1FVFA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
590
structure length
543
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYVEKEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SEC1
total genus 187
structure length 543
sequence length 590
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvfA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvfA03
4JC8A 5BV0A 5BUZA 1Y9JA 2XHEA 4JEHA 4JEUA 4CCAA 1FVFA 5BV1A 4BX8A 4KMOA 3PUKA 1MQSA 4BX9A 3C98A 1EPUA 1FVHA 3PUJA
chains in the Genus database with same CATH superfamily
4MP6A 4RLQA 1EDZA 1J0EA 2AK3A 2GRQB 4GTTA 2QN9A 2X0JA 5ELMA 2PWPA 2ISSD 2SCUA 3QVMA 4D26A 3DTTA 3FCEA 3ZWBA 3APCA 1D2MA 4EKDA 3UW1A 1TYDE 1DWPA 1SXIA 1QGZA 2QAIA 4Z9AA 4CM5A 4EDFA 3P2OA 4MR8B 4PINA 2IV7A 4YDSA 4CV2A 1H6AA 4XCQA 3RCBA 2PX5A 4LECA 3ZQUA 2KLHA 3IUQA 4LK3A 1UOPA 2R4TA 4RZ3A 4TV3A 2PGAA 2GPTA 3BH7A 2RH9B 4MMZB 3BD7A 2CHVA 3THRA 4MRNA 3CV0A 4HNVA 3LWBA 4I9GA 4AI6A 1N57A 3DBLB 3MBIA 2O2XA 2XMPA 3PNLA 1NXPA 2HM7A 2I2WA 3VGJA 5B3SE 3EXFA 4MRVA 4PGMA 1FUIA 1PW5A 1QOPB 1U4OA 1AO3A 1XQVA 1YO6A 3KT0A 1TADA 4MW4A 3QBDA 2H2IA 4OVKA 2MDTA 1ECGA 1SCKA 3CO5A 5A7GA 2ZDQA 2YKGA 4X6UA 4NHOA 2ILRA 2DMRA 4BFRA 1VJ1A 4RVDA 4KQKA 5C8YB 2O7QA 3H4MA 5T8IA 3SN6A 1L5KA 3PR3A 2J7PD 5C5IA 4YRQA 1KK3A 4EZKA 2RMKA 4LX8A 1HDIA 1VBNA 5CDFA 1NXQA 3JARA 3HU1A 1AA9A 1E2BA 4U8HA 4OGWA 4TYPA 1NNSA 3G2KA 2AG0A 1KPIA 1Y3FE 2P2CP 3BPSA 4ND3A 5J5CA 1IZ0A 3WMXA 4QPZA 2QSJA 2VSOE 4IHQA 4LYDA 2WPNA 5HCNA 4GM4A 3WB9A 2AV6A 4UVEA 1MC8A 3NDRA 1W25A 2DFTA 2W48A 3JQFC 4KWCA 4RMHA 1JWLA 1SQ0A 5EIXA 5I7FA 2YQ8A 2I4IA 4G0OA 4LRYA 4RK7A 4DNXA 4L9AA 3U4MA 1VQ1A 3QWFA 1P7PA 1H4VB 4L8YA 1VGQA 3DTVA 5DTRA 1RI1A 1TRHA 4GECA 2RK4A 1L1RA 1NTOA 1EBUA 3VM6A 2VVTA 3GFPA 3QYAA 2KBFA 4K88A 2C9OA 5C8VA 4A8JB 3N2ZB 2O3SA 3AF3A 5BPFA 5FEUA 2ZRHA 3A1FA 1FUUA 2BM8A 3B6KA 4UARA 3R6TA 2BZSA 1QH1A 1V4BA 3X2FA 4O3MA 3TQQA 1IXYA 4UCWA 3HDVA 3UCXA 2BM9A 4BHTA 1CSEE 4F9GA 1S64A 1TU4A 3WK5A 3FTEA 2WHYA 1H42A 2E4WA 1SUDA 1M8PA 2E4VA 5ECGC 3U16A 4HNAB 1NRIA 3D5TA 2X6TA 4N5LA 1PV1A 1W8IA 3FYTA 4MQFB 1K5HA 1T25A 1YZVA 3K8OE 3U3MA 1JYEA 2O0MA 4AZ3B 1J97A 4FB4A 4IV8A 1HEIA 1NWCA 2C4NA 3EOAI 3LXMA 3ZI0A 3K1JA 1EA5A 1KYWA 1PL7A 2CCJA 3C7DB 3PXUA 3SI5A 3W2TA 4YRBA 4F92B 1BW9A 2UVQA 1DKOA 2VHTA 1OZFA 4MPPA 1UBMS 2Z6VA 4PG4A 2HZBA 4L2YA 3OFND 3L0PA 3MJSA 5A5DA 4JU9A 1KJ8A 2EIJE 2C3MA 5LA6B 4AKEA 2JGKA 4BB9A 1L0BA 4J0DA 1G64A 4X8MA 4NOMA 3ZW9A 1EVZA 2HQBA 4HP8A 4FWTA 3WL4A 3FPCA 3D3QA 1XPUA 3GFSA 3NBMA 4B47A 4PHTA 4G97A 4X6YA 2ABWA 4RELA 5LOVF 3LHIA 4MUYA 3BXZA 3BDAA 3GBVA 3SICE 4Z6KA 4ZVVA 4RQBA 3QITA 2OXTA 5JNLA 4BJ5A 3CIFA 5C0OE 5CA1F 1KGSA 2R7LA 4G5QA 3BAFA 4TV8F 4JVMA 1ZR4A 3VJKA 2AN1A 1I9GA 1CR6A 4FYYA 3STVA 4LRZA 1WY5A 2WUDA 1N2ZA 2UV8A 3S3TA 3PGA1 3LAWA 2ZJOA 2WD9A 1RYZA 3RVJA 4N12A 3O4HA 3EF0A 3KB2A 3PH0C 1V8ZA 5H80A 1CS4C 5F2OA 1WPRA 3A2KA 3SEZA 3DSUA 3PBKA 2WTMA 2FPIB 1NC3A 4Y2YA 2AQHA 2X0DA 3C3XA 3HBLA 3PDIA 3UA4A 5I7VA 3VNUA 3CR3C 2CVQA 1Z8FA 3K9LA 1QX4A 4LVCA 2I3AA 3FUKA 5HZKA 5L4LA 3T7CA 1BVYF 5G2NA 1DDOA 3CLTC 3QGMA 1YKGA 2F48A 4OLFA 4WEOA 5EJ6A 1F3OA 1Y1SA 1K3ZD 1GPKA 3VOSA 1FJ2A 2ZR7A 1KC3A 2GLUA 3CLSC 4LIPD 5GZ6A 3ROQA 4DUPA 4N0MA 2W43A 1VDZA 5ES3A 4RTKA 1E9EA 2IZZA 3PC8A 4DUIA 3SC3A 3SHFA 1K0FA 3DPUA 1O97C 3E9EA 3H16A 3MTQA 4MUIA 2F1JA 5KNBH 1G20A 1ELWA 2XVXA 3OHMA 1HG2A 1BI8B 1C7FA 3L17A 1WD7A 3PRHA 4GMFA 4LHSA 4Q7MB 2HU7A 4XUDA 3X43A 3WADA 4CXMA 1RRFA 5BQXA 3O92A 3UMCA 3HHEA 2O0LA 1P4HA 3O47A 3Q8WA 3LBIA 1L1EA 1RXYA 3ZPJA 2BGNA 2X15A 4G5FA 1SBNE 2IHNA 3O4RA 3E2PA 4BQFA 4YV2A 4U8GA 3MXTA 5J5AA 1J9EA 4JHJA 1FNMA 2J45A 4YT5A 2NV6A 5KVSA 4RQUA 1BJTA 1O03A 3W4KA 4G0ZA 4DLAA 3U64A 3BK7A 3MPOA 3A9WA 5L3SA 2BJVA 2X1VA 3A6KA 2B8TA 2ZB3A 1R6AA 3LNCA 5B1BE 3ZQ4A 2IFTA 2Y77A 2OAP1 4ANUA 1IJFA 3EPLA 1E2NA 3PHBE 1GPLA 1R4NB 2B37A 2FMFA 1WB5A 2VJKA 4D79A 5DBFA 4F46A 1EB9A 3CBGA 4ILIA 2EKDA 2PXXA 3WS7A 3TRDA 3AQIA 5M2QA 3C3RA 1KI2A 2HJWA 2FN7A 3IBCA 4KQFA 4R2WA 5CK4A 4BNJA 3R24A 3H4TA 1DZIA 3PL1A 4KGZA 1O08A 5ALRA 5B64A 1EUDB 4RVFA 4K0RA 2J7KA 3S0JA 2YFYA 1CUFA 2FSGA 3TO5A 4MDEA 3RUFA 1IZ9A 4FFNA 1Q7RA 3FUMA 4RWZA 2O20A 3HDJA 4K2HA 4LAFA 1B1AA 1KOLA 4UBOA 3W3ZB 3HN7A 5MHTA 1T1IA 2RHWA 4DVGA 4RQIA 2P91A 2YZMA 1O8BA 3W2FA 4B2LA 1JQAA 1IATA 2RH4A 4RE6A 2QM8A 3GZ4A 4OSOA 4AG3A 4E1BA 4R68A 5D7BA 4ZALA 5A9RA 2WWVD 4RK5A 3WYBA 4JODA 3F6BX 4KFRA 3U81A 5IT0A 1JR6A 1G4AE 2VDNB 3C3AA 3UA3A 5KNGA 4XFKA 2YN0A 4PTYA 2IXFA 2WIGA 4Q7QA 3DOFA 3KQWA 5AW1A 3WGIA 1MR3F 1RPTA 4XLZA 1NSFA 4LDPA 3WGYA 3B9BA 4RNCA 4EY6A 2X0EA 5AHRA 3T3MB 5JNWA 1E8WA 2HYZA 5LP6C 1OZAA 2IF4A 3C5WP 5EIHA 3I4GA 1SC6A 3KOWA 2YXBA 4U8VD 4IO1A 4PZCA 2Q6VA 3UT5A 4V0QA 2DX7A 1JTFA 4KLNA 1Z6XA 2QRJA 4KMMA 4N7RA 3ROPA 2LZ0A 2Q50A 1LD3A 4A55A 2VR1A 1YVUA 4GP6A 1IG3A 2R96A 1XQ9A 4P54A 3AL2A 4QDXA 1M8FA 5HF8A 4E5VA 2JGEA 2YY5A 2MOWA 1UDXA 3K15A 3GFTA 4TVSA 4UWGA 5H82A 1UWKA 4GOMD 1TZCA 1AIPA 3BB1A 3JRXA 4LMPA 4TWBA 5DX1A 4CM4A 4D9GA 3O2SB 4NBRA 4E2XA 5AH0A 1EXDA 2CXSA 2P5YA 1IY2A 4MEAA 2EFHB 3F49S 