2TA 3IIEA 3D6MA 3J7AC 3P52A 1XCMA 5BN5A 1GWNA 4MP6A 1T2CA 3FTDA 1QKIA 3RBZA 2OVFA 3T35A 3OZXA 2HSJA 2FR8C 4JEUA 3G0GA 1A7KA 4KV7A 3J80A 2ODNA 2FB9A 2OXIA 2O5CA 1IY0A 4CIBA 1XD8A 1E9FA 4N0QA 4IH1A 4BNMA 2GO7A 4L5JA 4MI6A 4DC9A 1UBTS 1X92A 1M2VA 1H0AA 1CEEA 3VVLA 1C7RA 3BDAA 4EW2A 2J07A 3C2QA 3PFCA 2QMYA 3WYGA 4GNKA 3LKBA 1KMHB 4C0MA 1ZK2A 1JJ7A 3LUCA 4ZU1X 3PGA1 4OI4A 4BUJA 4PZ0A 1G21B 3RARA 2A58A 2WXIA 4LXYA 3DNPA 1HH8A 5FUMA 1DKUA 2BMFA 4XR9A 2ZYHA 3PRYA 3ORHA 2OZVA 1X7DA 2I78A 2VA8A 4MV3A 5KYWB 1OWPA 4POAA 5LDGA 1US8A 2HFKA 1D9SA 3O8OB 1J24A 3OICA 3ITNA 4CM4B 4LYGA 3MCVA 3R6LA 3BDVA 1AKMA 1Z3XA 5JMTA 3HNOA 2IGTA 3WLAA 3E8SA 3V6MA 5KWIA 1V9LA 5E4YA 3NPAA 3V1UA 1BCRB 3B1VA 3VZRA 4R51A 4NG4A 4FQ7A 5CCDA 5HKAA 4DK5A 5AK0A 4LGMA 1KNQA 5FJIA 2GQ0A 5CJ2A 1UKEA 4ME2A 4J0DA 3UA4A 3U31A 3VU8A 5HIMA 3D6NB 4UATA 4IQ4A 3QHQA 1QRUA 3THOA 2P2DA 1ZJYA 4IDOA 4OQQA 4BQPA 4KX5A 2ADMA 3DLCA 3I9OA 1N2XA 3QA9A 1RKXA 1VMDA 1ZCFA 1MB3A 3ZU3A 2VHJA 1ORIA 2WF5A 2BKLA 2VFAA 3CV3A 1O8BA 4YO8A 1BNCA 1NG9A 1DKQA 1EGHA 2FZWA 3VTKA 1AURA 3MA5A 3LLUA 2KW5A 2ZTVA 5LBIA 3GPLA 4JCOA 4WNYA 1DDOA 1GUZA 2CKDA 4GUAA 3AHFA 2M9MA 4Q9IA 1XDUA 3O3CA 1Q1NA 3JQAD 1TUGA 2CMGA 4ZQBA 3ACCA 3V2GA 2PKYX 4GGMX 4F6RB 3O3NB 2ONZA 3GGSA 3C8MA 1OWMA 3FULA 1TJ3A 1TVMA 5DV9A 4N49A 2ZBDA 4RD3A 3T5BA 5B1EA 3RUCA 2XEHA 2QYTA 2R8PA 2FE4A 4TYPA 1E1YA 3NYRA 1A9SA 4G24A 1V8FA 4XVQA 5G05C 4K9PA 1ACLA 5DISB 3RTGA 1ZCZA 1YBFA 4MARA 2Q6TA 4DMRA 3I28A 4RVFA 4DYHA 1KIFA 1WM5A 1ZRHA 2X1LA 4JH0A 3OJWA 3S99A 4BTVA 3T7CA 1L7QA 3NDIA 2JFZA 3CK8A 3TFQA 2YJGA 4YUZA 1M8KA 4H27A 3ZEAA 3RS3A 2JF0A 5EJEA 4LNUA 2X4GA 4FKZA 2RBEA 4OJYA 1LBTA 1JU9A 1S01A 3RU3A 3LVFO 2O2ZA 2KSQA 1RYZA 3V5NA 3CLUC 1AO0A 1C0EA 4KO8A 3ZDQA 3GAAA 1R7RA 5K0NA 4V0ME 2NWQA 1D9XA 5KHLB 4Z51A 3NC4A 4F9FA 2NOAA 1NI4B 3D1LA 4ZGWA 3RUIA 1OC4A 2ISCA 2FWPA 2ZBPA 2CMFA 3IV0A 3O0TA 1QJCA 3JD2A 1U4NA 4MINA 3K3PA 1E7RA 3ABQB 4RGYA 4G8LA 1C81A 4CQLA 4HVBA 2GD6A 4C4AA 2B4KA 2IS6A 4CQMB 2WLSA 4QUJA 4JX8A 3UM9A 5SY6A 2W48A 3HG0D 4Z9BA 4KXKB 5IJAA 4WLVA 1JQAA 4CLOB 2BJWA 2ZWAA 4QEZA 4H35A 5JQGF 3AP1A 2LCIA 1U3CA 2X38A 2DWOA 1N3YA 2B25A 3DPIA 4QBGB 3ZVRA 1ZD3A 4OIMA 1Z5SC 1CY2A 4W5OA 3GRAA 3O2SB 3JUIA 2QVZX 1FMCA 2YWXA 3L1KA 5IP5A 3Q8XB 4LYDA 1TF2A 1A2BA 4PYQA 4RMHA 2XEEA 2UDPA 3IULA 4QG7A 4F2GA 2GXSA 2E87A 3ZV7A 3ZN2A 4GBMA 1OZAA 4RSYA 4J0UA 4QX6A 5BOSA 2J7PA 5B30A 4I1VA 4F60A 1UJMA 4S05A 1YCGA 2B9EA 3HBNA 2IEDA 1BVRA 1IIBA 4A1SA 4YJ3A 1IEQA 1B41A 4ZHQB 3K6RA 5EIEA 1JDSA 4KGVA 1VPTA 3H97A 3ZCSA 1QV7A 5D5HA 2K2WA 2DZDA 2Q3EA 1UXJA 5AQBA 2YNMA 1BGXT 1V9CA 2Y76A 3MEQA 5LSAA 4RSHA 4YV0A 1FLDA 3UA3A 5DGTA 4LXTA 1IXSB 3MGKA 2QB5A 3CUYA 4H6XA 4LZNA 1TLFA 1JPVA 4NCNA 2P9YA 4OKNA 4JHJA 4DOMA 2W8BB 2G9NA 4A6PA 3IMFA 3R7NA 4C89A 4JI1B 5EYPB 4X8HA 4D9EA 3ZJ5A 3GGPA 3ZE8A 3V2HA 1RRKA 4YRZA 1U80A 4OHWA 2ZYAA 4DZZA 1WW2A 3CSDA 3RWOA 2QLNA 1EGVB 2HDNB 2IO3C 4FADA 1Q0LA 4Y9RA 2PXAA 2CL5A 4JA2A 4LNUD 4CHTA 1LLUA 1Y48E 1JKMA 3E6AA 1HEYA 4NVRA 4ZPXA 4ZEVA 4NF2A 2XHZA 