1FVFA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
590
structure length
543
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYVEKEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords SEC1
publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
total genus 187
structure length 543
sequence length 590
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvfA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvfA03
1EPUA 3C98A 4JC8A 5BV0A 4KMOA 3PUKA 4CCAA 4BX8A 3PUJA 1FVFA 2XHEA 4JEUA 4BX9A 1MQSA 5BV1A 1FVHA 5BUZA 1Y9JA 4JEHA
chains in the Genus database with same CATH superfamily
2H2GA 1SBIA 1UEXC 2GX6A 4L5BA 3X1JA 3D0KA 5EWLA 4BU1A 1FQJA 5D8DA 1WW2A 1A1SA 4MUHA 4DCPA 5AHWA 5IKPA 4RTRA 1G59A 2RKKA 4JENA 1VSTA 1NX6A 1ZD1A 2QYOA 4BNWA 4DA9A 4BWYA 1FF9A 3KZMA 4JJAA 3N8GA 4L3VA 3TRDA 4DIMA 5ESWA 4M9QA 4DA4A 2UUBB 3KL2A 2DBRA 5K8JB 3UB2A 5DP2A 5HKPA 2XJ9A 5H3HA 4JI3B 1LGYA 2FY8A 4U02A 4KAJA 3NYRA 2VLIA 1ZVQA 4DSOA 2V7GA 1K3UB 2XHZA 1BD4A 4M1EA 4N8EA 1CNMA 1GYPA 5B55A 5JJ7A 1KYWA 2A9FA 2BHSA 2JGIA 4OJMX 1PWYE 2QV0A 4N1AA 4TQAA 1F06A 4U39A 2YUIA 1Y3AA 5EVJA 5IZ4A 1E4EB 1C8KA 4EY5A 4GTQA 4ME2A 5HVNA 4Q9IA 2V7VA 4DN6A 1K1AA 2ZI3A 1V4NA 4H3KB 4UTVA 1JRLA 1YBHA 3O0TA 4B3XA 3RU0A 2PMWB 4FDTA 1DEXA 1NT4A 1E5XA 1Z0JA 3Q8XB 3CLSD 4D9NA 3V42A 3HZRA 1GR1A 1KKMA 3KETA 1GM5A 2QLJA 1AN9A 3BBPA 1PYOA 3AP3A 1Y6GA 1MO5A 3RAGA 3OD5A 2IP1A 4QDKA 1MBZA 2EIXA 2ZBDA 2PSDA 1YQGA 3FNGA 4A0HA 3B1WA 1FMFA 2C61A 2IPOA 2F8SA 4DMMA 1C1HA 3SE7A 4EI8A 1SFRA 1GU0A 2R1ZA 4DQDA 2ZJYA 1JI3A 3R3HA 2XNSA 4CIWA 3I2GA 1P1BA 2BGMA 5LDHA 4XGRA 3LLUA 4D4IA 4U7DA 4M1QA 1MB3A 1R27A 1PEKE 4CEIB 3N0XA 3I1JA 3K5IA 4TL8A 3RFCA 4BGDA 4Y6RA 5CITA 2ZFUA 4MVJA 4NF2A 4NRHB 2WYIA 5KQPA 3VGJA 4QGBA 3T1QA 4YCSA 3MN1A 2QM0A 1HDGO 4B34A 3VNVA 4UMDA 4PR3A 4P5PA 3OFND 1UADA 4EHJA 1P61B 5KVAA 4Y0NA 3E61A 4Z1MD 2FRDC 2QN6A 5DTQA 3I5AA 2OXRA 4YNDA 3KXDA 3N6RA 4HHEA 4JBNA 1U3FA 1KJ8A 5JYBA 1U4NA 2OV1A 2GD2A 3FYHA 4HAOA 3E0XA 2BM9A 2DQ4A 3V8NA 1YR6A 4GM1A 1QQ7A 1IM2A 4B7CA 3AR2A 1A8QA 3WGLA 1K8ZB 3D3QA 4MUKA 1Y1PA 2UYCA 2FPSA 5BOSA 1R4MA 3CZ5A 1Y37A 5C1IA 4IIJA 3T34A 5HQJA 3WA7A 3VR0A 3K1TA 3A1CA 1IBMB 3OPQA 2R00A 4Q1EA 2QN7A 5DHRA 4DC9A 3NJRA 3C7CB 2GHRA 4QD3A 2Q5FA 1ZXBA 4AJ4A 1GPYA 1OI4A 3WLIA 3Q3GE 3U3ZA 2Z5LA 3OC6A 4CLDA 4Q3KA 4ZICA 3QLJA 4MPRA 2TRSB 1OVMA 5JANA 3MYYA 4E5KA 1YOVA 