4KOEC 1Z4NA 3EFBA 1EF1C 3KXIA 1IK6A 1CZUA 3HYLA 2CG3A 1GCUA 1V8FA 3UKRG 3ENVA 3OETA 4AX8A 3B3QA 2GOYA 3DO5A 3W0LB 3W8EA 3D7NA 4LYJA 2C57A 3KZMA 1VLVA 3BU8A 1DRUA 1SQ6A 4CLEA 1UR5A 4UI9J 1GIAA 1FA9A 5REQA 1JMYA 3LVFO 1T5BA 1HQYE 4GOXA 3U1TA 3WBKA 5FUMA 2EQXA 5KS2A 5FA6A 2G88A 4HWKA 3EBPA 2ID9A 1ILEA 6REQA 1P18A 4ZEWA 5K0EA 4L3VA 2QYTA 4X8QA 1USVA 1T9GR 2Z2YA 3HKCA 5DCUA 2GPWA 1FK8A 4HJRA 1BMQA 1BN6A 1QLJA 5LLSA 3EJ6A 3IAM6 3VLFA 4H4CA 2OVBA 3UJ3X 1ZJ6A 3EVNA 3CHSA 3CNLA 3PNSA 3WJ2A 1QYWA 1KBQA 4J7XA 1CJTC 4F7DA 2C9BA 2C99A 4QUGA 3C0KA 2F62A 1Z38A 2JJ8A 5F1PA 4ER0A 2GEUA 1VLJA 3LKUA 1G9XA 1H66A 1T2EA 1UFOA 1D4AA 1WXQA 3FUHA 1X9GA 2D54A 2YMQA 3BRCA 2KWIA 3W2HA 1FYWA 3G6WA 3TDKA 2X6QA 1NUPA 5EGNA 4CGVA 3ER8A 4JOCA 3P2BA 3CX8A 2PZBA 2HSGA 5AQ9A 3I8SA 4OGLA 2R8EA 2PCJA 3CHMA 1M2NA 2W5UA 3I9OA 3NTRA 5IAGA 3LCRA 4FFPA 3WO0A 1D2NA 3PJGA 3NFYA 4XH9B 5J4KA 2QXTA 2H8KA 3OP1A 1BKSB 1K98A 3AH8A 3EVFA 3KT3A 4JWKA 5ALQA 5DM70 3JCKC 4PZ0A 3RJ5A 3QU4A 3TOSA 2XE8A 1QHNA 3DQPA 4XGKA 2AQ8A 2A5EA 2YYAA 4XXHA 1UFKA 3QZUA 4FUQA 4JLKA 3E33A 1RJDA 4Q16A 3PFKA 5K3EA 5FI5A 3ELDA 1JJBA 4OKSA 4E6PA 2O8FB 3O2NA 5BQOA 3VHQA 2M1XA 4CFZA 1XTPA 1YUBA 1JFFA 4Y3UA 4FMPA 4UHBA 5CNIA 4MUEA 4NJMA 3ICPA 1VLMA 4UM9D 4Y6SA 4L1KA 2Z3WA 4LERA 1QGAA 1W34A 1HKHA 2HJGA 4AXHA 4FSHA 3Q3HA 4ZCRA 5CFQA 3D9PA 4M9XA 4ZIRA 3W5BA 1VJDA 1WSBA 3CISA 4B4KA 4OH7A 1EX9A 3DZ8A 3L9XA 4WH0A 3SG0A 3ZY2A 4CIVA 4YV1A 1OH7A 5DO9A 2YY6A 3E5NA 3KWFA 4AO8A 1H6PA 5BR4A 1NW6A 1ODTC 2I5PO 2Q49A 3A1EA 5B58T 3GPCA 4B9EA 4BC0A 4FM9A 3JPYA 3ROTA 4CMEC 4CM8B 1G8KA 1PSZA 3TM4A 3LFTA 2E4AA 1PBTA 2BBOA 2I54A 1OGYA 2HJRA 1WMSA 3DAYA 1F2DA 1FNCA 3AP1A 3JQGA 4IFIA 2H6FA 4MVJG 3HMKA 4MCIA 1AP7A 2H29A 2CSUA 4RZXA 3TF5A 2HPVA 1TT5B 4MUMA 5GAJA 4P7BA 5GADl 2B9EA 3FTFA 4ZXFA 1P1IA 2E6UX 4FHGA 3RRZA 1P0CA 2C2LA 1LPAB 3M7IA 4R5MA 4DSOA 4K9NA 5IXJA 4UU0A 4ZAXA 2EYUA 4EVSA 2PKYX 3R0IA 3LRTA 3DYBA 4G1CA 2OUIA 3GBPA 5AQ7A 2J5XA 5IT5A 2XRYA 1QDLB 1SURA 1JMVA 1EJ2A 1COWA 1TM5E 2H4YA 5G3ZA 2FSHA 2ZU0C 2R66A 4EDHA 3VDNB 1KI3A 4FU0A 2ZJ6A 1NNEA 3AOEA 2G63A 1JDNA 3DM5A 2IU3A 2XGGA 2X4IA 3CRQA 4YRRA 1K86A 2ODQA 1G5FA 2J87A 1GZ6A 1D1TA 1DXYA 4LY0A 4FKMA 4MEBA 4QUAA 521PA 2B4YA 3ZK8A 5JJCA 4N48A 1UBGA 1X7WB 4XFDA 3W6UA 4U2KA 5ICEA 4YMSA 4FLHA 3CX7A 3GLTA 4X84A 4C48B 1KQNA 4MS4A 3ETGA 1FDUA 1NQAO 1YXMA 1UBTS 4J03A 3OZSA 4ZDWA 1N9KA 1RZVA 1OMOA 1P6QA 2YIDA 2VH1A 4PQFA 1ORRA 1S6YA 3KJGA 4LMBA 4TLDA 3TKYA 2H1VA 1E20A 2VPIA 3KQPA 3UJ6A 1QP0A 3WRVA 3D6FA 4QFCA 3ORHA 4L50A 5ENRD 1N6HA 1OW3B 3HJHA 4D9IA 1E9CA 4LHWA 4DQUA 4YAKA 1EFVB 2DPLA 3WKBA 4DB4A 1RQLA 2P9IG 3TX2A 4D9JA 4BE4A 2I4TA 3OJOA 1GVHA 4KPUA 1GZDA 2IH2A 5HHTA 1T9BA 1KKLA 1W5SA 1Z17A 3H8WA 3N39C 1YQGA 3V2GA 2H85A 2AN9A 2FBNA 4JP2A 4RTMA 2Q41A 3IXQA 1P4AA 3OTOB 1MIOB 3IPRA 3QEKA 1TUIA 3HCNA 4GTQA 1Q0TA 1HUQA 4WNAB 1UPUA 4MXDA 3OZDA 2IYXA 1S2NA 1BA3A 2QNBA 1CZNA 1RXWA 4WNYA 1UEIA 4RC9A 3KT8A 1MXHA 3EMDA 5KC9A 4JFAA 4UBNA 4U7JA 4BECA 3FCXA 1LGYA 3UUEA 1ZN9A 3MJCA 3V79K 4ED9A 3LKZA 1Y89A 4HO1X 4D10C 5BNWA 3F2VA 2MMCA 1MUUA 1Z0IA 2UYQA 3LXXA 4MVYA 5EMJA 2EU8A 4MI3A 3JQAD 1QONA 1T8SA 1TZBA 4LRUA 5ECDA 4ZI2A 5JYDA 5JSUA 4KQ9A 4R7TA 1FB5A 3PFCA 1K3FA 1EIWA 3RW9A 1L8LA 4MV1A 1E2EA 1CDEA 4TN1A 3PKJA 1DCMA 2DVWA 3OOYA 4JPSA 4P3KA 2NYVA 3ZVKA 4HDOB 3LTEA 1U7DA 2V7PA 2BEUA 1I6LA 3VJMA 3E4CA 1R88A 1MQSA 1M7GA 1T5DX 1KI4A 2IYPA 3UFXA 2NVBA 3BOSA 4XQ0A 4BC1A 2W2OA 1M1NB 5AVTA 4KPYA 3EEFA 2W00A 1E1QA 2NU8A 3K5HA 4CTMA 2CNBA 2EZTA 3SJBA 3FYHA 3SZ3A 1LLFA 1B2LA 3ELBA 3ESCA 4MB0A 3KSBC 2EJUA 4CMEA 2O3RA 1ZWKA 4D4IA 3B6EA 7AT1A 3WLOA 1VC2A 1V37A 4A63B 5HIIA 3ROGA 5ADWA 5AR1A 4Y2QA 2ZYDA 3D6TB 4FHDA 4OQXA 3PDWA 3ZIDA 2G07A 1OE0A 2P30A 1HOXA 2FWPA 3NYWA 1XRNA 5EE0A 5FYDA 4BZXA 4C6RA 2CE2X 3ZXPA 3AX6A 4K8OA 4ZRNA 4BFLA 3WA7A 3R4VA 3H6GA 3FNIA 4XB1A 4ZAYA 3NHAA 5BP7A 1FSPA 2YV1A 1AXEA 3DV2A 4KGVA 1QIIA 1BWSA 3U26A 4CDMA 2WM3A 3KSQA 1WCIB 1DBWA 1U7HA 1LVHA 1RHMA 1ISSA 1BO6A 4FJYA 3EWNA 3ABRB 3C8HA 4Z0HO 4NONA 1DMRA 5F1KA 4HB2A 2BKKB 2ZUBA 3QI7A 3O82A 3WLQA 5DYNA 2WXHA 4DYVA 1N2SA 1GNTA 3OWHA 1BJKA 5EJAA 2PLRA 2XIQA 3KLNA 4N0EA 4R2IA 5FPSA 5K3OA 1YAHA 3HYRA 1Z2OX 2P2CA 5E75A 3OC0A 5DN6A 1Z4PX 1EU1A 1URPA 1AKWA 1Z56C 3M5WA 3IHYA 2ZI3A 1ZM3A 1D04A 3QVVA 3KFLA 4ZOEA 5DTMA 4C76A 3RU0A 2ZS8A 3OO1A 3T94A 3KUKA 4UASA 1MX2A 4QPPA 1JJAA 3RS5A 1BQ3A 3WO1A 1P5HA 1Q1GA 2Q5HA 5GVSA 2NTJA 3EEIA 4QEDA 3DD5A 2WIJA 2D59A 5EZQA 3AEYA 4PCLA 5HDQA 2F8TA 3N70A 1WMFA 4HDSB 4LJ9A 1GNQA 3BH0A 4JOQA 1YQUA 3I2JA 4GC5A 1UFVA 4KGDA 3C87A 3WQRA 3B1KA 4UDOA 4EKEA 2V6JA 5K6AC 2W9XA 4O2AB 1EK6A 3OIUA 2GHQA 1ZHFA 2DRIA 1D7OA 3AT1A 3AILA 2E6KA 4PSAA 2D13A 1ADGA 4RD2A 5AOVA 1DVPA 1R6UA 1NHWA 1ZVVA 2X4GA 1T6ZA 3K5IA 3JUIA 3M34A 1VG1A 4DGQA 5AVVA 1B6RA 3ABSB 3C2QA 1QG0A 4GMLA 5EFOA 1BDJA 3N6XA 3TLEA 5KSYA 2HLPA 2BGWA 1YS9A 1GXSA 3RASA 2C04A 3U7RA 1ZINA 4I55A 1H3EA 2JC3A 3E7WA 1ZOOA 2JVKA 1WXHA 4MUJA 1LPMA 1U31A 3QOUA 4TMTA 2EATA 3ABOB 1OLUA 5FPTA 2VZLA 5T4EA 3OPVA 1M1UA 4MW7A 1AQIA 1USIA 4JBYA 2P2GA 1OWMA 1BS1A 4UTXA 3UK1A 