3V8BA 3HKBB 4U8HA 1UK6A 3EXEA 1CP3A 4L3WA 4V38A 4CKCA 4IMRA 3TG4A 1K1AA 4HOUA 4W8GA 1ZN8A 2X9NA 1E9EA 1NONA 4HGOA 2C7OA 4N2QA 2A1TR 3HJCA 3AFGA 3WB2A 3CO5A 4MI3A 2XMRA 5SYNA 2MMCA 1MPTA 5IF9A 2ATXA 1G2IA 3OCWA 1RPNA 2O4CA 4GT1A 4UZEA 2CWDA 3W4IA 3I5AA 1ELRA 2E5WA 4RF3A 3ZCXA 1AXGA 4YJ2B 1UXHA 1VKOA 4QBTA 2YOGA 2AJBA 1ULBA 5TGTA 4QO8A 3URZA 4ABYA 1NN0A 2GFQA 4HPXB 3JAKA 4IXTA 4NK4A 1YO6A 4LSMA 4CI0B 3R20A 4EHLA 3E5MA 2NVUA 1TCAA 3MV3B 3NPMA 1HXIA 2FZGA 5JDIC 4F2HA 4DIKA 2FZVA 2MYTA 3HYRA 4A6XA 3OZSA 4J8EA 2CFRA 4WBNA 1VLLA 2IEIA 2J7PD 3B8HA 4XIIA 1EM8B 3OPMA 5BPHA 3V32A 1HYGA 4LJ8A 4ZPJA 3SZUA 3C4QA 1LPPA 3QQ5A 4X97A 4X1IB 4P1ZA 1VSUA 4GLOA 3EXIA 4EJSA 1YV9A 1HT1E 4MULA 1KDTA 4RF2A 4RTRA 2ZYGA 2V7UA 1DPGA 2OT3B 2WF6A 3ZJUA 4F4HA 2DHQA 2C9ZA 4NI5A 5A05A 3M9LA 1AN0A 4FE4A 1DAKA 4DABA 3PHJA 2O2IA 4B3IA 3AUAA 1PEKE 1WA5A 3T1NA 4YGXB 2FPWA 4OUKX 1DIBA 3WXBA 3MD0A 1XFDA 4PY2A 2QAGA 4GECA 3LUPA 3L8DA 3EUFA 2PSDA 3PZ2A 4TN1A 4F4JA 4PUCA 4E21A 2R6GA 4TKZA 1S8AA 1MDFA 2Z09A 4UREA 5LZ7A 3U7JA 3LYLA 4C7XA 4FJ1A 1FUIA 5KOHB 5EP4A 5IBPA 2FWIA 4D92A 2VJKA 1C9MA 3H5NA 1NP7A 2Y1EA 1S64A 4FW8A 4BFRA 4IO1A 1N2JA 3IXEA 1FUYB 1UBKS 2HRDA 2IYUA 3AVOA 4QOGA 4C7OB 2KZTA 3ZGXA 2VC2B 3QLTA 5DGHA 1II9A 4WCFA 1HFKA 3U6BA 4KUEA 2J49A 5CLQA 2CLOB 1XGKA 1DCQA 5SZIA 3ONNA 2GYYA 4FYXA 2PL3A 4AMZA 2H4WA 4A1FA 1PHPA 4BJHB 3ED5A 2H31A 5DSXA 4XJXA 4BTLA 1E2QA 5FYQA 1E59A 4R2MA 2ZK7A 4KBFA 4GQAA 4HDNA 4CNQA 2PUTA 1XZEA 2QMUA 5IYZB 3HNPA 3NU1A 1AHNA 3CF2A 4WZAE 4FFSA 2VUSA 3U7GA 3NBUA 4PFSA 4Y1RB 5EQJB 3EQ8A 4H31A 4TV9A 4XD2A 4EF4A 5SV2A 1MX3A 2NX2A 4WESB 5AQAA 3QVSA 5H02A 5ILGA 5AHXA 1KZ9A 3P97A 3L0OA 3ESBA 2TSYB 3U1BA 2RI0A 3C1OA 4QODA 2NUBA 1BEZA 4F97A 4I5EA 2QX4A 1WZCA 5AJTA 3X43A 3A3YA 1OFIA 5JS7A 3FYUA 5K0BA 3GA7A 2Y2UA 4TV8A 4NYIQ 4BNDB 2WXRA 2PFKA 4F9EA 1R8QA 3GGDA 5LQDA 3BS4A 1N2ZA 2X86A 4P3OA 2XDAA 2ZZMA 5JCXA 4KYIB 4K6HA 3T7DA 4QIHA 1O0CA 1NXOA 3C45A 3M8KA 1SIUA 4MIEA 1WCIB 1MDBA 5CTAA 3UN1A 2QAJA 5JNSA 3QAQA 2CSXA 1Y8QA 2PH5A 5BPFA 3PEUB 5C35A 2ZSEA 4HDQB 2FUEA 3PXEA 2GWRA 1S96A 3W6ZA 4BFZA 2C7GA 1RYFA 2G1PA 3UQZA 4D3SA 1MENA 1Q19A 5JPDA 5F1KA 4OKIA 3DBOB 2D4HA 3ZDEA 5AI5A 2J9FB 1MIHA 3DONA 4TQ9A 5K3FB 1ZHOA 1TVKB 1QZUA 2FUG6 1N5OX 1ND6A 4IDGA 2Q5JA 4GKKB 3JYSA 1GL3A 5IAOA 1CDOA 3QYPA 4YACA 4NHEA 4KSYA 16PKA 1JXAA 1GCOA 2XQ0A 1H9BA 2OFPA 1YMQA 3UF0A 5FXMA 5L4SA 3G3EA 1L4EA 4NBSA 3O8BA 3O4GA 2ZSKA 4A8JC 1JR4A 4AYXA 2CFZA 2YL2A 2C5HA 4LXIA 3TMAA 1O6FA 2YY5A 1W87A 3ZNPA 2QRKA 2ZPUA 3BD8A 2HTFA 4DR3B 2Q6IA 4H7KA 1ZH2A 4EY7A 2GJ4A 3R0VA 3DEHA 3WL5A 5D5QA 2KLBA 3SF0A 1AZWA 2Q2VA 3OMXA 2DVMA 3S1SA 3ETHA 2P6OA 2P62A 3N8HA 3MWDB 4MQUA 4G8DA 2HW8A 3I9JA 3PQ5A 2FLWA 9LDBA 1IBCA 3RDPA 4ATNA 3QFSA 4HH4A 2IIQA 4Y0VA 3FWZA 4MWZA 4XE5A 2FULA 3L43A 1TEHA 4YPFA 1QFMA 2JD2A 2HLHA 5JQGB 5HF8A 1DG3A 3GXOA 3V8VA 1P7CA 1ANKA 5FINA 2BJVA 3ML9A 4FBMA 4M1OA 5JT1A 4BNVA 3W77A 3LMKA 2FWRA 4H7YA 4CIXA 2PFGA 1TO1E 1UEJA 2X1MA 4HR7A 1DADA 4WDQA 3G2SA 1TZCA 1F17A 1C1HA 1Q12A 1ZUNB 