3H8WA 4EB6B 2WWHA 3UI2A 5EE3A 2LAHA 3R7RA 1B0UA 3AB3A 4HTFB 3MGAA 1Y5MA 2F8YA 5FLKA 2G4LA 3JXJA 4BAGA 4FLHA 1HMPA 5IWCA 1HDOA 2F67A 4ENTA 2SKDA 5DIZA 1HUQA 4URKA 2Q45A 4HYYA 4OJYA 4BJ6A 1LDMA 4R2JA 2E5LB 1RQLA 5CBPB 2OCPA 5FQOA 2WHXA 1IJEA 5AJUA 2Z4RA 2JIZA 4DYHA 3OTWA 2YIJA 3ZD8A 2WVIA 1ISPA 2DHQA 4G26A 2PBFA 2VSXE 2P5YA 1N8KA 5JSFA 2J8SD 1TM5E 1F8YA 4D0LB 2FW0A 5B1IA 3PI7A 1Z7BA 2Q1WA 1REQB 3MCZA 1JHMA 1E5QA 3AT1A 3F5QA 4J94A 4NARA 2C2KA 1PNQA 3S6JA 4QAJA 1E6UA 3G0OA 4Q7MB 2NXJA 2Q8NA 3EYWA 3H5WA 4XUEA 3FCXA 3DCNA 1FXUA 2R96A 1AV7A 2UYQA 1UJ4A 2YOFA 1FFWA 3G02A 3MYRA 3CNLA 2QRQA 5DX1A 1DC2A 3TXXA 1BQEA 5GVRA 1XZPA 4AUEA 3SEAA 3AG4E 2OXEA 5KQGA 4IUDS 5EHQA 1RYBA 4UEWA 3BSYA 4MQBA 4NYMQ 2P0AA 3SZOA 5DHSA 2QAIA 1H94A 3GLIE 4PLVA 3CR7A 4HI0E 2BM1A 1SEVA 2ADFA 5FF9A 2Q1TA 4LV8B 5C4IA 2GN9A 2K7ZA 4JI0B 4BP8A 1XL1A 5BUZA 4FJYA 2AG6A 4ZVNA 1A7UA 1ZJ4A 2VAPA 4P3KA 5EE0A 3ZDXB 1V48A 2PG3A 5ENNA 1F4VA 3VPAA 3U16A 3LD9A 2EWVA 1I3OA 4PQFA 1R6XA 1IWBB 4JJZA 1JFVA 4MKRA 3MTDA 2QK4A 3ODPA 3TZQA 1MQSA 2PFSA 1M0TA 2CVZA 1X7XB 3VO9A 3GT4A 3H2SA 4PN3A 1I4DD 2DPLA 1LW7A 1E8DA 2FXVA 4M2LA 1TKBA 3E9YA 4RANA 5FB3A 3RDPA 1CX9B 3SQXA 3BQOA 2JAWA 2AW3A 3CK8A 1P9RA 1T4CA 3TTTA 3ODGA 4PGMA 5JWOA 1EUCB 3AHEA 4AQ7A 2OBLA 4U00A 4LYJA 2P2LA 2VDUE 2PZIA 1JFFA 3BFVA 2X3UA 2HMTA 1QAMA 5A7GA 5EXDA 5JCJD 1UEIA 2YWRA 1PGPA 2NAFA 3JV7A 3UGTA 5EIOA 2FZKA 1N5MA 1T9KA 3GLTA 3I61A 1KE2A 4GTRA 3TR6A 1KI4A 3LBAA 3KVRA 2ZT6A 2XXBA 4DQ0A 2JPDA 3D5EA 4EF6A 3AY0A 2XUOA 4UKDA 2FMHA 4DRYA 1YRWA 2A9PA 3EGCA 3ESBA 5DK4A 3D7RA 4LJ8A 1ZDMA 3U7JA 5CFZA 4BO0A 1BQ3A 4N8DA 3NFYA 1SEPA 2J0SA 5DYNA 2GUWA 4MR8A 1AIPA 3DBRB 3DOIA 1GLNA 1DBSA 4GRIA 1EYZA 3IFSA 1A4XA 3BSFA 1XFAA 5FFNA 3FDIA 3OE5A 3HP1A 5LDDC 3PD7A 1NM5C 1NMEA 5E8JA 5CDGA 4O0MA 1UPXA 5COBA 1HT3A 3KB8A 4CKCA 3GUVA 3B13B 3ZJVA 1P0CA 1HDCA 3TTYA 1QM5A 1T3HA 1B6TA 5DXFA 1MIOB 4PS8A 2BGUA 4AL4A 2AUMA 2P1DA 2QNIA 2DC1A 1JMYA 2EVWX 1UXOA 3L82A 1NNSA 3CNEA 3JD3A 1JQAA 4WAUA 4D9MA 4RF4A 2YMPA 2C5GA 1LD7A 1JJ7A 1PNTA 2VDWB 4AK9A 5L45A 4BNNA 1MVOA 3GIDA 3I1YA 1FTNA 2PT6A 3ZHSA 1YQUA 2C5SA 1HNNA 2AUTA 3A27A 2GDZA 1Z6YA 1J39A 1P0PA 4WXHA 1Q84A 2MSWA 5F1OA 3TTXA 3NANA 2CJFA 4PZ9A 4AF7A 5D6OA 3KQHA 3KOWA 4ARAA 3ASUA 5AUNB 1VG9B 4LSZA 4YCJA 5EJ5A 4AECA 3EIOA 2ILTA 3T4EA 5CYGA 5EUQB 1IXRC 1Y3FE 3H3XA 4GA2A 16PKA 4Z9YA 4IF6A 3DSSA 4TV8B 2DZDA 