4DEXA 3EU9A 2IXGA 4L15A 2HF7A 4Q82A 4DY6A 4HAXA 3ZEIA 3JQBC 4WN9A 2OFWA 5EP4A 1DPGA 4MO9A 1QQTA 4UXIA 1WNTA 4EBFA 4F3RA 5C1PA 4BFSA 1SUAA 4D5GA 3B7TA 4MV7A 2XNKA 4RIHA 4V3CA 4DNFA 1DC3A 4E2YA 1XR3A 4V2UA 3RHTA 2B6HA 3T3DA 3RU9A 5BV0A 1QR2A 3UAWA 1W8DA 1MB3A 3FWYA 1C7JA 4GLLA 4M6WA 3R7SA 3ZHOA 2OBLA 2R0QC 5JU6A 4K5CA 3IIMA 2FPUA 4I46A 1YB6A 4E4YA 3TW8B 4B32A 3NJ8A 4DN6A 4G5SA 4C29A 1Z62A 3ISMC 3GFFA 4U0UA 2BHTA 2H63A 3WWOA 2ZUVA 3HCEA 5L3RA 4QM6A 3IOBA 3LRPA 2HDOA 2DLNA 2ADMA 1EG7A 2B8JA 2X0KA 4Q00A 1DNPA 3CWCA 4H3SA 1I4DD 2DF8A 3HCOA 2QX6A 3T4UA 3VV2A 3ZYCA 2GM9A 4JI7B 5F51A 3TZEA 2OORC 1YVDA 4UQOA 4X6LA 1W6UA 2FGKA 2R5NA 3FMVA 4P86A 5CFPA 1SH7A 4IYJA 3RVPA 4CTOA 3PZ1A 3G7NA 3SM9A 3WSWA 1G20B 4B7UA 5E1DA 5JS1A 1L3CA 3OLWA 2E1RA 1JWFA 1UN8A 3EDOA 4HXGA 4N3NA 3WRXC 3NIFB 2Y27A 5K8CA 4CDNA 4HOSA 1KOJA 2AFIB 2ZPAA 3OCXA 5LC1A 3EGVA 1YNSA 1PEAA 2HUNA 5HILA 5CMLA 4QYSA 1M8KA 1WF3A 3C6KA 3QXJA 4K6OA 2OHHA 5CNMA 1RT9A 4B3IA 3GFBA 3P1UA 1XKQA 3H5AA 2BY4A 3N76A 1RTKA 4I2WA 1SXJB 4YWHA 2PL3A 3N8KA 4OXXA 1N4QA 1ABFA 3GN1A 4OSEA 2O8CB 1NQTA 2BCEA 3NMUF 2L9BA 1XIVA 4FT4A 1K5DA 3MD0A 4UPEA 1A9YA 4JSYA 4AN4A 3WIBA 5M04A 3R1IA 3Q7SA 1P6UA 2YOFA 4PZUA 3B6ZA 4EAQA 2NUAB 1XP8A 2Q6TA 1NW8A 2WXJA 3MYVA 4IIJF 5KAMA 3INTA 2ZJ7A 1UZMA 3K9IA 3AKEA 4TXNA 3DM9B 3WZMA 3M70A 4Z8YA 2NVWA 3T0FA 5CXUA 1XYVA 2C4MA 3V1LA 2VJCA 3QKTA 1CF4A 1B1CA 4GGOA 2GBCA 2GETA 1K2WA 2VNJA 3Q9NA 4A8TA 1AGRA 3ZKAA 3SZGA 1G8AA 2JKZA 4PFJA 3QYFA 4YUAA 1Q0ZA 3KR9A 2W0MA 3BGSA 2MR5A 3IEGA 3D8UA 4L72A 2X8LA 5I5EA 4W8OA 3ZXSA 3QLJA 1G9SA 4L78A 3WHLA 3WIUA 1ZB1A 3CVJA 4OBBA 5E7IA 1T2UA 2NO0A 1EHIA 1IOVA 3PG5A 2XCSB 3DE7X 3B1YA 1H2EA 3A1NA 3ETLA 4I8IA 5FB3A 4LEUA 1PT9A 2AZMA 3RSHA 4DVJA 5FH9A 2VNAA 1KFEB 2HPHA 1YTUA 2PS3A 5EN5D 1EFPA 1KYZA 2WP0A 2X4LA 4LZAA 3H7IA 4PLCA 5H8WA 4L5CA 4H15A 1MB4A 5H16A 1P7VA 2W6QA 1UKZA 3EISA 4M99A 2YBDA 1Y5MA 4H16A 4WPGA 3Q4AB 5IAKA 1MJHA 2GRUA 2DUUA 4N3CA 4RPHA 4F85A 2AJDA 4L8LA 2Z56A 2AXVA 3UT5B 4EG4A 1W88A 2AEFA 1IN8A 3R6DA 4KE6A 5EWMA 2QZ9A 4BX9A 1IVYA 2QTBA 1BU8A 4WA7A 5SICE 4DZZA 1P80A 3BWYA 2V7WA 2BHLA 1A98A 2B36A 2OGUA 1CB0A 3DO8A 5AVSA 2O5EA 2ZREA 4RV4A 2W2XA 4DREA 2VQEB 1Y1LA 3DKPA 2CB0A 2W22A 1NI4B 2AE1A 3QYJA 1QHHB 2KX7A 3OX1A 4P82A 5AHOA 4JLNA 3HH8A 4ASUD 1SVNA 2P6RA 1G3MA 2GX6A 4MWBA 3AJEA 1KZ7B 1Z08A 2OV4A 4JMPA 1IBRA 2LVBA 4K1LA 3WLLA 2FXVA 5DBOA 1WUYA 1EX1A 1X1AA 1FRNA 2FRDA 1E4EB 3FSRA 5FBWB 4LE2A 4MMXB 5BN4B 4A2CA 2JLYA 2EFEB 1BTOA 2ZTVA 4RKRA 4U2FA 1K5PA 2AX3A 3JWGA 4MBGA 3LBAA 3ID6C 3OIVA 3SE0A 2RK3A 1W2HA 2GNOA 4N7MA 2ZQZA 2PBZA 3WTBA 5K20A 3S7DA 5KQSA 4GU5A 2NXWA 3U3KA 1YOVA 5C2JB 2KCKA 2WK1A 2D1SA 4IKEA 3NM6B 3GGGA 1S2GA 4V0KA 2YJZA 1UDRA 1WWKA 3N2LA 3CW9A 4XM1A 1VIMA 3WGOA 4A1FA 4ESEA 3OM0A 3C7TA 1O96A 3LPMA 5FNZA 5EILA 1WX1A 2AD5A 2TS1A 3A7EA 4H17A 4CF4A 4CQMA 4D8YA 3G2OA 2ZETA 1DO2A 5FOWA 2ZE5A 4RSRA 3WIEA 3SHVA 3QJGA 2FWAA 2A3NA 3SQNA 4QNNA 1X8KA 2I33A 4JC0A 4D9HA 4U9IS 1ZUD1 3MELA 1N5OX 4RL6A 1VI2A 2YWFA 2IO3C 1LSOA 1Y6IA 3FTNA 3QBJA 1M7BA 2CWWA 2DG2A 1S63A 2HK9A 4G9BA 4Q3AA 3TQIA 4BWRA 4D44A 3OAAA 1Q7CA 3BD9A 4FP7A 1K8RA 1Z9BA 3IA2A 1G2PA 4DC9A 4DIMA 1Z45A 2E5FA 3MOGA 3RC7A 4G5RA 4ITVA 4RDIA 4C6TB 1TUBA 2DBZA 1RU3A 1AA6A 1CP3A 2O3QA 1CZHA 3T99A 1ODIA 3TWTA 2GSWA 4I99A 2DWUA 2WJVA 4C03A 2PV7A 1Z4KA 2A2ZA 3E8MA 3HKDB 4R9UC 1B41A 4WLNA 5KJEA 1RC0A 1V5EA 4PYIA 3I61A 2RGNA 5HUQA 3DYIA 5CVJA 3ZJTA 1P0MA 1WO8A 3IMFA 3KOYA 1FFSA 2PL2A 4L4XA 4RY0A 4V0NA 1E1CA 5K3DA 3TTSA 2D5LA 4MV8A 1EM8B 3IC5A 3BE4A 3QVLA 2HFKA 1F9EA 3WYNA 1DQSA 1UBSB 4NZOA 3SSAA 3PUWA 1QG4A 4OJNA 3ZBUA 3CA8A 1DMSA 4GOLD 1PZXA 1SULA 4E22A 5IT4A 1CEYA 4DTIA 5B3JC 1WXWA 3AEKA 4G0MA 1YCHA 4JQYA 3D59A 3S7FA 4B3MB 2HTEA 2ZGGA 3C24A 3JQGB 3NUQA 1WTAA 5CHEA 2HTFA 1US8B 3K1ZA 3NAMA 3U7QA 1P2BA 3CVPA 1VJ5A 2XCOA 5HKKA 1NC1A 3A3YA 3EOBI 1MD9A 5LYJB 3FB1A 4URYR 3EDTB 2Y1FA 4BJ6A 2ADFA 3ZLVA 4OK5A 2FA9A 2BEDA 3L1VA 4V0SA 4YECA 5GQSA 2BF4A 5GM2A 5CEEA 2CKMA 4X61A 1FP4A 1LD7A 3LGAA 4OV6B 1R4AA 3U7JA 3U7IA 3W79A 2J9XB 4KV9A 4N1AA 3DFMA 3NTQA 4GUAA 4KQMA 1Q1AA 1R9GA 2VK8A 4IUDS 4EJFA 4EJSC 4F3TA 2ZITA 3GZ1A 4GYOA 1P2FA 4CL8A 5TMEA 4YP7A 1N77A 2SECE 3HA7A 2W8BB 4YUXA 4LVOA 1EDUA 1FT1A 1P33A 2YASA 3OE4A 3MEKA 5SYAA 3U6KA 4CIDA 5L45A 1TVEA 1SXPA 3NLLA 1PYOA 1UP7A 4PLGA 2P27A 4JB8P 1K8QA 4G8JA 1PR9A 2DXIA 5EUQB 1JEYA 4AQYB 1SU8A 3HJNA 1TF2A 4N8EA 5C34B 5EIAA 3HNRA 4HVTA 3PICA 3RAUA 1FVOA 2WJAA 4DX6D 1SCUA 4UMFA 4C4TA 1OV6A 4G0XA 1U2RA 2JCGA 4M9RA 1PJ8A 4JI6B 1B89A 3JTMA 2D0PB 4G1VA 1PWXA 2IPNA 3H3FA 3G0IA 1PQUA 4D9CA 3SZMA 4GD3Q 3EYWA 1UBRS 3OE7D 2ZT5A 4NCJA 2A5LA 3HTXA 4H27A 4BTEA 4P0QB 1XYGA 4YRFA 3ACBA 2VYND 4RY9A 1G9TA 4RZIA 3DKRA 1MAAA 4MWCA 1XXHB 3EIQC 1DHRA 1RQRA 2C9YA 2Q21A 2VUUA 2IOYA 2J6CA 1QK4A 2W2LA 5ALNA 3ZNQA 5AJTA 1ISMA 4FN5A 4QHTA 3GLGA 1EDDA 1MZVA 2FZGA 1K7CA 1HFJA 5D3ZA 2C5EA 1TK3A 1ZSNA 4PVDA 1EE9A 3DS8A 4JROA 1MCZA 2J4FA 3STUA 2QZZA 4HDMA 2XCCA 1A69A 3KKPA 4R1QA 3SOPA 3M8KA 4YUWA 2OCLA 1I36A 2PVPA 2XRMA 3A1UA 4QRHA 1R15A 2EVWX 2HLHA 4F71A 3VNBA 