4MA5A 1QM5A 3TX6A 3VR4A 1CJBA 3ADOA 3QGMA 2OFXA 3LS2A 3EEIA 4QPPA 2WJGA 4DSAA 4C6TA 1EFVB 4YH1A 1SXPA 2HSEA 1VBKA 2GN1A 4DCOA 3A3OA 1TMYA 5AM5A 4CTNA 3CVVA 4JDPA 4V3CA 3DBVO 3GVHA 1ES9A 1WZNA 3OXFA 2H65A 3P20A 5F1OA 5IDYA 3ZY2A 3FTXA 1ML4A 1QHIA 1G1AA 1LVHA 1NVWQ 1L4BA 3CJQA 4YV7A 4GOMD 4PQFA 1W6RA 2OPHA 3SYKA 4AJ4A 3EULA 3DMNA 4KK4A 3E22B 1AMUA 2Z3WA 3IBYA 2HGSA 3KIPA 2A0YA 4TUMA 4FONA 1H94A 3EDMA 3SNXA 1KPIA 4RVSA 1ZK3A 4L5AA 4XDHA 4HWTA 4NJEB 1UN8A 1B8VA 2O8BB 1QWOA 1UF9A 3PDUA 5J90A 3CSSA 3IT1A 1W6UA 5KKAA 3ESZA 1ZMRA 4YB8A 2CDBA 4NJMB 4CV1A 5EN5D 2LUOA 4FX5A 4DHWA 3VYWA 2CHGA 3NBXX 3LX8A 4JT8A 5LU9A 2Z5LA 4MR9A 2J32A 3NQPA 3TW8A 1RPAA 4FSXA 5IUKC 1JUDA 2GRRB 3R2JA 4TKUB 1AKEA 3P8ZA 3ZHBA 2NACA 1MP0A 1KMQA 1OZ0A 3I6QA 1A9RA 5CDUA 4JJEA 3A58B 3WGHA 1GQRA 4L72A 1T1JA 3M5DA 4O02B 1YZNA 5SYAA 1RU3A 3TJRA 4HI0E 3HHPA 4I8IA 4RULA 4RH0A 3MJWA 5HNKA 3O1IC 1GN8A 5AW6A 2FN8A 3OM1A 4E08A 2GZAA 5DI3B 4G5RA 3K35A 4YAIA 2BW0A 3LA6A 2E49A 2AL7A 3CKMA 4IF4A 2AI3A 1SBNE 3EEOA 1GZVA 5HXAA 4FFBA 4XOIA 3H4VA 4AF7A 1ZD1A 4UCWA 3PQDA 3OIGA 3PQ8A 4M89A 3T9AA 2HBZA 2BGKA 2A5EA 1JEYB 1CQPA 1KAQA 2HQ1A 4P3YA 2R84A 5HJ7A 5G55A 5TLSA 5IY5E 1FJ2A 1O9GA 3DVAB 3VR4D 4N6NA 4IGIA 2FSHA 4QELA 2H0RA 2I2DA 2NSDA 3QY9A 3FU5A 4WXRA 4HFNA 1H1LB 3TLGB 4DLWA 2Y05A 1UFRA 3OX4A 3B95A 4B71A 5HW0A 3OZ7A 2WDZA 4JFRA 1JA0A 1FXUA 3T15A 2OHHA 5HE9A 4H60A 3RVMA 2B35A 1JCSA 3EXHB 3DAHA 5U1PA 1V4NA 4YCJA 1BLXB 4F72A 1DJQA 1ZD5A 2KQUA 4LECA 3SHOA 4JYAB 2VDUE 3FCSB 3IERA 5AOAA 3I04M 2LE0A 2JZCA 2B1JA 4UTPA 1THTA 3M5CA 3UKJA 3LKUA 4BJ6A 1VIVA 1WMDA 2PMCA 1NR1A 3F3YA 4DLQA 2YWGA 3SEZA 1HE8B 2R8BA 4X1KB 1YK0A 1FFSA 1YZTA 3ETLA 1S8OA 2A5UA 5CDTA 5C9ZA 4HMPA 2JFVA 4L23A 4MB0A 3MS7A 4D26A 4AULA 2B92A 4LCBA 1NU8A 2W5UA 3WWYA 4N1AA 4PICA 3OQ1A 5EE0A 3FVQA 1SC1A 5K8LA 5L4LA 2EZ9A 3FDFA 4RY8A 3ME5A 1QCYA 3IAXA 1K6MA 2HF8A 2P4HX 3SBOA 3OXLA 1BI7B 5CRUA 4KN8A 2GK3A 5ALYA 3ZPJA 4EPXA 3MZLB 4NZOA 4CIVA 2GVDC 2ZYUX 2Y0EA 3EQ9A 2YFQA 4KACA 3DHYA 1M2EA 4IIFA 1IEVA 1LI7A 4KQXA 3MB5A 1DAEA 2V45A 3IVCA 4WOPA 2D0DA 3H9BA 2LPMA 3VKWA 1P9RA 2F00A 3E4DA 4KQGA 5G4KB 3KYCB 1UBMS 4D99A 1XVLA 3AP3A 5T64A 3R9XB 3SG0A 4O1OA 3PC4A 3E5RA 4HWGA 1GZ5A 3K8YA 1D2EA 3K0FA 2QX6A 2EZ8A 3EGEA 1NDHA 1NV9A 3U3RA 1TJYA 4TUYF 2IYQA 5AM2A 4C7VA 3T38A 5DXJA 2ZRHA 1G21E 4QU8A 4ZP1A 2VZEA 1XAHA 2BGLA 2GS9A 3IURA 3HN7A 3WR5A 3CINA 2ZZNA 2PZJA 3KKKA 3IILA 1G17A 5BNTA 2Y1GA 1OH7A 2CGEA 3E2MA 3HYMB 4DBVO 3ICEA 2IS2A 2VUTA 1SU8A 2IE8A 3R1IA 2ODAA 2HI0A 2BFAA 2FP4A 3AEKB 3H2IA 3A6LA 1QMGA 3EDYA 1JJVA 2DLNA 2Z6QA 2V7BA 3L40A 2RCNA 4P7KA 1F7UA 4C4PA 2PN1A 2ZPAA 2PVCA 3FUMA 2NN3C 2X8WA 1U0RA 1MRNA 3ZE0B 4YP7A 2L42A 2VBIA 5DNVA 1MX1A 1Q74A 1RKBA 5ELLA 2XKBA 3K09A 3HEMA 3WLSA 2GD2A 3U17A 1MXHA 3IUSA 3WG7E 2RK6A 3W8FA 1DX9A 4RA6B 1Q16A 2EKLA 1OFUX 2IEBA 4TXLA 3EA0A 4HKTA 3N76A 5AXCA 1F4PA 3QE4A 2XWBF 1OREA 3OIYA 3HLTA 3DEOA 2W93A 5DOVA 3JVDA 2ETXA 1ZM3A 4QTYA 4MKIA 4PHTA 3W7AA 1PUIA 5JAMA 1V11A 1YMUA 2BUGA 2I8LA 3MCTA 3GX1A 4QZVA 