4YDSA 1E7QA 2B8JA 4EI9A 1MIHA 1C7IA 3WWPA 2WEKA 2H11A 4GOLD 4Z7QB 2L6BA 4DJAA 3IYLW 5FTKA 3DTNA 4PR0A 3X1KA 5ALUA 3GJ6A 5C7IO 4WI1A 5G41A 5C35A 4M9RA 2IXAA 2IHVA 1M83A 1WETA 2Z8ZA 1V0JA 5IM5A 4G4SP 3B53X 1U81A 1Z33A 5H16A 4WZBE 4OVUA 2AX4A 3GCXA 1II9A 4UNRA 5A71A 3RYCB 2QGZA 2IZ0A 2YMQA 3IDFA 3JYLA 1KEEA 3DL0A 1JEQB 3G2NA 4B81A 1ANKA 2A5DA 3UWPA 3FKSD 4O4LA 2HJRA 4ZK2A 5HFJA 5BW5A 3FSGD 4HGOA 4ZVUA 5H0IA 1WV1A 3RRXA 4M0LA 4YBZA 2XQFA 2WB4A 3P0FA 5J4KA 4PVDA 4PG4A 3PCTA 1Y7LA 1Y5IA 3USCS 1D03A 3IVAA 5ALNA 1KYQA 4FDMA 1IHDA 4JI4B 1U7HA 1BD8A 3DLHA 4DIFA 2EKPA 3FUWA 1PD1A 2VZ8A 4J4BA 4I3FA 3IXMA 4ILHB 3GFRA 1S8FA 3P71T 4KNYA 1MF7A 4HBDA 3I72A 3ZKWB 4CWAA 2W37A 3DKKA 4G9EA 1GV0A 1Y1SA 4V1CI 2CEKA 2OOEA 4Q7QA 1FL9A 1WXHA 2WAAA 1KNQA 2BH9A 1NRIA 1MG0A 1WSAA 2DKOA 2ZE8A 5H70A 1T35A 5LZ7A 4P8RA 3HCAA 4O2AA 2P11A 3MELA 3FGPA 3ESLA 2ETVA 2BP7A 4FDAA 2WPNA 4ZI7F 4LK3A 3CWCA 2ZYHA 4FILA 4ZCRA 1OSNA 3A1EA 4K9SA 3FROA 3M0EA 4KR7A 1UR5A 2VHXA 1IBLB 4BMYA 3KP1A 2MR5A 4BMZA 4ZJUA 1EGMB 4JA0A 4QOIA 1PG2A 4ND4A 1LDGA 3SXUA 4RVUA 1GRNA 4LXXA 2MMCA 2MINB 2A5FA 1VI6A 4RD4A 5CDTA 5DHAA 3S7FA 4MHOA 4R5MA 4XCQA 2FEZA 1E2GA 1ZS9A 1PUJA 4R54A 4RY9A 3RRFA 1JFSA 4YCMA 3X2FA 1ZVVA 4GEGA 3ZTWA 5C1PA 3PRHA 2B98A 5ECYA 1UJ6A 3QE0A 2IYZA 1GAJA 2IYNA 3TLCA 3LQ2A 5HE9A 2R8OA 2OWEA 2Z6QA 4WLOA 1Y9DA 2RAVA 1KO4A 1ETUA 3K09C 4PZUA 4GLJA 1Z0ZA 3P20A 4IVRA 4TYPA 3WSTA 1WZNA 2ZRDA 1JR3A 5FL7D 1TGYA 1UJNA 4EKYA 4QM7A 2C2BA 1QXSA 4XPIB 4HGQA 1PBTA 4U8VD 2W2TA 4CTNA 3NC4A 4KYUA 3L6BA 2XB4A 3V8VA 1TQ2A 3OH8A 5DBGA 4DRXE 5FYDA 4BFLA 1HG5A 3L7AA 4YXFA 1GTVA 4LTMA 3GHYA 2R8PA 5LUBA 3DONA 3UJCA 4B6RA 2XTZA 1AUOA 3LF1A 4EPYA 1LXCA 4JXKA 4Z5XA 2W4QA 3QQ5A 3H9UA 2C4WA 3EFEA 3QXCA 1G66A 3K0EA 4A2WA 1M2VB 3NOVA 2FW1A 3W78A 3A36A 4URYR 4G23A 4AIIA 1N0RA 1SHUX 2IHYA 3IBCA 4WBNA 2HEIA 3GV0A 2EIJE 1BMQA 2CJPA 5C51B 1BEUB 1DELA 3UCXA 1UC8A 1M1XB 4BY6A 1BDJA 2OP1A 5EINA 2AKYA 3HTXA 1BRTA 2BGLA 3NRJA 4LEUA 4JXTA 1LFDB 2MSCB 4FFBA 4DUYB 3I2YX 4GWLA 3L43A 2RC5A 2PRZA 4LXGA 1YUMA 5BORA 1QO9A 1U0GA 1JF8A 1NQWA 4WH0A 4X94A 1H2UA 5D0OD 2GXAA 1UBEA 4ZIRB 3H17A 4DPKA 2PU5A 4ENRA 4RD1A 1HZ4A 1Y3BE 2I3ZA 4Q18A 4C7MA 4L5IA 1Y34E 3C24A 4LNUA 2NWQA 1KFJB 4P4UA 4AJJA 5CB4A 1L4YA 4Q7JB 3RKSA 4DLSA 2G4VA 3PI6A 2NSZA 4LBWA 2ACVA 2JFFA 3GFFA 4EQZA 2XUFA 3WL3A 1G7RA 5JPDA 3BEDA 2IA5A 4YIHA 4LXTA 5GGYA 1WO8A 2LCIA 