1BI7B 4GCNA 2C4VA 1K5GA 1MJGM 1LPBB 1PWHA 2PLAA 1UJ5A 1SIBE 1KEVA 4I9EA 1EFCA 3FMOB 3GZNB 3ZX4A 5HSGA 4Q9KA 5DSXA 4C9BA 1NV9A 3KS9A 5B3AA 4BVAA 1JI3A 4LCEA 3KHTA 1OX6A 4YC7A 4GYWA 1BDIA 4QBHA 2I1VB 1C3VA 2JIOA 1Z5PA 3L1UA 4QD3A 4BQNA 3CT6A 4MICA 2FZLA 4OA8A 3GP8A 3LC7O 4TTPA 4X60A 5GWXA 1MRZA 3KR0A 1YFLA 3I23A 1QU2A 1PR4A 2Q27A 1U1DA 2XLCA 3C3DA 3MAJA 3MYYA 4CTJA 5H9WA 1YE3A 4OYHA 3UK6A 2C7OA 1ORWA 5CMWA 3K0BA 1L4BA 2H5EA 4ZJPA 2AW6A 2FPKA 3A9TA 3QVWA 3Q7TA 4KAXA 2Y4NA 3OX2A 5JMPA 2C58A 2H7CA 2DT5A 3PX2A 1C30A 3SWWA 3BEOA 1GUAA 4IJKA 4B40A 2PKCA 1CHDA 3LUGA 7REQA 1D0SA 3J5QB 1CNEA 3GELA 1SPXA 3CRZA 5D6OA 5TIIA 2O48X 4FBMA 1GAEO 2Q4BA 2P9NG 3IOCA 3T7TA 5HW0A 2Y2UA 3BQMB 4AV7A 1FRZA 2I2CA 4H31A 3MYRA 4FS3A 1T0BA 1H2FA 1VB5A 3H86A 3LK6A 1MGOA 2B1RA 5JCJA 2DETA 1MOZA 2HCBA 2VAWA 1BRTA 3AUTA 3G2WA 4IRXA 4JS0A 2BFDB 2NYAA 3MG9A 3ZGLA 2VJ8A 3LYLA 1DX6A 3GW4A 5JRDS 5HKBA 3Q9UC 2AH5A 2UZ1A 1G20E 1OROA 1DEOA 2YJNA 4GSLA 3FBWA 2VP3A 1ETUA 5D2MC 1XDGA 2E0IA 2J48A 4PC1A 4ZXPA 1L7XA 3UO8B 4RPCA 3AFMA 4YRNA 1HE1C 2GN4A 4YDRA 3E37A 4UEQA 1CU1A 3I5XA 1R0BA 2CLHB 1DLJA 5ESRA 1TRKA 3FWZA 1JXQA 1HL3A 1KVTA 4MRAA 3RYTC 2EARA 3HABA 1WUIS 4YP9A 5BURA 4LF8B 2L42A 1NVTA 2NZYA 3IIIA 3KWLA 2RBEA 3ONVA 2ZBGA 1Y6ZA 3OC6A 3SE7A 1WXDA 3SFXA 3EIEA 3PPIA 2O6HA 4IM7A 1DIBA 5AM1A 4NU5A 4GGMX 3TMYA 3V31A 5CCDA 5BW8C 2AE2A 4OFWA 4NNJA 4NCXA 1Z2PX 4YASA 2FW1A 4YREA 4D0LB 3L02A 4RS3A 4YI3A 2LWIA 1FMTA 1IBCA 1Y1KE 1K1BA 4HFJA 4DR4B 3UXMA 4QELA 3K20A 1F3LA 3QVGA 3UN1A 1WKBA 1R18A 2MYTA 3L8CA 4GZMA 2AL7A 2ZSFA 3JXJA 3KJIA 4EW1A 4DMLA 3HSYA 4BE7B 4RZHA 3QW2A 4DQKA 1ENOA 3AYXB 2Y3IA 4Q4JA 4F97A 2B25A 4W1RA 3LP5A 4WKPA 3RUPA 1AOXA 1NXVA 2PPLA 4WADA 3RYFB 4KHPB 2XYQA 3B1VA 3L01A 2QRNA 4JT9A 4LJAA 1JECA 3L8DA 3RK1A 2BW0A 4PZEA 2H48A 3U4TA 1KK2A 2VK2A 1OY1A 1OFVA 2EIHA 2FEXA 1X87A 3QE9Y 1XTTA 4FJZA 1GXSB 3ASNE 2VFAA 5IUJC 5IXYA 1OCZE 1SUFA 4LWPA 3GYGA 4K7JA 4D9KA 2Q2VA 1XMPA 1FL9A 2OY0A 1N33B 1CUVA 1VDMA 2C82A 2L2QA 5AVUA 1OH8A 5I7HA 5HGXA 4F04A 4A16A 3HXMA 5DIFA 2HSJA 1I4LD 2P2NA 4IX9A 4EMSA 1QG6A 1FNDA 1ECFA 1SK8A 2GTPA 2WSBA 3BE5A 2WHPB 3JAWB 3I09A 5HQ3B 4E30A 2GW1A 3EWIA 1Y3CE 3OQVA 4ESOA 4JVOA 1J06A 4QFBA 2A9PA 3NEYA 4EBAG 1VLHA 1Z16A 3HJUA 3EODA 4CLDA 1ZMXA 1J8YF 1V41E 2RGYA 3D0OA 3ONNA 3PXDA 2GK7A 5DIZA 3W5SA 1RDFA 4BFWA 1Y3HA 1JKJB 3L7DA 4AJLA 5F9HA 3L82A 1TKCA 2V7GA 4NIMA 3DBLA 2O07A 2BFFA 4NYMQ 1QH9A 3THSA 3HVEB 8OHMA 2QG9A 1CP2A 3CKCA 2M6RA 3BX1A 1QQBA 1U0BB 4ML3A 4I7EA 2M1ZA 1ABBA 2YVKA 2Y4TA 1YDEA 1T9DA 3RLFA 3TQCA 4CM9A 1QWOA 3QXGA 4CEJA 2H07A 2HU2A 4XTCS 3FUTA 4ANFA 5JAUA 4UNIA 2HBZA 3GFOA 1QRUA 2ERYA 4PX3A 4JBNA 1YDGA 5JEEA 3INGA 4G36A 1C1XB 5DBKA 4DA8A 2GPAA 2GXQA 2GJ9A 1SXGA 2IDZA 4J43A 4DIUA 5JXWA 5F7OA 5ISMA 4RVGA 1LQTA 2CLIB 2IEIA 2OLEA 2CLKB 2JAXA 4HDNB 4OCZA 4URVR 4MRRA 3U4IA 1Y8CA 4QTTB 5CCMA 4ZQCB 5IHPA 2UUAB 2H7XA 1AUXA 5B37A 3N7UA 2CNNA 2XDQA 5BSEA 3MLBA 2C5AA 1XD8A 4RFLA 3GEMA 1VI6A 2EWWA 5C4GB 3LW7A 3A3NA 2DPXA 3EIHA 3QVSA 4Z1OA 3L54A 2AZ4A 2O23A 1YAJA 2ZATA 2RHBA 4QUHA 9ABPA 2WABA 3R9AB 1GNRA 2NP6A 2VPQA 2XUZA 2X8WA 3K1AA 1I7DA 5E8JA 1OLXB 2ZIXA 5ILOA 1TA4A 4FHFA 2GEDA 1ZICA 2IU6A 1NZFA 3R77A 3AHFA 4KZKA 4OQFA 2QL5A 3RF7A 1IN4A 1MX3A 4F2WA 1Z7BA 2O14A 5FFFA 3O8RA 2BLLA 5HQJA 3OEWA 4HGOA 1YB2A 4UHEA 3HN2A 3ICEA 2IS2A 2EX1A 5ITSA 4ZZ3A 4AQDA 1UZLA 3IE0A 4QBIA 2K7ZA 5D3QA 3HM9A 1WBDA 2OCCE 1Z33A 1C8BA 2FLWA 2VZ0A 3FWHA 5HUJA 5EVCA 2OHGA 2OMKA 3DHNA 3JVIA 4Y0NA 3EDMA 5DNEA 2NUTA 1VPEA 5C31A 4K6KA 4FNGA 1ZRNA 1OB5A 4NC9A 3KEAA 5C4IA 4Q3BA 1HTWA 4XZ4A 2R4UA 1NVKA 4KL8S 3AJDA 2XUJA 4MVJE 2I1WA 5IULC 2FUEA 1NXXA 4IS3A 3LT0A 3QWAA 2JPDA 1TMKA 5JAOA 1NVWQ 1U5CA 2JBHA 1DAHA 3QEJA 1HNZB 1EQUA 2ZXEA 1F8YA 1YMUA 3I4LA 4JKOA 4ZDJA 2AI3A 2UUBB 3DEIA 3KPUA 1JCQA 1VSTA 1FZTA 5LUBA 2YNQA 3R0ZA 2O2GA 4DW8A 4OSPA 1EFTA 5BOSB 1RMYA 1RPJA 1SC4A 3KBOA 1U8CB 1MO2A 2APJA 2PZKA 4HNRA 4HQ0A 3TCXB 2PRZA 1T26A 3LY5A 4BVLA 1L8AA 1R8YA 1XN1A 1SQFA 5ELLA 2P9UG 3IKMB 5HE8A 3URKA 3YASA 4CE6A 4NJOA 2J0UA 1T6BY 1Z3IX 1FE8A 2I66A 2O19A 2DUWA 4IEEA 1KZ1A 5E7JA 1WDKA 2H57A 5E6RA 2OXIA 5FV4A 2AG6A 2PE5A 1P5QA 5CW2A 4UHKA 3JVVA 1PX0A 3V9PA 3KNZA 1Z83A 4J49A 2ZRNA 4PLPA 4PLWA 2FU5C 2IKSA 1Z6YA 2AXQA 2VQ3A 3Q98A 1T6YA 4HWTA 5B1IA 3MGGA 3KLPX 2XGOA 3CIAA 3QX7A 1HYHA 1K8KG 3PGMA 3QPVA 2G9VA 3Q1KA 4CMIA 4HGRA 4F4FA 4MVJF 1DC4A 2G7ZA 2I71A 1MVNA 1I30A 2PHZA 3SO8A 3D7RA 3N8NA 1SRQA 3C85A 3O9MA 2ZTUA 3THOA 3ZQ6A 3IEIA 3A9CA 3CWQA 1R16A 3BCRA 5DNWA 1U7PA 4LHXA 4S24A 4R2XA 3SAJA 2KXPC 5ECYA 4PGFA 3PNPA 5KWIA 1E96A 4L08A 2ZJYA 4WMLA 3THYA 4QREA 3GQVA 5JXGA 3X1XA 1X1BA 1FXWF 4MP3A 5DLPA 2RI0A 4QRIA 3BHIA 2KZTB 2IY7A 4Q93A 4R4JA 1D1SA 1Q6ZA 3CVUA 4JL0A 3Q6NA 1A4RA 3ENEA 3HRHA 3USES 3ZZ0A 4RHXA 2GPSA 1OCCE 5A4JA 3C8UA 2HMTA 1CY7A 1VDYA 1DHTA 1PFVA 2K6GA 2JGJA 4JJIA 2PO5A 4JH0A 5IKXA 2XKKA 4M7CA 1A8HA 4NCAA 2Q3MA 3HYTA 2Q8NA 4PIMA 3KQLA 3M3DA 4FOLA 4CODB 2WPDA 4EBAA 1HS6A 2PKWA 2ZRDA 3C6BA 4LF5B 1LTHR 2QG6A 3OURA 4NEQA 8AT1A 1AJEA 2OCPA 2X2OA 2FZCA 2IC5A 2V55B 3I83A 4JKYA 4KVGA 1MORA 