3N2NA 1GPAA 1GNRA 2ZIVB 1C4OA 4MS3A 3AEUB 1HBJA 2BHNA 1K6JA 4LG1A 3UMJA 1E9SA 3RIYA 3VR2D 4HRXA 3PZ1A 1SIBE 2Q2QA 4KH1A 3SQOA 3OCJA 1D6SA 1FNSA 3IPYA 1Q0UA 1XF1A 1U2DA 4H4DA 3SPXA 3RK6A 5T4FA 2QAIA 2WFAA 2PEYA 4GPZA 4M1ZA 5CFLA 4FDLA 5CX4A 4FYMA 1BRTA 4PFQA 5JDCC 1XJWA 5DXFA 1AKNA 1CJSA 1KDZA 3NWPA 5B58T 2PGAA 1E1LA 3P9IA 3TGPA 4TSFA 3ZR4B 2C4NA 1U8XX 1B23P 2JAWA 2JC3A 3I9V6 3KQKA 2DETA 4DQDA 3G2VA 1U4SA 5DP1A 1R9GA 3FYHA 3RKUA 1PLKA 3OFSA 3N5KA 2FOIA 1Q50A 2P90A 1R1DA 3RS8A 4UBOA 4V0OA 3BB1A 3F98A 2DPXA 3OE5A 3ET4A 4J1QA 1AK9A 3QEJA 1UKAA 2CC2A 4M99A 4GL2A 1EXMA 1TNYA 4MWTA 3UYLA 1LXCA 5JMND 1J2EA 5CLGA 1NC1A 2PM6A 3WK4A 1N1MA 5TR9A 3A9WA 4ZCSA 4Q3NA 2R5NA 1AQIA 1I7NA 3R7SA 5FQ8A 3AR6A 3CJTA 4NBKA 1E2BA 3CEQA 4AY6A 1U0JA 4QEKA 2RC5A 3SN6A 5EQFA 1HLGA 4KG7A 2L0TB 3NTRA 5T3UA 2PKXA 4S04A 4NURA 4DR6B 2FWMX 2GAFA 1ZW6A 2DERA 5M2QA 3OJFA 4EPRA 2XMSA 1Z0SA 5EJFA 2AYXA 3FH8A 4JQCA 2D5IA 1L8OA 1N4RA 3AG6A 3QYFA 1IUNA 2ZI7A 2CKMA 1SBQA 5IT0A 1FSPA 1YZYA 4B79A 4O2BF 3IIMA 2A0UA 2R8YA 3FH7A 3SVLA 3GRPA 4U6SA 2IUUA 1BROA 2YX1A 3AS8A 3KZMA 4NEGA 5LQAA 2HWWA 4CCWA 5ECYA 4FHEA 2FRXA 2K6GA 2AUTA 3NHSA 3G2PA 1WHTB 4WKCA 2FEWB 1J0EA 1EWRA 1X87A 1F60A 1NAIA 1W49A 3L0IB 5AUPB 4TTAA 3HFGA 1NRJB 2J9RA 4K40A 1U8UA 1Q3HA 4B43A 4AM8A 2R3SA 1NW9B 5K3DA 3UMMA 3G9XA 3PUXA 2B6CA 1T9GR 1Y8AA 2CEAA 4IFEA 1T2EA 1NNSA 1FW6A 1WUYA 4CDGA 8ADHA 2X2FA 2HT1A 4LTDA 4OL0A 1BGWA 3LRXA 5LLTA 3KX2A 3RD5A 3N86A 4DLYA 5FV4A 4BU0A 3QE0A 4P38A 4ERXA 1SKBA 1U31A 2HBQA 2QVGA 1P1HA 5CB4A 5K2OA 2JI9A 4YCNA 2ZG6A 3NOGD 2FPRA 3DFZA 1T4CB 2A7QA 3V7FA 1SJ9A 3SQVA 4X8LA 3K5IA 3EQZA 3L5OA 3C1TA 4TSFD 2YYYA 4EGSA 3AV3A 2O1SA 1Y0BA 2X6RA 4WL0A 2HO5A 1CVLA 5MN6A 5BXOA 2XI4A 5TQ0A 1RZ3A 5GP1A 2GPBA 4O2RA 2YZKA 5FUVA 3L8ZA 5EINA 1U8AA 5CAEA 1AXRA 1QRDA 2XYPA 1DJLA 3HB9A 1O77A 1NKSA 1G5RA 5LN1A 2AJAA 3R3UA 5REQB 1UC9A 3MM4A 1D0IA 1PEAA 3MMZA 2C99A 2D62A 5GY7A 5LZ4A 2XECA 1VJRA 1WXFA 1VTKA 2PWZA 3QOYA 2GESA 4ARBA 1F1JA 4D43A 2A92A 2FUCA 3P5BA 3HXPA 4NQZA 2WJAA 1ZN7A 3W8DA 4DUGA 1BAPA 4DT1B 2Z98A 4F2PA 3L7BA 4LWZA 3PI6A 4YHHB 3T3IA 4HB5A 1L8QA 4M7RA 4YXFA 1JDNA 1ILWA 4FP9A 1LDEA 1FYVA 3MCZA 3PXUA 5C46F 3NTOA 3LWZA 2DYKA 4G0NA 3CNBA 1QJ4A 3N28A 3UFBA 1WUHS 3KJZA 4X1OA 1Z22A 2ZUBA 2G9VA 3NOCD 2DF8A 4L8GA 3JQ6A 1QYXA 5C34B 2O7RA 2HMAA 1Y8RA 2XPZA 1O4VA 2W37A 3LYHA 3EPJA 3K1ZA 3GJ7A 1W19A 4FNAA 2E4ZA 2YUTA 4PLYA 1VC2A 4TTTS 1OHHD 1YQTA 4UTZA 1IK6A 4FOLA 4EO9A 3ZE1B 4RTKA 1IWOA 1PO7A 4MJ7A 2F9LA 2AMLA 2YJNA 1ZIPA 2YICA 3LUHA 1C30B 4MDEA 5B1HA 2H1IA 4JL5A 4RXMA 5EILA 1L7BA 3U9WA 3WKCA 2LAHA 1YE5A 1FL9A 4IJWA 5MGNA 2JCXA 4FR5A 3DYVA 4PZYA 1WY5A 1JZSA 1U6IA 1X14A 4WWOA 1FU8A 3AU9A 1HE4A 4S2UA 3TDMA 3K2BA 3WDLA 4BLPA 1FFXA 4IVQA 4CL3A 2ZI6A 1Z4QA 1JBKA 1XMIA 4HNHA 5EKUA 3WQRA 3JASB 5E9AA 1S0PA 1EJ6A 1TEVA 1MEEA 2P5YA 2O05A 4JL6A 5H1YA 5BWCA 3O48A 4B9EA 4B6OA 4PONA 2FRDC 3VDNB 4BSZB 1LFAA 1BN6A 1SU6A 1UOQA 3RRFA 4DV1B 2BFCA 4TUYB 1ADBA 1UT5A 2BKKB 3VZBA 4FT4A 4I5IA 2PZKA 4J0FA 4JXJA 5FA5A 3GGCA 