4QYSA 1NOJA 1KZGB 5G0VA 3PT9A 3SR3A 3GDWA 2AK3A 5LA6F 7MHTA 1U1FA 3UQ3A 4M1YA 1M6VB 1JH8A 1EDUA 1PYGA 1HZZA 5CB8A 2XIQA 1KNXA 4G5XA 3JQ0A 2ZDGA 2JGAA 4FGZA 1XZMA 1QB8A 2R2AA 5KYXA 3TNYA 3SJUA 1USVA 2C97A 5BMVA 5E9JA 2VRCA 3OAAD 1DQSA 5ESXA 5K0JA 4L7QA 4CKWB 1OJLA 2GFQA 2PKCA 3MLEA 4HDCA 4XAQA 3FU5A 4E22A 4G1TA 1BXGA 1LBHA 5I5EA 4FZ5A 3OG9A 3TMYA 4OU4A 3U7GA 1OF1A 4RVOA 3WQHA 2AFIA 1PS0A 4YACA 5KKAA 1TEXA 3H4VA 2XZPA 4Q05A 3VR5A 3HXTA 3IHKA 4ZA2A 1Z6GA 5KYUA 1VDZA 4G4SO 4H9GA 4KUEA 2QTAA 2GYYA 3KSAC 3ZXXA 2HPZA 3R5XA 3BH6A 1B00A 2Q3CA 3M5PA 4TVOA 1R6BX 1E6KA 2BFPA 2E37A 3A4LA 4IJ5A 4CM8A 1QP4A 3CPEA 3ENVA 3ELYA 5KEIA 2VF2A 5KNBA 3S0JA 1QB7A 1ZM7A 4PZYA 3PPVA 2YS6A 5CAEB 1LJUA 2P9JA 4JHRA 4YRAA 3SOPA 3TW4A 4D74A 2WXKA 1XDUA 4TTRA 3FSRA 3GAAA 2NZ2A 3Q41A 3I9KA 2BSXA 1V8ZA 2QLBA 1XZLA 1IKND 2AFHB 5BP7A 1DXHA 3WIEA 3SKVA 4NBWA 4H08A 3ZGZA 1FP4B 3CH5A 4UNPA 1TW2A 4UZSA 2YQZA 3AU4A 3CTMA 3FAZA 3ON5A 4HLCA 3UENA 1NBMA 1Z39A 2IYAA 2C8JA 3HFRA 1SAYA 4URXR 3QTBA 4NFLA 4RHFA 2DP4E 5LQDA 3KPYA 1CY6A 5BNTA 4DBLE 1CUUA 5BNWA 4I66A 3LO5A 1MT3A 1XCBA 1OOEA 1GLGA 1ZK0A 3TQSA 3ETHA 2YIVX 5ITVA 3UFXA 5TLSA 5DPMA 1YI0A 1KEZA 5BQPA 1YB6A 1JDTA 5CCLA 3D9LA 2V4HC 4J6IA 2VKTA 4EW6A 3KR1A 2XCRB 2R5WA 3GRYA 5ALYA 1YQXA 3PT5A 1QYWA 3KQLA 2ERXA 4LJ7A 5F3DA 1TT5A 2ZULA 1E9VA 2O7VA 2ZEJA 2FXIA 3CURA 2OCAA 2FDXA 3B8EA 2YQ8A 2Y1LE 2BTEA 3I01M 3CNQS 1EXWA 1T1JA 1XDDA 1QVWA 1KEUA 5ED4A 2Y1OA 4I6GA 3ICCA 1OY1A 3GRUA 4MWDA 1XZKA 4DYVA 2PBRA 5ICGA 3V4PB 4MAAA 3RIEA 2OV4A 3AW9A 4OHVA 4OUDB 2BJWA 3MWFA 3NBYC 2PZGA 4UHFA 4LQCA 4OYRA 2C0CA 4QVIA 2GEJA 1U6IA 1CUDA 1UN8A 2Z2YA 2GTIA 2BFBB 3FGZA 1EYHA 5DTJA 1ECFA 2GD6A 3L49A 3WRVA 1ZC3A 3ONEA 1RYFA 1UBGA 2DPGA 4U9UA 4ILEA 4PO1A 3VPXA 1PLKA 1FCHA 4V39A 4MQUA 1OXUA 5BV8A 1WWKA 1GZSA 3ZHEB 4HRYA 3P9QA 2VCYA 3B38A 3QKIA 1QGUA 4E6HA 1SUSA 3WJAA 1NHWA 3UGQA 1GA4A 4N5DA 4AFNA 1ZIXA 2Q1UA 4DM3A 3R0VA 5FKJA 1P2VA 4OQQA 5KBYA 3NV7A 5AUPB 2O8CB 1XZGA 2QD5A 2W00A 4UQYA 4LI3X 3MNFA 1UBFA 1H6CA 1P2GA 1VB3A 3PCRB 4ARBA 5C18A 1ZJ6A 3MJCA 4ARCA 4FP7A 4PANA 1YZFA 4MQEA 1RCFA 2IHUA 4JL0A 1PYDA 1YL6A 5JVDA 3G5TA 4TMFA 3ESQA 1KA9H 4L5CA 4ENSA 2JDIA 4CIVA 2V3VA 3CZMA 2O7RA 1FNMA 3I4RB 2PMDA 2PL3A 4O6VA 2XEXA 4BLOA 1E2IA 4HNQA 4EUFA 4IFIA 4CG1A 3QW4B 1WUHS 4FWBA 1R10A 3ZD6A 2CFRA 3VTKA 4R2MA 3LDZA 2DG2A 4V38A 3PDIA 4X8MA 4QFVA 1RC1A 4E5NA 1E3MA 