2C2WA 4K05A 4L4YA 3GAFA 1EGVB 3IJRA 1ITZA 2PJZA 3GJXC 3HV2A 2VUHB 3Q4GA 5CRIA 2YMLA 1VSQA 2QUAA 4IZ6A 4K6FA 4OAOA 2C3OA 3O8NA 1S8OA 3RR2A 3UYKA 4AIFA 3R6GA 2H1FA 1Q5PA 3I32A 4W6ZA 5JI2E 3A0RB 4JC8A 1YQWA 4EYEA 1KHTA 1HNXB 5BRJA 4RTNA 3W5VA 3K0HA 3L4BC 5FLKA 2RFAA 3ZNPA 3MUEA 2OCXA 4GE0A 3ICOA 1IC6A 1U9IA 1TCVA 1NW9B 3HVIA 2OAEA 4X7PA 2PRSA 3WL3A 5FPYA 1UMBA 1PJBA 1QYIA 3OXFA 1RI5A 2VBGA 1MO5A 1TUBB 1X6VA 1T24A 4XM0A 3S29A 5ALLA 3WKCA 4E5MA 1E5DA 1IPEA 3HQ4O 3L8GA 3PYXA 2AN5A 3NW9A 4UXHA 2ZYGA 4ARBA 1K75A 2ACEA 1BHO1 1OIVA 1ISIA 3O5AA 4AS1A 5C7LO 3SVLA 1OUVA 1B76A 2IYRA 5H02A 1MW8X 5H0IA 5IM4F 4URFA 1YA4A 4YAFA 4IG4A 1OH5A 3CRMA 3KUCA 3LJNA 2NTYC 3RFTA 1QZUA 3ML8A 5EWLB 4C7MA 4Y2UA 2Z5GA 1C9KA 4ROTA 3WIOA 2VXCA 1BHSA 1GKKA 3M4ZA 4MITA 3ZN3A 4JLVA 1BE8A 4N6GA 2QNRA 3FVWA 5E2IA 2OC4A 4UQLA 3U17A 2QRQA 1EM8A 4YH1A 4EFNA 1QMGA 4HS4A 2YS6A 4C7KA 4LF4B 1Z63A 4HYYA 2QEQA 2VLIA 3ZHEA 2CHFA 3RUEA 4APOA 2QD5A 3SDBA 1QIKA 5E4TA 3IRUA 1XE3A 4LQCA 1DAFA 1O9BA 3INRA 3LZ6A 4QBKA 1MX6A 1PSDA 1YJAA 3G0CA 1VCHA 3IV0A 2CZQA 3UJ8A 3I30X 4NG4A 4RF2A 2Y1EA 2AJAA 1AQLA 5HA5A 3K6KA 4DRXE 2A0KA 2I4OA 2OOKA 3K09C 2GRLA 1RACA 3DFZA 1N52A 3T5PA 3OQPA 4BT9A 2P9KG 4DWJA 5K3AA 2CHZA 2GVDC 4EHDA 4GB9A 1RRCA 5AKEA 5DM1A 4HGNA 2REQB 4JNCA 2PUJA 3G0HA 5EJ2A 1JKXA 3FJOA 2P1ZA 3TQFA 1QFZA 2GHTA 3T8MA 2GNPA 3GBSA 5DNAA 3QE0A 3ASUA 3K6RA 1K08A 2ZKLA 1DX4A 4GMDA 3RS9A 1V6CA 1AN9A 5IY5E 4X1YA 1Q0RA 2MINB 2VNKA 1YBHA 5FBRB 3TNJA 3SLKA 3ZWXA 4KN8A 2LO6A 1WS6A 1ODCA 2CEKA 5LZ7A 3ECSA 3WWEA 4R8LA 3VA7A 4L28A 1BS9A 3PQCA 4L9PA 4Y8VA 3FKJA 4OAPA 4YMGA 2X40A 2G6TA 4ND8B 3Q78A 3HKBA 1EFUA 2H3HA 3E1KA 2HUPA 1N5JA 1Q1BA 2PFKA 4Q47A 1KMIY 1GZ3A 1KPHA 3PXXA 1PHPA 4G86A 3L2OB 4MKFA 4JVSB 1JB1A 3E3OA 4M7OA 2BP7B 4TKVB 4PCAA 4QOGA 1PP4A 4YRLA 1LDNA 1LSUA 2UYYA 3UPDA 4X45A 4YFVA 2PWAA 4QDOA 3ANLA 4YALA 3IPAA 5IJWA 5JASA 3TUIC 1M0SA 4RVHA 2RD2A 3KTFA 5CVDA 3RJMA 3LUDA 5BW4A 1IUPA 1G42A 1NQXA 4X1IB 3AM4A 4NYJR 4M1SA 1YR6A 4QSHA 1I2CA 2Z57A 4NR0A 3SIXA 3W8DA 2GK3A 1KH1A 3E58A 1QH0A 5DI3A 3EZ9A 2BVNA 4BATA 1H9AA 1KY3A 3CZAA 4GVPA 4MUAA 5AJVB 3TLMA 1R0WA 1FQWA 1MEJA 1V47A 3QLUA 1QDUA 3SBTB 1V1JA 2FN4A 3L06A 5K5EA 1J0XO 1XT6A 1LUAA 3ZYZA 2FDCA 1H2ZA 3GLGB 4ND7A 3ROKA 4IZIA 3UANA 4WT7A 4EB6B 4ZANA 2YCBA 4PBRA 3KCQA 4QJ5A 1T0HB 4RESA 1FMCA 1VP9A 1XMQB 1IIBA 4MINA 1RZ4A 1ZA2A 1UZAA 5KJMA 4Q4DA 5KX5F 3U9SA 2MRIA 2XTAA 4D81A 3EDCA 1UDCA 1Y3BE 3HYNA 2UVPB 2GWHA 5JVDF 1PQ4A 4BNWA 3KTAA 3ANSA 4BP1A 2Z8YM 3N5KA 2FE4A 3RQSA 2VP9A 5D5HA 2BM0A 3TGPA 2RG7A 3KQUA 4DR5B 3AHIA 3K9FC 2VNSA 3OFKA 1V6SA 3A31A 4HMOA 2ALJA 2GF2A 2YN4A 3M5PA 421PA 3KS2A 3FNFA 2FHSA 4IP0A 3BXGA 4R98A 4EG7A 3JSXA 1I94B 1ZJYA 4WLVA 3IKOB 5EZYA 3SYLA 4J0QA 4OU4A 4I5GA 1CB7A 1LJ8A 1T9HA 3R0JA 4G0YA 5IC4A 1RCUA 1XD2B 4JVNA 4GMHA 4OQLA 2ZRPA 1N6PA 2WFLA 3BVPA 4R1LA 5AVWA 3HJBA 3QWWA 2DJIA 2XRFA 4AY5A 1UKEA 4Q4CA 1E1KA 5CLJA 4LNUB 1NLZA 4AUMA 3P9XA 3OT5A 4J0EA 3JZMA 5EXPA 3V2HA 5BWNA 1A04A 3SBXA 4MA0A 4ZQFA 3E35A 3FPAA 1JE0A 4DMUB 5BUQA 3HRAA 2ECFA 3A6JA 1VL6A 3H83A 3SHTA 1EVIA 3G9ZA 4C7BA 1RI3A 2BSQA 4NNPA 2V7XA 3RRNB 2YHBA 3EDQA 1UK6A 3PNMA 4HQ6A 3M6UA 4MDYA 3T8YA 3HKEB 2KATA 2YVLA 4B31A 5C8DA 4TTSA 7REQB 3DSVA 2YV2A 3DUFA 4TRRA 1YGPA 1X19A 3S2YA 2ZDGA 5EMMA 1F8XA 2XZDA 5GV7A 2RAFA 3UKJA 1T4GA 5CBNA 2I3ZA 2RIPA 4US0R 3IPCA 3FPGA 5DV9A 3RVLA 3SS9X 1NMQA 2G04A 1C8VB 2QM3A 4X64B 4AF8A 4FNAA 2ZUCA 3LCMA 4G0VA 1U8ZA 1S0UA 5TPWA 3R75A 5JC1A 4JCOA 1NNLA 5KUTA 1PVOA 3OCCA 3TTXA 3NGMA 4LWQA 5LNK1 4EHIA 4E31A 2FHPA 2W42A 5E1OA 2R11A 4KR3A 3CEPB 4B0ZA 1BLXB 1HNNA 2GBLC 5FUVA 1KETA 3QDNA 1M8GA 1NWHA 2A8YA 1ECCA 2H0RA 2HAEA 2I6UA 2V9PA 3PR2B 1G3QA 4A2QA 3WWCA 4YMHA 3PZ2A 2BR3A 4XYLA 5HXAA 3EPJA 3JZAA 4DM4A 1I5RA 4CRWA 1XWFA 1QYMA 1JQBA 2IW1A 3A4MA 3TVTA 1NKVA 3GV0A 3X1DA 1OILA 3VPCA 2C9MA 4RKYA 4UXJA 1YQEA 4YP0A 4XWOA 3K2QA 3FNEA 3SMVA 3QF4B 3U3OA 2IZ0A 1N34B 3GJYA 1Q44A 2MOKA 1Q3HA 1G21E 1X80B 4Q48A 1GV0A 1W46A 4XPZA 1C4KA 4AKSA 1OA0A 1X7WA 3E53A 4JP5A 2VSXE 5DVZA 4F56A 3N5CA 4M8KA 2AFRA 1FFYA 5LDDC 1P0QA 4YRSA 4MULA 4E6EA 4YHHB 1NFFA 4O5OA 1GQOA 3CF6R 4L3OA 1KWKA 4P31A 2DIWA 1LEHA 2P67A 3K3PA 3KQQA 3E61A 2IDKA 4FYPA 1LBTA 4ZKEA 2A78A 2OXRA 1AY0A 5KPDA 4IQ8A 1GUZA 1LF8A 5DHPA 3WK8A 3DCJA 3PHJA 3IRVA 2H1HA 2I55A 2JAUA 5T4YA 1J22A 3KLOA 4XR9A 1PZFA 4KRYA 2P1RA 3L7JA 4L5IA 4W8GA 4GKAA 3G79A 4ZOLA 1NQVA 1AGNA 4CQLA 2PLWA 3COVA 2QS9A 1JVBA 3GLGE 3CTPA 1H23A 3BL5A 3BM5A 3BXPA 1L6RA 4QO8A 4WWNA 5IMBA 3V2UA 5B4VA 2ENUA 3EA5A 2FB9A 4GVXA 4FYVA 4P2BA 1IDN1 2BFCA 3OPYB 1QUEA 4HLDA 1QCCA 4Q0MA 5HIMA 2YIVX 2ZJ2A 1HZJA 2HHAA 1UXOA 2BMEA 1Z7GA 3VO1A 3H1EA 3LCUA 3RKUA 4C22A 4EY5A 3AUJB 1IQUA 4NURA 2PY6A 4W1PA 4REQB 5KHAA 1WSWA 5IJAA 5JOQA 1XCPA 2ID7A 4GLOA 4HVAA 1TK2A 2JFGA 3AUFA 1W5BA 4XQ9A 3NFRA 4V0OA 5DTIA 4XVCA 4XSVA 3TSOA 4IIFA 4JUAA 1YCFA 1KXZA 4M87A 1FFXB 5C2YA 4KBQA 2ZPTX 3LIPA 2RGBA 2Y3AA 2D7CA 3ZFWA 3KQOA 3U7HB 2OT3B 1DOZA 3WKAA 4LFAB 1VIDA 2GYYA 3SD5A 1PJSA 2HRCA 3N71A 3ED5A 3FPFA 1LSSA 5F9FA 4CNQA 3LLUA 1NX9A 2C5GA 5LBIA 3L1JA 