1K7SN 1W1IA 1XCPA 2H1SA 4ZTBA 1P45A 1RI2A 1XWFA 4Y6QA 1EH5A 5AHOA 1DXYA 2P6NA 1EFPA 4R8KA 4BAGA 4BCBA 4PGMA 4HX2A 4D4MA 1XDGA 1JFLA 3R9KA 1J5PA 5LUAA 4L4UA 1GKUB 3W5JA 3EMBA 3ASYA 3ZI7A 2FW0A 1GUDA 4JODA 4RD4A 2FEAA 3PXXA 1MX2A 3IQFA 5AIBA 4OK3A 1F9AA 4DJ5X 3KB6A 1T1IA 2IZ7A 4QUKA 4QOFA 2FSSA 1ECCA 4DUGD 3TG8A 1IK4A 2QP4A 3JAWB 1OXSC 1TRHA 4CEHB 4BXOA 3L13A 4JOBA 4TTVA 1RI1A 4FHGA 2ETCA 1AUOA 4EB0A 1TVEA 3GUZA 3K0HA 4CT4A 2WWHA 4R98A 3V2XA 4C5AA 2C7VA 3LSYA 2DHCA 4N7JA 3EAFA 4MKZA 3ELBA 4HH3C 3AF3A 3MHPA 2FF4A 1XALA 2H7CA 3WYDA 2OFWA 1I3CA 1ZUWA 4QBIA 5FB3A 3KE8A 5PGMA 3HRKA 2IXDA 3V4OA 2E18A 4BVJA 2AQ8A 1CETA 1DEHA 4BCDA 1BIFA 3MTBA 1GPYA 1OAOC 1NQXA 4HNAB 1EWQA 2OGUA 5CUQA 3FD8A 1O1SA 4N8SA 3G0CA 2Q07A 5DM1A 4DG8A 2O6LA 1XZAA 1A2KC 1CRQA 3D59A 4ZXPA 4U7HA 2F43B 5FOVA 3WWOA 4DIBA 3AZPA 1ZNXA 4FN4A 3MERA 3KSRA 2JNWA 1NKTA 2UZ3A 2RHMA 3IEMA 2QTBA 2HRZA 4L6AA 4D9BA 3NAGA 3AR5A 4TLEA 1R4NA 1DMSA 1NJ8A 4TKLA 1TLLA 4PCAA 4LYJA 4YASA 3EZNA 3IVXA 3OQPA 1KMIY 3WNBA 1UR5A 1RHUA 5FIOA 2GJKA 5DHQA 4UNPA 1U8EA 2JJYA 1GU1A 2W42A 1QVVA 4Z1OA 5LLDA 3WQSB 5EJGA 2RG1A 3U66A 4RY9A 4ITUA 1KK2A 1T3ZA 5KO2A 4CXMA 4AZTA 1E0AA 3WRYC 4JLKA 2O2CA 4UEWA 1QIMA 3KOXA 4BCCA 4JELA 2ZU0C 2I76A 4MICA 1EVJA 4YMGA 2RJNA 4UZSA 1J70A 3P2OA 4BVEA 1G1MA 4EG3A 3JZAA 5JQWA 4P0QB 2HWXA 3H5IA 5HP4A 3WMWA 5JAOA 3BTOA 4N03A 1QMPA 1O94C 1FTNA 5KSWB 221PA 5IJWA 2V54A 3OC6A 3EXFA 2J0UA 3LP5A 3ASZA 2F8LA 1GILA 2J0SA 3NHZA 2C2BA 3ZHRA 4IRUA 3GK3A 5D3MB 5BSGA 5A5FA 1A04A 3PDWA 3FPKA 1JIJA 4BO9A 1U9YA 1QBQA 3RGWS 4B8YA 5K3SA 3GBSA 1PJLA 5DTQA 4EUHA 1TT5A 4C2TA 4EQ6A 5HKOA 4AN0A 4B8WA 4MA4A 4Q1CA 2IYLD 1I2ZA 1SOVA 2I9CA 1PF7E 3DKRA 2HXSA 1ZSVA 3GLGA 4OIFA 1Y5RA 4O2BB 1M34A 5I48A 2OAQ1 5CH5A 5LNK1 4CFZA 1OAKA 1NE7A 1SG0A 1USIA 2XA9A 1EIZA 3EVCA 1Z8NA 5E0KB 1CPYA 3M6MD 5EUCA 3RFVA 2J4BA 5DYYA 2LXMA 3NT4A 2UXBB 3GJ0A 3RAGA 1WQ1R 1KE2A 1QQ5A 1NMQA 1MQAA 2GM5A 1U0TA 3ODGA 4RM3A 4XI0A 5GTDA 3DTTA 2XXBA 1TA4A 4QC2A 5GWXA 4R1UA 1F20A 5MN4A 1X8XA 3BWBA 3UB4A 1DX4A 4KIJA 3F90A 5G40A 1UDCA 3LOQA 2ZVJA 2GYWA 1OBFO 5BRAA 1YDGA 3R3HA 3UK2A 4EBFA 3QK0A 4TRNA 4OFBA 4QT4A 2F6RA 4L8WB 3QXHA 3JZIA 2ZR9A 1U3VA 2R97A 1AH2A 5KNHD 4XCXA 1UM8A 4UOEA 1UBHS 3O95A 4FI3C 4B82A 4OQMA 1LBQA 1VE5A 2FCRA 2RK3A 4FNMA 3DEKA 1EUDA 2FZLA 3EVFA 1KYVA 4EHMA 1N4AA 4MK4A 3FSGA 1N52A 4ZT5A 2P9HA 3FUNA 1GPLA 5H8WA 2EP8A 3QBJA 4GBED 3HGMA 1GEEA 4PRKA 4KE9A 1Q1BA 1IG0A 4RE5A 5CHEE 3MJEA 1AGRA 4GKJB 3MTJA 2OO5C 2N9UA 2NTJA 3X1KA 3IALA 5K6AA 3L0YA 4NABA 3DUWA 1M33A 4MQEA 1CNEA 1VIDA 2PM7A 2NPFA 4QUHA 1NPYA 1QYRA 2DQKA 1EA7A 2BR4A 2XNJA 2RIRA 5I7UA 2QVCA 1T5IA 4TGLA 4EI9A 3AP2A 5IPFA 1DI0A 1MOPA 2A5YB 3KZXA 1PJRA 5JHHB 1JDVA 5J40A 2IDZA 1R64A 2IUTA 2EJCA 2VQ6A 4EHKA 2W2KA 4K6GA 3BG5A 4C05A 1JTEA 4TMYA 3FFTA 5DULA 3BXFA 4F86A 1J8YF 1ISJA 1PWYE 1FDSA 1FDIA 2QVYX 3V42A 3NQ41 2GUWA 2JHGA 3QKUA 2O52A 3HY4A 1XSEA 1WDKA 1A4RA 2AS0A 3LQRA 2ZFUA 2Y93A 1Y5IA 1DBWA 1MB4A 3DUFB 1NDUA 4K6KA 1JTFA 3O7WA 3OTGA 2ZGDA 3ZTYA 4MRRA 4J4HA 