1HQCA 5TSDA 5LXTA 5K09A 4UUMA 3NWBA 3G8CA 3W9FA 1M7GA 4F97A 2OPBA 3DOHA 2O2JA 4H6XA 3FKJA 4GHWA 3THWA 3CVWA 4UTOA 2DVWA 2AL7A 3K96A 4PIVA 3GVCA 4RACA 2AEFA 1U0RA 2GNPA 2H6FA 3WO1A 1NX9A 3A1FA 3CRMA 1Z45A 3VC2A 4M0FA 5FBQB 4PX2A 4F2HA 2I99A 3TAXA 4TMZA 1J4AA 3G9TA 3M89A 1Z2DA 5FI1B 2A92A 1OTXA 3E7XA 4LSWA 2X58A 3BK7A 1NVAA 4TN1A 2Q41A 5FWXA 2EQBA 1E3WB 1NOIA 4RFSB 2PY6A 4NQZA 4Q9NA 1YULA 1CY7A 2YIMA 5CYOA 1XEWX 3QB2A 3BMNB 4HQFA 3DF9A 3TB6A 2EWMA 1ZIYA 3VA7A 3PRYA 2RI6A 4DY6A 2ONZA 3RS9A 1G8PA 5A6CA 1K5HA 4ATNA 4BP9A 1ZM3A 4ND7A 1K0UA 4M98A 5A03A 2WJZB 2P9IG 3V00A 3ZN2A 4W9MC 4LOKA 1FYEA 2WIKA 1Q0SA 4IOJA 4KG7A 2OBNA 4LDPA 5KPDA 1SU7A 1Y6QA 2HCFA 1ZZGA 3WSVA 1LI5A 3WBFA 5JZSA 3PICA 1WMDA 4ISBA 1UJKA 3ZXPA 2PZFA 3A9RA 4YCLA 3WTCA 4QTYA 4ZTUB 1AH2A 1RI3A 4NG4A 5IS2A 1S64A 3SXJA 2DRIA 5CA0A 4GYYA 3CGWA 4MA5A 3WRYA 4UEKA 3ABLE 1Z4PX 1NW9B 1HLFA 2QTLA 4D8WA 5E6UB 4JODA 3C5EA 2PUTA 4N2QA 3KPVA 3GT3A 4CIXA 2OHXA 1USGA 4M8IA 3T5PA 3SZMA 1DCMA 4LG6A 4EUEA 1J2UA 1KOFA 3RYTC 1A9PA 4YFYA 4IV5A 2QPOA 2PYZA 3DAHA 4ABNA 4RCZA 3D6VA 1YQDA 1G5RA 4J7CA 5AM3A 3V8PA 4P4LA 2BW0A 2Q8QA 4OHYA 4ZCMA 1JSZA 1CQJA 4U8HA 5FWYA 5K4HA 2NU7B 1YVDA 5KJKA 4LOJA 4MP6A 1Q6ZA 3VO8A 3Q7TA 1ZMOA 3N28A 2DWPA 1RWOA 3RNLA 4XZ4A 2AXUA 3D3JA 2XNJA 1VSUA 1JXAA 4DSAA 2P8SA 4K6FA 3VAAA 3T8YA 5DV9A 3KSUA 3B1ZA 2ROQA 5H83A 3H1EA 4J0KA 4C0LA 1K8XB 2WAYA 4FFDA 3OE7D 1UMBB 2WXMA 4F1KA 3ZIDA 2G88A 1ZI8A 3HYSA 4R8SA 2P8JA 2XDWA 1KVRA 3NQ41 4D1YA 3K0SA 5HDBB 4QPCA 4TKZA 5B3SE 4IDAA 4NNJA 2IDZA 3CCBA 2QORA 5D85A 1RW4A 1QUEA 1MNAA 5B4UA 1X77A 3O8OA 3AGQA 2JARA 5SV2A 3QEMA 1ZNZA 4C43A 4K2HA 5JA4D 2HYDA 3PU6A 1JTFA 3CUUA 4ZDIA 4V0MA 2REOA 1FPMA 2J7PA 3HADA 3WFJA 2FW7A 2P69A 3EIUA 2FETA 2K2QB 2V54A 1RQ7A 5GJCA 1TOAA 1CULC 4MGIR 1AA9A 3DE1X 4MHSA 4ZP1A 3ZNGA 4EMSA 1ZGHA 5EP2A 2C84A 3V4OA 4D8UA 2GDJA 3MSCA 4LCJA 1Y5NA 1T36A 1BE8A 2Z3VA 3FWYA 3ELUA 3UK2A 3F0TA 4XSHA 5JDCA 5MDHA 3SNXA 2V8SE 2IITA 1OFTA 4UMFA 3OZFA 1BXRA 4JUAA 4I55F 1EI9A 5JAPA 4G0QA 1Q1GA 1UKCA 3HXMA 3S8EA 3O73A 3QUSA 4DE5A 1Q14A 2OBMA 2Y27A 3MXTA 4RJJA 3Q9NC 4KDEA 2A30A 1I1NA 2RGCA 4ZYLA 3NDJA 2VYQA 1RC8A 1Z5VA 1OI7A 3SQOA 1GSOA 1K86A 5SZKB 3TL2A 1MDFA 1UM9A 6REQA 1XB2A 1H4TA 2D8AA 2QA5A 1XNRB 2OQ2A 1ZH2A 4DI3A 3D3WB 5K0SA 5IAGA 3L4EA 3WNQA 1FK8A 3RQSA 3AI2A 3OPYB 5BYBA 4L9AA 3SQDA 3EZYA 2PLWA 3SYLA 4TXQA 13PKA 4LDZA 2GA8A 1Z6PA 