3KM0A 4DPKA 1IN5A 4EARA 1H3FA 1R64A 2JFUA 2GPBA 1M2EA 3CPEA 2HV9A 2Q5QA 4DCVA 2BBTA 1C8KA 3MWDA 3QA3E 1ZIPA 4IWYA 5KCMA 4II3A 4PF1A 5B1EA 1CVRA 1KO8A 3GAAA 4KQXA 3BG1B 1UFQA 5F2EA 2ODTX 4L75A 3SC4A 2GAJA 1QCYA 1UJJA 3FTUA 2HMSA 3GEHA 3EQ2A 1C1XA 2B20A 3NHFA 2BRUA 2G72A 2CWDA 4LF6B 5UKDA 3PQDA 4Y6OA 2IS1A 5ALXA 1FMLA 1KZHA 3IH5A 3A1CA 3O1IC 2CL5A 1A76A 2FW6A 3Q15A 4FI3C 4S04A 1ECJA 2VYNA 3MQ2A 2VA8A 4EMUA 2C3UA 3SPXA 3PUJA 1SBHA 5CB4A 2IH5A 1RRKA 3GYZA 3DF7A 4G6ZA 2PX0A 2WSSD 1ZG3A 3EZ7A 2HHJA 4HWRA 2C42A 3A4LA 2HA7A 2PWBA 5JH7A 3AINA 4KLCA 4QODA 3COYA 4RPJA 4UAVA 4D7AA 4OXNA 4G1EB 3LTNC 4PN7A 4UCQA 1FCJA 2JHAA 4BEWA 2JS7A 3HXFA 1Z7EA 2RGNC 3AIIA 3MWEB 1LVUA 2P6OA 5FIUA 4KXNA 4D92A 2J07A 2OKCA 3H42B 2FFRA 4GXRA 4PG8A 5CLQA 3VX3A 1NVUQ 1S7GA 5IVIA 1O95D 3LXUX 3AEQA 3OESA 3U4GA 2V97A 1XG5A 2DVMA 3ECCA 2CL7X 4GPD1 4BMYA 1PC2A 1R0SA 2PVCA 3Q3JB 1KDYA 4JV5B 4GQBA 1PY1A 2WF7A 1KJQA 2D06A 2QGNA 3B1ZA 3RIEA 5JNTA 2FE1A 3QEAZ 1M2VB 2C8JA 5EUMA 4DCPA 2GF0A 3GEEA 1WPXA 5I9SA 4MWSA 3LY8A 1LH0A 3WV5A 3H4IA 3D7SA 4AFNA 5KJLA 5JXIA 1CTQA 2G06A 2R1TA 1GSAA 4WEQA 5EP2A 2PRJA 3A6PC 4CMHA 4O3FA 4NMLA 1OA1A 1E7YA 1QM5A 3KEGA 2V8BA 4RYLA 3X44A 3ZLTA 4ACBA 4WERA 5LX8A 1Z5WA 4KRXA 3BGIA 5CX1B 4G24A 1HKUA 1VM6A 3EFOA 4O2AA 5ARGA 4YV0A 5F3RA 5FF9A 5KJCA 4UJ5A 4BGIA 3EPHA 3F3MA 4G2VA 1RFGE 1TNOA 1Q0PA 1B43A 1XMOB 1GZ5A 4DLBA 1KYYA 3TNDA 2WXNA 3ZUVB 1VGVA 1XA4A 3GFRA 3ODGA 4NTZA 3ZDBA 1H1LA 5HS0A 2X6IA 3H8JA 3ZX5A 1IYGA 4C7JA 1CIPA 4PN3A 3TGOA 3NC1C 1WCXA 5E6UB 2WXMA 4K5AB 4UTOA 1G3NB 1XKTA 1ZI8A 2OOSA 1TQ8A 3QJYA 1AF7A 4MS1B 4R81A 4H1HA 1PR0A 4DAEA 1FU4A 4Q5IA 5K4AA 3O48A 4P5DA 4OLHA 4WZBB 5K8TA 2RHDA 4XIIA 1UBJS 5T6BA 3VV3A 3K8ZA 2R7KA 4WN9B 1ZJ4A 4PC6A 1B6TA 5IAAA 3V8BA 3ZQJA 4UOEA 2POQX 5LLTA 4TPKA 1DKMA 1XTQA 3HY4A 2ZJZA 2FPPB 1VPDA 2J59A 3MTJA 2ST1A 5HKLA 3VYUB 2BH9A 3LV8A 1E66A 4J1TC 3NZSA 4RSHA 1NSYA 4QGAA 1ZC3A 4CUJA 3MS2A 3B5EA 3KE9A 4EYKA 3SF4A 3HLKA 3TW8A 4Q37A 1VP3A 3ZD6A 1L5NA 3W9UA 1UAGA 4OGKA 3N8DA 4PZZA 1T0PA 1UWLA 4ZRMA 5JCOA 4HN4B 3HVRA 3TWOA 3NQ41 3OD5A 3WBFA 5BWMA 1C1DA 3V2XA 3DSWA 3IQIX 1EVQA 1E58A 1ESNA 3MW8A 2JLSA 4KDRA 5FBZA 3O4IA 5LP0A 4OL9A 5EG5A 3GJ8A 4YXFA 3EXG2 4D25A 4GDFA 4QUJA 4KR7A 3ZY5A 4RMNA 1MHQA 2BMAA 1KL7A 4HUJA 5ERXA 5JLJA 2VCEA 2Y92A 1NBEA 3C4VA 3MJTA 1J33A 1E3QA 1G41A 1K6EA 1PJZA 1QIFA 4Q01A 3ZGXA 4UTNA 1M75A 4GR9A 2AYYA 1RHKA 3PTLA 3EPPA 2RGUA 3N07A 3FG9A 1CUBA 3T5VA 4B5KA 5J2TA 2P75A 2WSMA 4JP8A 3ZIUA 2AXEA 4IMRA 5LD2B 3TL2A 2J0SA 1C0KA 2EIXA 3VC3A 1EI9A 3L04A 3OI7A 4NMXB 1MC5A 5KWVA 4I6JA 5JDCC 1C0PA 5AVYA 3EFHA 3FH5A 1HA3A 1N9GB 4MI1A 3ADBA 1RBYA 3NBNB 3I72A 3U4HA 1C7EA 3OCYA 4XI0A 4HH1A 3NTOA 2QAGC 3P4XA 5DHUA 4DT1B 4JASB 4EFKA 1TK9A 1K8XB 2DOKA 1FSZA 1CV2A 2X86A 3ILYA 3GMTA 3HDYA 4GP7A 4M1WA 3UKOA 1C80A 3BSYA 4O6VA 1XFAA 2NMVA 3CX4A 2PZIA 2GCNA 1CJVC 1AKUA 3EQ6A 4B4UA 3UXYA 1QAQA 1RR6A 2WNSA 3WZ2A 5CPBA 5DSZA 3QK7A 3T1HB 1E7RA 2NUAA 1YR8A 1F8UA 5BORA 2PXCA 5HJ5A 4U2DA 4WJKB 2II6A 2NUPA 3D9JA 2V5AA 5CA1B 1CUCA 2ZSUA 3OT1A 3F5MA 1AKTA 1KA9H 4AJ1A 3JRWA 3CJQA 2QY7A 2VPYA 2VF2A 5T41A 3IDSA 3KAJA 4OG2A 4RGQA 2PL1A 5IZ4A 4XASA 1KORA 2X23A 5ED0A 1GD1O 1E3WB 1SCQA 2JD1A 2QMQA 2GRMA 2Q9AA 3W6OA 1RHQA 4LJYA 3GIWA 1EAMA 4RDCA 4UMEA 5AICA 3RYCA 1TT7A 5H83A 4GCOA 4RG9A 2V7UA 3PGLA 4PHGA 3SQLA 1MVLA 8ATCA 1ZONA 2J9YB 2QTNA 2ZWMA 4IDGA 4Z3DA 4MW1A 5ENPD 1IVNA 1IG0A 4TZ0A 3C5RA 2HV8A 2Q62A 1XMXA 1H2UA 4EJMA 2EF0A 3TKLA 5HS4A 2J32A 3AKYA 3ZH9B 3HZOA 5K0JA 2H17A 2GZ3A 2JEKA 2WFMA 4PYRA 1E77A 4B6RA 5JZBA 3E05A 2G1PA 2AMJA 2VHZA 1L1FA 2X9LA 2D0IA 3DEYX 3I12A 1FPMA 2FX2A 5THKA 2G67A 2ZJ8A 2CJWB 5E1BA 3S40A 1AHHA 5LBTA 3VU9A 3OZVA 1C0EA 3ZI7A 5ICSA 3SS8A 1PT6A 4KK4A 3D54D 1PJQA 2X8BA 1BYUA 4LHEA 1LF5A 3EUFA 4Y2GA 2F8MA 2JJ2D 1ZK3A 2HT6A 1X92A 5DPMA 5J58A 3I92A 4DI3A 2JI9A 3BMCB 4H08A 1LNQA 5IG2A 3AGQA 2QM7A 2FV8A 5EE9A 4BKQA 5GINE 4GKVA 4PY2A 2NC9A 2MSNA 5T4BA 3RIMA 5H3CA 3N2KA 3H75A 3M6WA 4J07A 2ZXUA 5I7RA 4PSKA 2VBFA 1LC0A 1YDHA 2GT1A 1DAEA 2VNHA 1XTKA 2P90A 3OJCA 4LJ4A 4MGZR 4QYIA 3R2JA 2IHZA 4G9EA 2FFAA 4CHTA 4KACA 1L7OA 3VTZA 3IS3A 2OHVA 4B6EA 2CVOA 3IDAA 1LCIA 4AURA 2GASA 5TEVA 4WFQA 3I3NA 4JVSA 1R0XA 2P6NA 4TKVA 3SDSA 1EUQA 2A67A 3HA5A 3TR0A 4J9UE 3RAEC 1TFRA 2BN4A 3DCIA 2B7BA 1NMZA 4XWAA 4DA4A 2EL9A 1I51A 5FO0A 3L4JA 3R3YA 2XOKD 3KE8A 5A2QA 2D00A 3MSCA 3OMLA 1PG0A 2XPYA 1L7BA 1KH2A 3QELA 2HHLA 3AKCA 4QPNA 1K63A 1UBHS 3RWOA 4U7WA 3L7IA 4I1UA 4YCCA 4F4HA 3DZBA 2V7EA 2RHGB 4PH4B 3LX4A 4OP1A 1ZGZA 4AMYA 2X3FA 4ITUA 1WEKA 1UT5A 1PJ3A 5JFOA 1XZIA 2YC4C 2R751 4M46A 3X1ZA 4BTBA 3O3NB 3ZU3A 3DB2A 1UXJA 3DEFA 1BDBA 1I2DA 3O26A 4DLTA 1EGAA 5ENQD 1JDBC 1ZZEA 2NNLD 1SCNE 1E8DA 1UOOA 3I73A 3N2YA 5FNVF 3D2AA 2XY4A 2YIJA 2X0FA 3L8MA 1CRLA 4KKXB 2IFUA 2PKQP 3PYLA 2CXPA 2JANA 3N28A 5B6JA 2W6MA 2X5KO 3QF7A 1UP4A 3W34A 3HU2A 1MENA 5HOQA 1O0BA 3O4VA 3ZGOA 3N6VA 4A10A 1ODLA 4G11A 2ET6A 2OXEA 2QP4A 2UVPA 5DTJA 1C9MA 5FWYB 4ZHQA 2AZDA 3ZEAA 2H2GA 2Q5JA 3ISJA 4PS0A 3EQ7A 2ZCUA 3ZU7B 2N3ZA 2WJGA 3OEYA 4TKMA 3E82A 3NXSA 1TA9A 3T9DA 