1MJHA 2CHFA 1V5IA 3RVBA 3FWVA 3QDNA 3KDPA 1WZ2A 1SCIA 5DSZA 3ORYA 3WIBA 5EYLA 1JKJB 2BKXA 2X76A 2WWFA 3OMWA 5FQ7A 1SK9A 5K5EA 5AIJA 2NG1A 4HY3A 3LUGA 1YOVA 1BFKA 1UJ5A 3EZ9A 4DCMA 2DFNA 4PAWA 1XXLA 4UI9C 5DW0A 1GG9A 5JXWA 2G76A 5J4YA 2A4MA 2Q6LA 3G8AA 4EA9A 2IEGA 2EFYA 2ZYDA 4X6LA 4F3RA 1GSIA 5ARFA 2XPIA 3L4BA 4L5YA 5G04J 2JBHA 4AWXA 1G41A 2UYOA 1VMAA 4DLAA 2FN7A 4EMTA 2CFTA 3ETNA 3MCUA 3V3TA 4HLUC 2QXYA 3FMGA 1P4SA 2ZVPX 5D6NA 3DD5A 3N75A 2A88A 1TPZA 5BWOA 4IWYA 1JQEA 3NRBA 4IS2A 4NU0A 1GPJA 5D3ZA 5AT1A 2VPTA 1ORDA 2CNOA 4NV0A 3U7QA 3U40A 4UDOA 2WDPA 4UVHA 4N82A 2J3JA 2XQJA 4AJ1A 3VJLA 3FSGD 4ZKDA 4OM7A 1OW3B 3HSKA 1OBCA 3CLJA 2G63A 4WK0B 1DNPA 3FB4A 1ZM9A 1YQXA 1JGTA 2ZIGA 2F3TA 4M83A 2ZYVX 3GPDG 4KOAA 4Q34A 3VJMA 2AXVA 5NLLA 1Z3CA 3C6ZA 1JJAA 1FTYA 3J7TA 3S7FA 1HDXA 4J1SA 1GVHA 4CUZA 5E1MA 4I9CA 1C9YA 4EZBA 2I62A 3H5OA 2BD0A 4ZZ0A 1CUIA 4ND3A 4PBSA 4DPKA 5CDYA 4LDQA 3ZVVA 4JLMA 4DYVA 4PLWA 1MX4A 3D8HA 3W90A 3LUFA 4KXYA 2OV4A 3I6IA 3K1TA 1HRDA 3VLFA 2P2CA 2NXCA 3FOEC 4CNBA 4P9NA 3SOPA 3UCEA 4I5DA 1JEAA 5BSTA 2GT1A 2BGWA 1A72A 1CEQA 2QSUA 4YT8A 4ZQFA 4EB3A 3WRXC 1PWZA 4U5XA 4OYLA 1O1TA 2BZ0A 4GMKA 1XAJA 5JNTA 1ITZA 4N3GA 3Q3EA 2HDHA 3R4CA 2PX4A 4YUYA 3NWJA 2A5DA 5BMOA 5JS6A 4UMEA 4AMUA 5G2OA 3B2NA 2RHRA 3IHVA 3HM9A 1D1QA 1M2OA 4IRXA 4YCBA 3IMGA 3DOEA 4BFWA 3NVMB 4GWKA 2ZOSA 2UY1B 2XRZA 3REQB 1CK4A 4NBNA 1E69A 2Z43A 2PKQP 2COUA 2I7DA 5A7DB 2H7YA 4MI1A 5F64A 3DZ8A 1XCLA 3RANA 2FTKE 2HJGA 3EZ2A 1KVQA 2R66A 3PFWO 4YBRA 1L5FA 2IDJA 2AC7A 4ZAXA 1L8AA 2XWPA 2WD8A 4UVGA 4D9CA 3HDVA 2QE6A 3ETJA 2NUTA 1M6NA 1UP6A 4D6YA 1H65A 1EFKA 4C0WA 5CVTA 4UWKA 2GETA 2W8ZA 2XF2A 3DSTA 1MJNA 2BGJA 3SYLA 3RUPA 4OJTA 5C8YF 1JE1A 3E70C 1UJ4A 5A9TA 2QQ5A 2IPLA 1JZQA 3TZBA 3FNBA 4Z4QA 1FFYA 1FRNA 3LP6A 4K9KA 5AKZA 1GPUA 3G02A 3CH7A 2GLXA 3GG9A 1MQSA 4UEJA 2HCJB 1KQFA 3L0SA 3MX3A 3F6YA 1GXSA 2UWJG 4EENA 3IUEA 4RGVA 3CZAA 3RTAA 3TQOA 3FNEA 2YRFA 4AU1A 2FPIA 4WY2A 1TNZA 2Z1MA 3DB2A 3W2EA 3TTSA 3ZJTA 3HBAA 4RKYA 2WIKA 3HHEA 2C0PA 5BSRA 4AKTA 3ZVMA 3LBNA 3CKCA 3GLIB 1GCGA 4C3VA 4ND4A 2QUZA 1W36B 1CDEA 4C7MA 1I5OA 3EFOB 3NWBA 5DCWA 1I7LA 4JK3A 3HY6A 4ANUA 1R0KA 4HBZA 3U3XA 4O4IA 3C6BA 3LXMA 1ZMXA 3O7MA 1T1GA 4CMIA 2VKQA 1JRLA 1KBOA 1C41A 4A0HA 3VSCA 4KT6B 4FGKA 1YJ5A 1NVXQ 4DJEC 5ALXA 3PYLA 2IHTA 3W3AH 2XBMA 5DCLA 1Z15A 3W5SA 1PFGA 2NTVA 2X7JA 1SUAA 3ZDFA 5EC8A 4BLOA 4KIGA 5BW5A 4JY7A 3RI3A 3H7IA 2E1RA 5CVUA 2F8TA 3QWBA 1WXXA 1H4QA 3WGNA 1Y5LA 2XQKA 1KPSB 3R7AA 2O8CB 2F1HA 4JLVA 1AP7A 1PFYA 4DM4A 4NENA 3PEEA 2UAGA 4OSOA 3O1JC 3QWHA 4OUDB 1OXKB 3ASUA 1JP7A 1UFVA 3II6X 4BEVA 8ATCA 2CXNA 4MCHA 4TX1A 5BYBA 3G23A 4ZCRA 1MX6A 3DP7A 5JSZA 4DYDA 3N2IA 2ZE5A 4UM9D 1KMCA 4MVJD 4CMBA 5LQJA 4QATA 3T7JA 2EG9A 3LC2O 4UCFA 2YV2A 1PZXA 3JXJA 1XTRA 1IH8A 4OHZA 2IEZA 1NR5A 3V2IA 3C4VA 2VL7A 1WUIS 1QO7A 4BB0A 3QPVA 1IE3A 5CD9A 1NRIA 1F2TB 2YXPX 4OAVB 5DEOA 3DV0A 4XDGA 4WSOA 3VPDA 1ARZA 4OHBA 4I4IA 4QTUB 4S2EA 1U1IA 3R09A 3ONVA 4YAGA 1EVEA 3RC8A 3ORRA 5F52A 4WRRA 5HOQA 2Q45A 