1KK3A 4X7BA 3E3NA 3OU7A 4NQRA 3K71B 1N6LA 2HDWA 5U4XA 1X1QA 3JQGB 4CMHA 4MEJA 2Y1CA 5AOVA 5E1MA 5IKEA 4H18A 5KMGA 2GNAA 4QVKA 5D2MC 2FUG6 1BHJA 3MVEA 1CUJA 1I6WA 2H0AA 2Z09A 1VZ2A 1FTSA 4Z6KA 4PINA 4RA9A 4RV5A 4QGGA 4OH7A 3WKEA 1JXMA 3L6OO 3IAM1 1UP6A 3ETNA 5JAOA 2EGHA 2RIRA 2F9LA 4G1UC 4PQRA 4JSRA 2WWIA 4N3CA 4XDGA 1YZQA 4TZ0A 2FWMX 1JZSA 1OIXA 1QCZA 1ID8A 4Z0TA 2VWQA 3C3JA 3RC2A 1AOXA 4XEUA 2ZR8A 4CMIB 3QKRB 2UV8A 5IN5A 2C3PA 2ZSHA 3WL5A 4YRNA 1NW4A 3NNSA 1GL9B 3U40A 1BS9A 3HSSA 2HWYA 2ZCJA 4HAIA 3OEEA 4P5EA 3TGPA 4EF5A 4M1TA 1Z0DA 5KOHB 1WB4A 3OQIA 2QU8A 3DKRA 1T5OA 4GX1A 5BW4A 2O3TA 4DPMA 1CJCA 1CXZA 1YB4A 3L17A 4XLTA 5J2UA 1CUVA 3WOHA 1B6SA 3KEMA 1RAFA 3JATB 2QMQA 1PVVA 4EUNA 4RD2A 3WBKA 3E9EA 5B3JC 1VBKA 5HW0A 3RROA 2OAP1 4WNCA 2QLTA 3PC4A 2P3QA 4DCCA 2OEVA 5LUAA 4FUTA 3DD5A 4YJDA 2Y8EA 1PHRA 2DYKA 2NSHA 3TLJA 2PCJA 3X44A 2EZUA 3NM4A 4IY1A 3QEOA 1L7AA 5JU6A 2IIPA 1PWZA 4FN4A 3HIZA 2Q5IA 3SMVA 5KYYA 1Y9JA 4MV0A 4AKHA 1QFMA 4KXFB 1RJWA 5ALIA 1PC2A 5LCXA 4L2LA 5HIIA 1X1SA 3ET5A 4KAXA 2PO5A 4I9NA 2NPIA 2ZJ4A 4Q3EA 5FUWA 2JI6A 2ZJAA 4I1RA 5LP6B 4M9UA 4HNHA 4Y9TA 1PO7A 2I29A 2O8DA 2W2MA 4DVJA 2X9GA 3IR5A 1W93A 1HI9A 5CBKA 3EA4A 1E92A 2WZCA 3WLNA 3KDSE 5JXHA 3S2IA 1WW8A 2HMSA 4OQ4A 2CFIA 4EY8A 3U7RA 3OFJA 2FF5A 1AUPA 1KXJA 2HZ7A 3LUCA 4QWMA 4LHXA 1ZMRA 4ASUD 3HWX1 4PAWA 1Q77A 4PYOA 4WDQA 1J8QA 1L9XA 5SYAA 3IVGA 5BT8A 1KFEB 3VBCA 6NULA 3TBHA 4YGYA 2RCYA 3FVTA 3LM8A 1F9EA 2DH6A 1E99A 1SVKA 5I4KA 4TOIA 3HA2A 1PFVA 4XASA 1O03A 4HSEA 3CF4G 2CLFB 5LOZA 4KR0A 3LBYA 2EARA 5AARA 1SHKA 3K16A 3FR7A 1RAEA 1KDRA 1S0UA 3T3PB 2UKDA 1HNWB 5D66A 4PO3X 1NI4A 1ZIOA 2A67A 3IGFA 3K1ZA 2QYJA 4XWAA 4ZU3A 4YAKA 3QVLA 4OHBA 1P0MA 4AI6A 1UXIA 1KRHA 4FOPA 4MUGA 3ZOZA 4ALIA 4K81B 5BNIA 2PH3A 2NAPA 4YQZA 4YT5A 2H54A 1BGXT 5DLYA 3UWOA 4FMDB 5LZ2A 3D9OA 2OCYC 5ICSA 4WAFA 4BZQA 1NZNA 1PD0A 1K88A 2OSBA 3MJDA 1DDOA 3AMVA 4JDUA 3KR9A 3I37X 3VKHA 5L6MB 3Q3HA 4CPDA 1J2EA 1ULAA 3IP1A 4TLCA 5DTRA 1DIRA 2HHLA 3L04A 1V37A 4YP1A 1U2VG 4FA6A 4NBKA 3B78A 2V7QD 4B5KA 3OJLA 3VX4A 2XDAA 2JKYA 1FJXA 2CV0A 3R24A 4CUJA 1VHQA 2X0DA 3LPLA 3KJNA 4COKA 1WAO1 5EJ6A 2OCIA 1P8AA 4I8IA 1ORIA 3W2HA 3F7OA 3GZNB 1L2TA 1LKZA 5JAHA 3LDHA 4PAMA 4P4SB 4GKAA 3FTQA 4J1QA 1W9HA 1W36B 4C3VA 5ILOA 1A2QA 5DEOA 5KNLA 2EZTA 3DR5A 1V54E 3LP5A 2ZS7A 2DF8A 1CEQA 3RYIB 4MMXB 1FRNA 5IASA 5JS1A 3ZV4A 4KYTA 4MUYA 