3KKZA 1JIUA 3LF1A 3M89A 5L7YA 5HPYB 4DPRA 2PGDA 3E70C 4EPWA 1UDWA 4Q1BA 3JS5A 1KOGA 2I4RA 4RVNA 3QV1A 1A9XB 1YIOA 4TMKA 2ORVA 2WYVA 3PLNA 1NJ6A 5G4KB 3WGHA 3WFJA 1TVMA 1T6XA 2O2IA 3A4IA 3PZRA 4RJLA 1AQ6A 1GA6A 1H94A 1DKQA 5AESA 2WXLA 4GSYA 1TEVA 1NJ8A 3RSFA 4M0FA 3M82A 2XGJA 4UTZA 2WFLB 4E08A 2EDCA 4ISCA 4E15A 2G4LA 4CCSA 1J49A 2ZQYA 2NXEA 3UM1A 1BG6A 4ARVA 1EJ0A 3LPDA 2O7SA 4PSCA 2UXCB 1ZOLA 1JT2A 2XCTB 1JPLA 1QGUA 2QYHA 3FMFA 2G40A 3TSYA 3NV9A 2HE0A 1N8NA 3F3KA 1JIIA 3F78A 3NT4A 1EFLA 2E87A 1LVGA 4E2WA 4AQ7A 4YJHB 3OEED 5I9BA 2C7BA 4YT8A 3ESQA 1H2RS 4BQOA 4ZMBA 4CJXA 4MWEA 3KOZA 3E5RA 4J1SA 4EFLA 4WXRA 5JTTA 4KVAA 4O4HA 4FJ0A 5CMYA 4EI7A 1B15A 1KI6B 2IQIA 5HWSA 2ATCA 2R00A 3VNAA 1GT6A 1H2BA 1Y8QA 2FWNA 2XVZA 3ZIAA 5MGBA 3MCAA 4KQEA 3RHFA 2NIPA 3O0TA 2CV2A 3MINB 3N6RA 1TFUA 1DAIA 3NTVA 4KYVA 4H4DA 2FFBA 3MCTA 3I2GA 2PH7A 3NWJA 4Q66C 4YACA 5T4FA 3AG4E 1C4XA 3N0TA 4TV8A 4K9SA 5TE9A 2G25A 1QU3A 3KL2A 1S2MA 4F72A 5L7TA 4RA6B 4L51A 1XF1A 1SUPA 1Y3IA 4L0CA 4FGUA 4MARA 1DKRA 4JC4A 3TG5A 5EJMA 3D3EA 5TB5A 2JD0A 3DULA 5AIJA 3LKBA 3MS4A 2OBBA 2C2GA 3DBOB 1PFGA 4IIGA 3E27A 1GGNA 2O3UA 4Q69A 3T35A 4BYGA 1SOWA 3F6CA 2F9LA 2VHUA 1JEEA 3R09A 5T5QA 1DV1A 1Y4DE 4RVOA 5JJ6A 4IX1A 3AS4A 4QEZA 5DNDA 4NJEB 1Q2ZA 3FTPA 4P7KA 1WBBA 4Z5XA 3Q40A 3QX9A 1XSEA 1YL7A 2BFMA 3A2NA 4PWZA 4NOJA 1G0OA 2ATXA 4R31A 1G63A 5IAEA 4GAAA 2ZRCA 2ZB7A 4AN1A 3UQYS 3ZWMA 3NB0A 1OZHA 1QZ3A 3TWVA 1CUXA 3DZHA 3EC1A 3D3WA 3F6PA 3JYNA 3E9YA 1E92A 3K05A 2P9QA 4OIFA 1NBIA 3CX3A 4L1BA 3D6MA 4NBWA 4U3JA 5A2GA 4GYJA 1CEEA 3L8HA 4LJ5A 3MV3B 4UD6A 3REOA 4ZYWA 2QRMA 4M8LA 4OQPA 3CHPA 2Y67A 5CIWA 2KM1A 4BX0A 2B94A 2BEWA 4QU8A 1N5DA 3ZBQA 1HNWB 2NTEA 4BEPA 4REMA 1J07A 2M63A 1LPSA 1A17A 1YZGA 3LC1O 4LJ6A 1CUHA 2JIBA 3OY7A 3IBYA 4FEAA 4S2EA 1TM7E 2YWRA 3RFXA 3SKVA 8GPBA 3AKZA 3M6AA 2AD1A 2I7DA 5FQNA 1JLLA 1M2OB 2OENG 5KDLA 3UJBA 5E1MA 4WGFA 4WRRA 4WKCA 3ACDA 1YKSA 2GEBA 5C1IA 4WI1A 3ZDQA 3E9CA 3D9LA 3IUEA 4G84A 3D6JA 4MYUA 3TWUA 3BWMA 3SNKA 3ZTYA 4BESA 1CG6A 1OXTA 4IY1A 3PC6A 1FUYB 4C9BB 3IEXA 4DLXA 4M4SA 2HMWA 4Y0AA 3C6QA 4HEA1 3MJWA 3RC1A 1ZPDA 2H65A 2RONA 2Y9MB 3JQAA 4EJSB 3PQ3A 2HIHA 2VT3A 3T1NA 1JSRA 1ZGAA 3IDQA 4JD5A 4HWGA 1IHPA 3SBEA 4D3YA 1QB8A 3UJPA 1P9OA 2VUSA 3E03A 3EARA 1EWTA 3PVCA 4J1TA 4CU2A 2PUHA 1F0PA 4DQVA 3TBHA 1JAZA 3IQHX 1FQKA 5AM4A 4XEUA 5E3HA 1FFAA 1GGHA 2RH8A 3HG7A 1ISPA 3AWIA 2Y99A 3D4NA 3FDJA 4I9HA 4QNMA 5BRNA 3VTKA 1SEPA 2NM0A 4QXOA 3DZIA 1J2YA 1WDLA 3DXZA 1GT91 4KWTA 5K0ZA 5KDOA 3T3HA 4M76B 4GE3A 2XT6A 4ZO4A 4YGYA 3ZH2A 5LP6B 4H59A 2ANBA 3HPQA 4I1OA 3DEOA 2C2XA 4ZGBA 3BTSA 2PQMA 4YRCA 1MT3A 1WKCA 3F71A 4HFGA 2WAOA 1WABA 2QQEA 9GPBA 3QUQA 4A2WA 3HCAA 3IEPA 3ELWA 3GUYA 2D1YA 1R9MA 4H1VA 3I04M 1EQAA 2RG1A 1P0IA 2TMGA 3AEUB 4KIJA 4GTMA 5JE8A 4L8FA 1HV8A 2QYJA 4U6SA 5JATA 4QO7A 5MF6A 5THQA 1Z2CA 3DMYA 3EIQA 3I28A 2W6OA 1TMOA 3VR5D 3VHLB 1WU7A 1XNHA 3FTVA 3MN1A 1SHLA 1Z34A 1T5HX 2CMFA 3FDZB 1LK5A 1Z5VA 4GZ6A 3PEUA 2WKWA 1JV2B 1HT1E 3IXMA 3MNFA 1L3BA 3N7TA 2WU8A 1OXBB 1R0CA 3BWEA 3I64A 1ZRHA 2IEAA 3L0BA 1A9PA 4TVKA 1H0SA 2LP4Y 4Q96A 3KT6A 2WQ7A 3IAXA 4FCWA 2ZQ5A 3I3SR 4X3OA 3T1VA 1NN3A 3LUFA 3MKQA 1MEEA 4TMXA 3SGHA 4C5CA 2FSUA 2OHOA 2XCLA 3M3PA 2ONKA 1E3TA 3R5JA 3QEMA 3WL7A 4BKPA 1EK1A 3CQ9A 5KTRA 1GPNA 1XZJA 2L6JA 3Q3IA 3CUKA 3WSVA 4MRUA 2W2KA 5DBIA 5KQPA 2ETVA 1AGPA 4C6HA 2XB6A 4TTRA 1HEYA 6NULA 2I34A 1LQ2A 1WBJB 4KR0A 4DBZA 1JPJA 5JNUA 2P4EA 1ENZA 5IKEA 1Z0ZA 1PJ4A 3TZCA 2Q3DA 3DL7A 2B0OE 1T1JA 2GBFA 1TQ2A 3ESRA 1FNNA 4AECA 4BO8A 1DXHA 1WOMA 4BNKA 5KTPA 1O77A 4RS4A 2FGJA 5K3CA 4TYNA 2RGGA 3BQ9A 5FP0A 4WNGA 4I50F 4QIHA 2W0SA 3DHWC 1JI0A 4WFJA 4L6IA 4KWIA 3COPA 4D4MA 5EN4A 1JHOA 1JUDA 5D01A 3I9V1 3ZWDA 2IP4A 4FR2A 2MCFA 5AFSA 5CD9A 3GRPA 1F5SA 4PBSA 4BMOB 3KZCA 2KW5A 3P97A 5LQCA 2C88A 3D81A 5KDDA 5EKUA 1U8YA 1V43A 3RTEA 1R1DA 1OI4A 5EC8A 3FSEA 4QVIA 4WBNF 4I9UA 1KS2A 4TKLA 5ITZB 2PFGA 1Z13A 1Y7HA 4LC1A 2FZ5A 4PRYA 2WTAA 5AMXA 3VU8A 2QI9C 2W6ID 3F90A 1QH1B 3G1TA 4IAOA 3AERA 4C0MA 4Q7LA 1YWGO 4D43A 4TT3D 3T06B 3X2EA 2H1LA 4RSGA 2O8EB 3B78A 4PPGA 3TPCA 1R27A 1VYUA 3E7DA 2CUTA 3RDPA 3AEXA 4M21A 4R41A 2CMKA 4EIWA 2I80A 4Q4AB 4BO3A 3T34A 4JA2A 4RL4A 5EQJB 4DJEC 4LN1A 2ZRMA 3C7AA 5J4LA 3ZHRA 3GA5A 2K7FA 3SYRA 4S3MA 2PUGA 2HY7A 1XZKA 5FIOA 2QSZA 1MXFA 1Z18A 2GCGA 4A23A 3WV4A 3T7KA 2AJLI 1X81A 2QQ5A 5KQLA 1MZPA 3EC7A 1Z26A 5GONA 1XLWA 5F21A 3ND5A 5ITZF 1YONA 5LQUA 4B3TB 5BN3A 2H4WA 4GBJA 4QT4A 4RH1A 5CB0A 1GPBA 1SEVA 1U4NA 2TECE 2CFZA 3VR5A 4BQEA 3AZOA 3DDOA 1PFQA 5C4MA 1PNOA 5IDYA 2WVJA 3KD2A 3QMMA 3TVYA 5ADHA 2NGRA 1E3DA 3U7GA 3DDHA 3WB0A 1IXVA 3NBFA 3SKXA 1ZC4A 4RK1A 1G3IA 1IDOA 2RJNA 2X5JO 1WUKS 3JQQA 4QTXA 5FWAA 2CFUA 3RO3A 2P3OA 3UV6A 4CU5A 4QXPA 2QMHA 1RLUA 2B98A 3X1YA 5I45A 4Z4FA 1VSUA 1O6CA 5ALZA 3FYUB 2BGGA 1OB2A 4N6OA 2VPPA 4CM1A 1NR1A 2HR1A 3PHIA 2Z6QA 1DQZA 5ENDA 5AK0A 3RK4A 2OP1A 4QDZA 1U94A 3M2PA 1X7YA 5CW1A 3KC2A 1H2YA 2AOWA 2NVUA 5TQ0A 5C7OO 4X97A 3UWKA 4UC0A 1IMOA 3ETNA 3PV0A 4M1KA 5KWSA 3CF4A 3EEYA 1YJXA 3CTMA 3OOJA 1X86B 5F76A 4KXLA 