5D66A 4X3CA 4BNZA 2AH5A 2X40A 3GI1A 2AOXA 2WTBA 1VCIA 3L0BA 1JR2A 1PFKA 1Z37A 2P3SA 4DLUA 5EWMA 4EECA 4OEHA 3ND5A 4NBLA 3G8YA 2B8WA 3C3AA 1QGAA 4HMQA 1J0CA 4O1PA 3ZRHA 4FFWA 4XGKA 3BL8A 4F5EA 3CEMA 2EIME 2N46A 3SY8A 2AN1A 1K06A 3PU6A 4Z2YA 3ND7A 4JA7A 4Q4JB 2JD1A 2Y8EA 4L02A 4AY5A 1O5TA 1U9JA 3PFBA 5K3EA 2XBUA 4DA6A 1PAQA 5A0FA 4TSKA 2Z2KA 3BVPA 1IM2A 1XGWA 4D0RA 2HJWA 2Q6KA 3HG7A 4BP9A 4CF4A 4AJEA 5J4VA 5AQ1A 5EMJA 4TXHA 4GYYA 4F2WA 1GYQA 1P8JA 2FI7A 2OYRA 3SKXA 2QD1A 2WU3A 3DOCA 2QU7A 2VH2A 5DDIP 3D3QA 2WXMA 2X6IA 1TIBA 3DXZA 3JQ7A 3HIZA 1EG7A 4DAOA 4JC0A 1J0DA 4G0YA 1ZJZA 2NV6A 4B83A 1N9KA 3QUTA 2XNHA 4CGZA 2WPNA 1T2VA 1QS0A 3F7MA 1G8JA 1ZBPA 2A4KA 1J1IA 2ZIEA 1M1YA 1W5AA 4NATA 3FAKA 3KEFA 2GGSA 5JYEA 1HDGO 1CEXA 3GRFA 3DDHA 4BP8A 1TD9A 1X74A 2IHUA 3CH5A 4S0ZA 2XZOA 4Z3KA 3L7MA 3K53A 4QQ8A 3R6GA 4Q12A 3PC6A 1E6LA 3OQBA 1LI4A 4NMXB 1AQLA 3G8BA 4PYJA 4YA6A 1RXVA 1USUA 4XLTA 3NJRA 4DLVA 2VSQA 1IRXA 3DZDA 1XQXA 4O5AA 5C3UA 1H2XA 4P53A 4LOLA 4E09A 4XFDA 4FULA 4TTRA 1QQ7A 2BDEA 2WP8J 2XVMA 5KX5A 5CNMA 5A6SA 1T3TA 4QXMA 3C97A 2PZBA 2VHYA 2JFQA 3KUUA 2QENA 3EGIA 1G19A 4CIAA 2PTGA 1RT9A 3D6TB 1I6WA 4A8HA 2BFWA 3BD7A 1XKXA 3DMDA 2I8AA 3N6XA 1X7ZB 4OHMA 3F9RA 1N8TA 2HSZA 1G3UA 2X9LA 4BO8A 3P4YA 4LZPA 5H80A 1GFSA 1W0JA 4LUNU 3CZ5A 4LJ6A 4BESA 1FB5A 2YZMA 4OI0A 1LWOA 4GUDA 2OFFA 1SVOA 3G2IA 1SVWA 3ADPA 5T3YA 1VI6A 2XUQA 4BIMA 4DQKA 1OXUA 1TTQB 4CEJA 1SVKA 3PKJA 3LHSA 4JD2G 3RYFA 4FUTA 3CEPB 1DKNA 1TFUA 3O4ZA 1WY7A 3DYBA 1Y9ZA 1Z74A 4R3NA 1IWBB 3VI3B 1B1AA 3DZCA 3CIFA 1KOGA 5JRDS 4UXJA 3ZZNA 2CCKA 1BWSA 5ALJA 4AUKA 4DARA 4NFHA 4KRGA 4N8DA 2VDRB 2QVBA 1MXFA 4I50A 4B5KA 2B21A 1Z68A 4YREA 4IJUA 3N2EA 1U90A 1KU0A 1JLHA 4PAGA 2IQIA 4HNSA 3FVWA 4U6QA 1SAYA 1L5KA 5E75A 4D1YA 1Z12A 5HIAA 3RROA 2HPHA 2VO1A 1J25A 3DL4A 1H4TA 3TOSA 5KMGB 4P0TA 4UHJA 3NEYA 3VTYA 3ZCUA 4ZYVA 1CJCA 2NXJA 1AUVA 4C2BA 4TS1A 1Z5OA 4QXQA 1VPDA 5AHKA 1ZNQO 3V8PA 3IAEA 3CIAA 2V6BA 1QH1A 4UBLA 2QOEA 3L7OA 4EB6B 2QV0A 3N0XA 3NBAA 1MW8X 1UM9A 2MYPA 4L9WA 3QBTA 4K9SA 3W2GA 3FF4A 2X9QA 3DOUA 2PL9A 3VO9A 4ADSG 5IHXA 4N65A 1EVKA 4V3BA 2X6HA 2KB0A 3NBYC 4JXTA 2P69A 3CNOA 1QG2A 1YB6A 5AW3A 2GA9A 3NAMA 3N74A 3WIOA 4BKRA 2QD3A 4LGCA 3TPFA 5TT1A 4M9SA 3IUJA 3EHRA 2EZUA 4RLFA 3U4TA 1IPEA 2KYRA 2W2LA 3NRCA 1NQUA 4XB6B 2FN3A 4C3OB 3OTQA 2BV3A 5E3HA 3E9QA 3WE7A 2HXGA 4WN9B 2W6QA 3P96A 5B7PA 4IQ0A 2GRMA 2O8FA 4F3NA 4XJSA 2C2XA 1JEQA 1RM0A 4BMNA 2JGEA 1ZWKA 2BBOA 3B3JA 4F3KA 4RCYA 2BP7B 3QUCA 5F73A 3Q9UA 4XB1A 2M2IA 4EZEA 3PPXA 1LS6A 5FUYA 1QIFA 3K94A 2QRZA 3CF4G 2PGJA 1W0JD 4URFA 2H2DA 5FOUA 4ZVNA 2V5FA 4ARZB 1Z0AA 3MFYA 3ZLVA 2P9JA 2QTMA 3TJPA 3FNQA 4JMPA 3I9NA 3TTVA 2IQCA 3LK6A 4DIFA 2RONA 3QPUA 4HK4A 3E05A 5JFGA 3I4FA 4YX9A 1S7CA 3GA5A 5JYBA 3NNNA 1JHDA 4WX2B 2O0HA 2QJTA 4F2DA 1MFPA 4E5UA 1POXA 3GROA 2AMJA 3FOBA 1CYDA 3R7QA 1WBDA 3C43A 3QWIA 4N9QA 3AHJA 5IBRA 3U4QB 4FPXA 3G17A 3WXMA 5HBGA 1A2QA 2FFRA 1PJ2A 2FQ1A 2SKCA 4X1YB 2FX3A 4CRWB 2E5FA 4N3NA 3HCEA 3EIQA 5ELXA 4HAOA 1CD5A 4GTOA 1SKUA 