1YIOA 1JCQA 3URMA 4DCMA 1OB5A 1N1DA 2OFWA 4Z99A 3RAPR 2VZLA 3GLFA 1UBKS 5JIBA 2DQZA 1G7SA 4DDWA 1R6VA 3RYFA 3AEKA 1OVGA 2AZDA 2W7TA 3RSQA 3BH7A 3KJQA 1HFWA 1F1JA 3DXMG 3MGBA 4WLVA 3D7MA 5LQRA 4ZDKA 1TM7E 1A97A 4UBJA 1I6LA 3CEAA 2ZR9A 1P1IA 4X65B 4RHYA 4RTJA 4ZCIA 1FDSA 4UM9D 5B36A 2JANA 1QIHA 3CLTC 4F9EA 4O4JF 2C7QA 5FNZA 4TKUA 1LS6A 3HJTA 3GNTA 4RDHA 4AAYA 1BZYA 3N8DA 4URZR 1VHWA 5T8KA 5TPWA 2IYPA 3G88A 3QU4A 2BPOA 4LG1A 5J23A 2NT3A 2IE8A 2CL7X 5D7NA 3CF2A 3H3JA 1OB2A 2GZ3A 2I8AA 1DV2A 2FMFA 1JJFA 5AVJA 3AG1E 5K8VA 3THSA 4M9CA 4LFAB 2Q6IA 3L8DA 5AVWA 1EXNA 3HJCA 2IFUA 4L8YA 2HSJA 3WB1A 2AX3A 3PFWO 2W93A 4D9BA 3G0IA 3AVVA 1ULTA 1IQPA 3ZYLA 2JIDA 1BH6A 5I4BA 2WKSA 5C7YA 1YVEI 4TSFA 4PYNA 1ZITA 3ZHBA 2IY7A 4C6TB 5IBPA 5E3JA 5F78A 2AN5A 2J3LA 3NNNA 5BN4A 4INPA 3A8TA 4XM2A 5ERXA 4R3WA 2O2CA 4RG6A 1VL5A 1RFGE 1JXOA 4Z4FA 3M6XA 3EMDA 4Q3DA 4A1SA 3K9HA 3I6MA 3EOBI 2Z6VA 1KFCB 5KREA 2V9ZA 5EHXA 4NMMA 5LYJB 1J1IA 4HLNA 1A9YA 4DL9A 2HJWA 4PYLA 4Z7NB 2W2PA 3HO8A 1FRFS 1ISMA 1KY5A 4MULA 3D9NA 1S8NA 3JCZA 1W6UA 2XWQA 5IMSA 2PR2A 4BC0A 1Z34A 2QY6A 3I2FA 2ZIUB 3FPHA 3F8TA 1FT2A 2ZIEA 3HG7A 5K2MA 4JJKA 2PUDA 3J5PA 4PZCA 3MRTA 3BCUA 1NNEA 3NT2A 2YHBA 3NEAA 5JPCA 4JEIA 5LLSA 1CKEA 4U9HS 5AI5A 1TKCA 1ENOA 2PLFA 5ELXA 1FFEA 4HVBA 4S1WA 4HYEA 2CXOA 1OX6A 3NHBA 4K40A 4HBGA 3H9JA 5GONF 2XCSB 5EJ4A 3T7EA 3RASA 3SQWA 5AH0A 1NUTA 1V8PA 2WFAA 3VHRA 1W85A 2HNBA 4GI7A 3JQQA 4AKGA 5AJZA 3JQ8B 3ANTA 1DVRA 4CJXA 3LA8A 4D9IA 2WR8A 2YFKA 3B7BA 4C7KA 1EFPB 1ZA2A 1E20A 3JYHA 4MGEA 2WXOA 1SXQA 3FTSA 4UJ5A 4YAEA 2YYSA 3PHGA 4C01A 1JUQA 4FSXA 1H6AA 4AZ0B 1U2GA 3I2KA 1G21B 5TC4A 4EELA 2QEQA 3OOWA 1KU6A 4LHZA 1BSVA 3CO5A 2D2EA 2HF7A 1EFVA 3DMDA 1O94C 4R84A 1EB8A 4MDYA 3QLEA 3R6GA 3WZMA 2X0KA 4PVCA 5H02A 1D1TA 3D43A 4KQWA 1W2HA 1VC2A 4JVSB 2VBGA 5M7EA 5CX1B 4KV9A 2ZS8A 4YV0A 4G0PA 5AJXA 5EGSA 4Z0HO 3KJIA 3REFA 3INGA 4ZALA 1F0YA 1G6KA 4Q4DA 2WD7A 3HCOA 1IN4A 4LEIA 4R0VA 3I39X 2BEVA 3R23A 2E4UA 3FDZA 4IMJB 4ESHA 1GTZA 3JD2A 3TLYA 1FFBA 2PTGA 3T1YB 2Q9AA 5ES4B 1R37A 5JH7F 1DBQA 4JPSA 1A9ZA 2VA9A 3K0FB 3GMIA 2BKVA 5B7NA 3KU4A 3QZUA 3GDHA 3LQ4A 3ZLTA 2WSYB 3H9CA 2A78A 4DNPA 3UUGA 1Z74A 3ZZ1A 3QOXA 4XVUA 4W7HA 1QZTA 5HMMA 5KWEA 1RQXA 1YA6A 3A6KA 3TDMA 2JFQA 1U0BB 5CMWA 4Q3BA 2H31A 3R7WB 4PBSA 1Z12A 3RJ5A 2YWGA 2GR9A 1N34B 5IK2A 1AKQA 3FN4A 5CLIA 4ZO6A 3DYVA 4FSHA 4ZV9A 2J67A 