3WTCA 2VAMA 2C61A 1ZW6A 2VEDA 1SVMA 2JI7A 2A84A 1NI1A 4BN4A 4CQJA 3LVBA 1VMAA 4NPHA 1TU3A 5BVHA 3IHVA 1W4ZA 1XTJA 3P26A 4A73A 1YRLA 3NBKA 1OLSA 4D3XA 4CUZA 4DNOA 1SUBA 4CUKA 4IFBA 3W6PA 2H4FA 3DW1X 3FBTA 3COWA 5ETJA 3M6IA 5TDHA 4BGEA 4BUZA 2WWWA 4HVCA 3UJNA 1D8TA 3CY6A 4ZZ0A 1Q3TA 2FRDC 3JQDA 3JR3A 5A5FA 1G7SA 3NEJA 1GOTA 4ZP1A 2PXHA 3REGA 5G0TA 2XWSA 3PX3A 3DSRA 2D5AA 3K1YA 1CDDA 3OT1B 4HWPA 4OM8A 4B6FA 4G63A 5BNIA 3G5LA 4H60A 4DX5D 3WGJA 3IE1A 4HQDA 1WXIA 4HB5A 3U61B 1AB6A 1E18A 2P65A 4JGGA 3ESKA 1N3LA 1NJSA 1IVSA 2OOEA 4MQFA 4PQEA 3A25A 2WYOA 1E2GA 2JARA 3FVVA 1UAAA 4NACA 4YJGA 2GZMA 1WXFA 4ODIA 1VJCA 5ANLA 2OSVA 5MGNA 1C7QA 4ANXA 2CBZA 1A3CA 3SR4A 1GL9B 2FULA 1RQNA 5FWXA 2C78A 3DE4X 2JL1A 2RHRA 1P5ZB 2QDKA 3S5UA 2CJXA 3T7SA 5AT1A 3QI2A 1XPRA 4HAOA 1HE2A 5FJJA 3B95A 4Q1AA 3L0YA 3WG9A 5K8UA 1LRKA 1BXGB 3RFVA 3PC8C 3U60B 1B0AA 1L2TA 2JFWA 3B52X 1OXJA 1HM5A 3H2BA 4KZPA 2CXRA 4H6PA 4LKRA 4CR6A 3VO8A 5INTA 3LI2A 5JMOA 3PUZA 4YQYA 2CJWA 3BUSA 1AXGA 2IIBA 2FSSA 3K2EA 2VUTA 3SQVA 2GYWA 2BL4A 4UBMA 1EDOA 2HNBA 5BT9A 2NPIA 3PEVA 3B2QA 4NXMB 2F9FA 4E88A 3CR3A 4KFTA 5H3HA 5YASA 5K0LA 4AMUA 3F7MA 1I7SB 2PKXA 4Q94A 3H5IA 4GR5A 3WYFA 4QTUB 1E7MA 3WY9A 2M98A 3GZ2A 1KYTA 3NBXX 2WG1A 3W5IA 1TJFA 3OLXA 1IBSA 1C2YA 4PCVA 2NOAA 2PZLA 4ER7A 1QNFA 3NAWA 2CXUA 2YS7A 3TL5A 3HVJA 3QA9A 3NH6A 1V7CA 3LECA 4KFUA 1MV5A 1PGPA 4MIKA 4YAUA 4JA0A 1F7VA 3G7UA 2I2BA 4I1VA 3TQOA 1FTYA 3A4NA 2JIPA 2HWWA 1MB0A 1MNQA 1EG2A 2GJAA 1M6VA 1QC5A 2NWQA 4QBTA 4TLLB 1X1DA 1REQB 3IKLA 3EFEA 3O74A 5MFPA 1R0YA 2SNIE 4B8WA 1C9EA 2Y0CA 3G8BA 3NHYA 4FSXA 1L5GB 4LE1A 5M29A 1Z37A 2G1JA 3GMDA 4GS5A 3RRUA 2G4CA 3QELB 4QPJC 3TMKA 3WLJA 3PQFA 4FTWA 4J0UA 1Q0QA 4PONA 3Q2OA 2OBXA 4O4IA 1AK9A 3HYCA 1GITA 3BAZA 5JS6A 3T1TA 3VSAA 1G5TA 4MV5A 4JUCA 4CQMD 4B33A 4ZTUB 1CJKC 3FSGD 3A1WA 4DLWA 4CYMA 4Q6WA 5EPUA 4C4XA 3OSZA 1K6XA 5EJIA 1YTLA 1JG1A 4MYRA 1VE6A 3UOWA 4J29A 1UL1X 2XMQA 3FI9A 3I8OA 4HAYA 1DC7A 4LZPA 4JI5B 1GVNB 2B35A 2D5IA 3U44A 2A58A 5BO5A 3FBGA 1CY1A 3INNA 1VL0A 4JSRA 2NXCA 3A28A 3NHRA 3LHKA 3UG6A 5E8RA 5DCYA 3NHZA 4QOSA 2PWZA 3NHSA 1M34E 2IXTA 1KK1A 2Q2WA 3H3XA 3VH4A 1H69A 1WOYA 3QUTA 4WOJA 5EP3A 3CZPA 3S2EA 1TOAA 1Z8HA 3GVIA 1KEKA 3V7WA 1ZD9A 3W1EA 1IOZA 2XITA 4FWIB 3JATB 2DULA 4WNFA 1I6WA 3OBIA 4JNKA 1ZMBA 1VZ3A 5AOCA 1UH5A 2BMFA 5ER6A 3CF4G 4YROA 1NPYA 1JEJA 2QJOA 3V8MA 4DOMA 5KQMA 1HG1A 2OM6A 4FHCA 2BKEA 4FMBB 4R3WA 4Z54A 5A5VA 4LRTB 3PUIA 1XEWX 2DUJA 2J30A 4AVXA 3DMFA 1Y42X 3ILHA 1B74A 4EZJA 5I8ZA 1BU9A 4NDZA 4OYLA 1XN4A 2XDWA 3PHCA 1FF9A 5LCXA 4XSHA 5ESXA 1G8HA 1U65A 2XYPA 3HWRA 2EW1A 3UQ3A 1NBOA 5CX4A 3K09A 3NBZC 1KU6A 2C3PA 4M3OA 2FDXA 2N9UA 3AG6A 3R0XA 4M1OA 3DC2A 3DE1X 2DWPA 1PTJA 4UNPA 3QU7A 4B82A 5HKOA 2JLVA 3LL4A 2H11A 3JD4A 1KTIA 3KR2A 2PMEA 3VTFA 1LDBA 3AUXA 4LE0A 2ZYRA 4U9UA 2XQJA 5JROA 1H5UA 1VG9B 3ZDYB 4AJNA 2ETXA 5FOUA 4K9DA 2COKA 2NX2A 3H4VA 2P8JA 3UOGA 1T8TA 4TLBA 2BCGY 2OKGA 3ZD7A 2J9QA 1JFVA 1GKIA 2IUYA 4EHNA 4PZAA 1VSVA 4MNTA 4BXOA 3FHTA 3C3MA 5EJFA 3OQBA 5HZMA 4TV8B 3JUEA 4IDNA 3ZTWA 4DPLA 2I65A 5C37A 3LO8A 5FPHA 4D02A 2LXMA 5CYGA 1R2QA 3GGJA 2JFQA 3HKBB 2RAVA 2QMUA 3KVRA 4JJ8A 1I5EA 2XYVA 3LIIA 4G5XA 4M1EA 4P4UA 4TUYF 2OWEA 4B6JA 1NW5A 2Q9UA 3D8TA 4LV8B 5IUKC 5AM2A 1VMKA 5KU7A 2JLWA 1G19A 5DNYB 4NQZA 4OK6A 2C4UA 1JAXA 2I29A 4KIWA 3TOCA 1GRVA 3FDXA 3SQOA 4Q3EA 1S70B 1DAPA 2H1WA 3ILXA 4N5HX 4O1IA 4ZGGA 3PEYA 2HCJB 3ZD8A 5KJFA 4LCBA 2BSXA 1RD4A 2V4UA 3JQCA 4ZI7F 1DCFA 4O4LA 4JJFA 3CUWA 3JZIA 3KSMA 4ZEVA 5KSPA 4JA9A 1KP9A 1R0LA 3GVCA 3E0QA 2FPGA 2QTAA 4KLZA 2QTCA 1MLDA 2F00A 4W99A 5AJYA 3Q7AA 4QULA 3EUAA 1AH2A 3L8YA 2YNMA 4OMDA 1AQNA 3OF3A 2M9MA 3IMKA 3SEAA 4G4GA 2R2LA 2GCOA 2Z04A 2XENA 5ALEA 5FXMA 1II0A 1UBEA 2IYYA 1XFDA 3U4CA 3IDFA 4HYTA 2ZZMA 3VSBA 1TNZA 2UVDA 4FWBA 4L8WB 3W8RA 4AJ2A 4DIDA 2HWYA 3KHUA 4J3JA 4CLXA 1GUDA 1YGYA 5EHIA 4BRUA 3I0MA 3OJWA 3DSTA 3AG1E 3VZCA 5BVGB 3WNBA 2YHIA 4QOHA 1EYHA 3E2IA 3NHUA 3ED1A 1I4EB 3NPMA 3BWBA 1KEEB 4YRDA 3RIYA 3V33A 1GFSA 2X2PA 2ZJ1A 1S1CA 2ZIFA 3OKFA 3P45A 5LR6A 1X38A 3QKUA 1RW4A 3JU3A 4FGSA 2Y76A 5D5PA 2Q5OA 2CFOA 3N75A 4PCUA 2V1XA 3DZGA 1FSSA 1YBFA 3RROA 4N0QA 3DKIA 1OX5A 1T4DA 1N8KA 1PZGA 3MEQA 1WP4A 2DZDA 1KDZA 1D4FA 3BQNB 3IT1A 1OZGA 2GRPB 1QIEA 2X76A 3LUKA 3GUHA 3QVJA 4IN3B 1L4KA 5ULLA 4U96D 4F5ZA 1N0QA 1F2VA 4CKXA 1NVAA 3U7FB 1ECBA 2X5NA 1EUZA 1Q0HA 4IH9A 3H2HA 4JEUA 1MIOA 2ZJ5A 4WASA 4ARSA 1HZZC 1QF7A 3KPJA 5IJXA 4C1BA 5SV2A 1WIWA 1BFDA 1FT2A 1LBQA 1QUFA 3PNTB 1ODSA 1QK3A 3THWB 2AC4A 2X5OA 3HB0A 3HKEA 3JZDA 4GLFA 4L4SA 1JAIA 5C8YF 4OQMA 1XHEA 4QVKA 3VRHA 3I5MA 4GR4A 4MQBA 3X2QE 3L0ZA 2VYFA 1X7XB 1FW8A 1M83A 1QBKC 2ZCVA 5DP1A 4GMRA 4MPTA 5CVEA 2WQ6A 2LE0A 1SZAA 5A05A 4Y9DA 1LKZA 1DCEA 1FLVA 3WYGA 3PD0A 5AQEA 3O2JA 5DGCA 3PEUB 4OHWA 1GTZA 1QOQB 4B7CA 3K0SA 3RT1A 3G6KA 3FOWA 3SHWA 2DFNA 1SXQA 4KREA 2AG1A 3UX4A 2CYCA 1K89A 2GO7A 1CD5A 4MTLA 4RH0A 3AOEC 4HXIA 3FRJA 5NLLA 1IQPA 1ATIA 1QB7A 2NZUG 3CLTD 3L6OO 4JIGA 3Q7QA 1W44A 4J2TA 4KITB 1NT4A 1IWPB 1IQ0A 4TL8A 4R7GA 1WHSA 3DV0A 1AV6A 1TIPA 2O2CA