4PQRA 3LYUA 3R24A 4KTVE 3FUXA 2C3MA 3I01A 1FDTA 4JXXA 1DBQA 3UY4A 5ES4B 4DJTA 3OKPA 1J8VA 1I2MA 2ILRA 4HRNA 3T5DA 1T10A 4GI3A 2XXAB 1X39A 1QHFA 5CA1F 3U09A 1CUAA 5E8JA 3G2TA 2AN5A 1K3FA 4EBAA 2H5IA 4EG0A 1SHZA 2BCEA 3SBTB 1HDZA 4ZIRB 1SQSA 4GG1A 3G82C 1OVMA 3CQCB 3VR2A 4DMKA 4LHYA 2HHLA 2YIVX 2DC1A 3ZY5A 2VYIA 5L95A 2WR8A 1EUYA 1HY3A 4URVR 5TEVA 4QFMA 1RW4A 2WFLA 4BMSA 5LMUB 3OQHA 1X7GA 2GM3A 1J39A 3UT5B 1QH9A 4I55A 4EG4A 4M9XA 3WLMA 4OGFA 2GZ3A 4I1PA 1JT2A 3IUPA 1UOPA 3KPUA 5E6SB 1P7WA 1YI0A 1UBJS 1GY8A 2W2LD 4QJIA 2NSHA 2PS0A 5E2IA 1E2KA 5BVHA 3AY0A 2FJ0A 5EJ9A 3G2NA 2FW7A 3GOHA 2WYWA 3DMRA 3EX7C 4HQNA 5T6MA 1QGZA 4XZ3A 3NANA 3RVRA 4WWPA 1BCSB 4W5WA 3LT0A 1NBIA 4P3NA 3K0CA 4ENSA 4QHYA 2GHRA 3BM5A 1ZX1A 5ALQA 4WNEA 4MUHA 1DIHA 4A8PA 4KQ1A 4MKXA 4M54A 3KB1A 1J90A 4NY1A 3RO7A 1Z5VA 5CBNA 1DB3A 3SD5A 4MR8B 1WRBA 4B09A 4KH0A 2YIDA 3KYDB 2XE4A 5FWYB 5IUJC 4FXPA 4IYPA 3KLMX 4UNIA 4EUNA 1QTRA 4Y2PA 1OBVA 1VXOA 2ID9A 4A27A 4H59A 3UOGA 3O3OB 1PR0A 1KBQA 2GB4A 3TUIC 2ASEA 4UTRA 2ISSD 2BEWA 2I66A 3B51X 1QPBA 1HRKA 3R23A 4HQFA 1JT9A 3A9TA 5CW1A 4PYRA 3RJTA 5AJWA 1Z83A 3U4AA 3VX4A 2XDYA 4QUDA 1B76A 1V3QE 2D2FA 1PVDA 3HXOA 3U9LA 5ICMA 1T1EA 3V80A 5IRCD 5FFNA 3ZWBA 5I4KA 1DG9A 3CSUA 4GRDA 3OETA 3AHDA 4HQDA 3FPFA 2O1XA 2XYGA 5DGDA 4NV1A 2IUEA 5ER6A 2VATA 4EJFA 4MS4A 4QTTB 2QYHA 4UJ5A 2EGGA 4XXHA 1TA9A 2NUAB 3BMNB 3L6OO 1L3BA 2VRCA 3H42B 4X20B 3BWVA 5JFTA 1MORA 4WZBA 5ICCA 5ALSA 4DHEA 4W8OA 4HOTA 1OMOA 5ICFA 1TZ2A 4LQ4A 4S35A 5HF6A 3ZBQA 2RHJA 3DT9A 2BTOA 3JAMA 1UP7A 1CY6A 1X1EA 4XIJA 3Q7FA 1PR5A 4M7PA 4GMJA 1S0UA 4C7KA 2NADA 2JGAA 2Q99A 5DX1A 4K3VA 3R7RA 3ETEA 2P2CP 2A0XA 4M0KA 2X42A 3F67A 1ENYA 2XOEA 2Z56A 4WLUA 2QTVB 4U7DA 4DCVA 2AMYA 1U2SA 1Y6JA 2P2SA 2ES4A 4OYRA 1FTGA 1Y3AA 5A7HA 4CN9A 2Q6VA 3EW9A 1FY2A 4AJKA 3OTWA 4CU2A 3LC0A 1H5UA 3JRWA 5DM2A 3VV2A 3SU8A 3KR0A 5FBVB 5I3ZA 4W1PA 5BURA 5J47A 3CT4A 1ZR2A 2YKGA 4J1NA 3F6CA 1RRGA 3KSQA 1JYFA 3VH4A 2M98A 4EDHA 1E5TA 1ODSA 1X80B 2ZRIA 3OBBA 2ID7A 4AKGA 1GGEA 1JXQA 3ZQUA 1U2PA 4Y98A 1LLQA 1GGJA 5EXEA 4HWOA 1T9KA 3ZK9A 1F51E 1XJQA 4S12A 5JZOA 1Z4OA 3OT5A 1P2SA 4CM1A 1DS6A 1N0QA 1JMYA 3QWWA 5JCOA 3ILYA 1LI5A 2GMWA 4JIMA 2OG2A 2XDQB 2DFTA 1OGIA 4O4JF 2WOJA 1AY0A 2D5AA 4P8RA 2DFVA 3F2VA 4BDSA 4DCTA 1E8MA 3GFTA 1E4EB 4IHJF 1XRMA 4KQCA 1X1QA 2YZGA 2O06A 4ITRC 3BHJA 2OHOA 5CA0A 1II0A 1OJLA 3CB2A 3KU1A 2VZ0A 4XSGA 1ADJA 5LOVA 2GFIA 5E7QA 1N6NA 2WSLA 1OJ7A 4JX9A 5DASA 4HUTA 1BG6A 3TBFA 1FYFA 3V4FA 2Q5FA 5KTKA 5EUMA 4L3VA 1OHHA 1BXGB 1G3RA 5AUNB 3BFPA 3MINB 3R9WA 2P30A 4V24A 2OEVA 1AA9A 5K8TA 1YS1X 2PZEA 3H2GA 4LFAB 4NDAA 5KU7A 1SB9A 2CJWA 5TQ2B 4V0SA 1C4KA 1T4MA 3HV2A 3VU9A 1PJCA 1USVA 2J46A 3QU5A 3CG0A 3FB1A 4IFTA 2VRCD 5F1PA 4F5YA 3I1IA 4R8LA 5T41A 4FU3A 3NV9A 4BMPB 4GPKA 1Q3TA 4HFJA 5A9SA 3PIIA 4D9FA 4DM3A 3QU9A 1C80A 2OXFA 1LNZA 3KBOA 3KUXA 3N2GB 4K87A 3DQPA 1UOEA 5K3CA 4DV7B 1RMTA 1FNNA 5HBRA 5FDFA 1XWIA 1N7HA 5ARCA 2AF3C 1GRNA 3B5IA 2X4DA 1AMOA 2APJA 1DBSA 3ZJYA 3QA3E 4O63O 2Y69E 4DLRA 4ZD6A