3NHZA 1U1IA 3PF9A 1TTTA 3KOXA 3WI7A 3K9IA 3TOZA 1ESZA 3ABRB 1ZSYA 1WG8A 5E76A 2B5WA 3PUHA 4H7PA 3FYUA 4C88A 2VPIA 2VQSA 3AF1A 1U2RA 3QUAA 4PTLA 1TPYA 3QPAA 1EZZA 2RGBA 3DV0A 3LDFA 2QD1A 2EP8A 3HRAA 2I7CA 3VSCA 3CVQA 4HPWA 2COKA 4M8KA 2Y69E 4ARIA 3O94A 2O05A 3COSA 4C9BB 1FUYB 2XMDA 4MVJH 3VPHA 4K9NA 4KKVA 5FUVA 5ITZB 1P5HA 5I9IA 1GQFA 2QN9A 4C0KA 4DIDA 3MINB 2EYUA 1AKEA 3F90A 3WB0A 1D0VA 5DM60 1GADO 2WXLA 4PYMA 3K8OE 4PZDA 3K8QA 1MRSA 4FFMA 1T2EA 3LW7A 3WJ2A 1HE3A 4A9AA 1RZRA 1A72A 1OAOC 2BD0A 1BVYF 5CM9C 4YP9A 5DM1A 1SUAA 2PUBA 4FBGA 2W11A 4GKVA 2EW2A 4XR9A 1NBEA 4C2BA 2ZTSA 2LP4Y 3EHEA 1AQJA 3DFKA 2ZRGA 3MWGA 3OQJA 2ZUBA 1K06A 3LC2O 1MCZA 1GIAA 3DHNA 5IFKA 3NUGA 1Y89A 4EG7A 4IDBA 4L27A 5F52A 4TS3A 3ROKA 3EOAI 1H0KA 1NUSA 3RS7A 1TYCA 1D2RA 1TUBB 3JAKB 3ZZMA 4B7XA 4ZOLB 1ZK3A 1TTPB 3A06A 2BT4A 1NVMB 1NVVR 3R74A 1XTUA 2WUWE 2AR0A 5C2JB 2HJSA 1UP4A 5FZRA 4KOEC 1NASA 5DVZA 3OQ6A 4MI3A 3R3WA 4I4IA 4DT1B 3T9DA 2H1SA 3WWYA 2J9ZB 3KKQA 4RSGA 3FUDA 2GCOB 3R40A 2GPTA 1GRRA 4DADA 2A5EA 1HRKA 4PX3A 5EXSA 2P91A 3NORA 2Q5LA 4K05A 3C5CA 4WNIA 4LZOA 5I45A 2H8KA 3GU3A 2WD8A 1H65A 2FX2A 3EBPA 5IC5A 3K5WA 1JA9A 3AIIA 3DSRA 1OLXB 2CKDA 1A5EA 5KTKA 3SDZA 5HQTA 1ND5A 5ADUS 1OKKD 2PUGA 2PSHA 3H7AA 2FF7A 4ZDWA 3X1WA 3P2YA 3RTDA 3RAUA 1WMFA 4R0NA 2FKAA 3PDNA 1CEYA 2DE0X 4G9BA 2XDQA 3G5LA 3H2HA 2UY1B 3L5KA 4P4TA 4XJVA 1C0EA 4HCJA 3B3GA 1NRJB 3IEXA 2R4UA 1GY8A 3DEFA 2ZYUX 4IJQA 4XYMA 4DLAA 1D3AA 3DBVO 2OAEA 5IUNC 3S99A 3C39A 3QVSA 4F6LA 3IOMA 2PZMA 5TS2A 2FR8A 1Z5SC 1Y9EA 4ZHQB 4M7WA 3IMCA 4WZZA 4QELA 1KQNA 2E6KA 3T3OA 1IVNA 1OWPA 3ZYQA 4X84A 3I04A 2IV2X 5A5VA 5CJPA 4JKYA 4F4CA 4Y6SA 3R3SA 3PNPA 4O63O 4RTQA 2MYNA 4II3A 2DLCX 2NTVA 2FUNB 1O6CA 1TF5A 1EM8B 3ZHYA 1XK7A 3BHMA 1VYUA 2WZBA 4BE7B 1U8ZA 2ZYVX 3Q72A 3GPBA 1GT6A 1V5FA 3EVZA 5K5EA 3RC8A 2Z56A 2WNSA 3FTWA 4EAQA 4G1BA 2DSNA 3CHYA 3WK7A 3N8IA 2FEXA 3QVKA 2OAGA 1Z47A 4KX3A 2VBIA 3FZGA 3KUXA 4J8SA 3DOCA 3KYIB 4ZK6A 1XD2B 1GZ6A 1PZGA 2VP4A 5JO0A 3STYA 1X2EA 2EATA 4I1OA 3K9GA 2NUBA 2X6IA 2WU0A 4BL5A 1ONNA 1EBFA 3RK0A 2V7TA 2F1HA 4KW7A 2DIWA 1F7VA 2R86A 4BUJA 1KZOA 1E2BA 2GF2A 4XWWA 4QKQA 3MOSA 3MKQB 2AKEA 1LJLA 4OI0A 1E1DA 4JHKA 5CT9A 1EXMA 2I22A 3G7NA 3TSOA 2DR0A 5BR7A 2R17C 1SZDA 2PXHA 1T43A 5JBQA 5CNIA 3ABQB 3DBLB 3TM5A 1C9MA 1GHTA 1I2ZA 3RCBA 1DKNA 2X14A 3JW8A 3ANYB 1W48A 1SCBA 4AMZA 2GA9A 1TN8A 4RK5A 2WBLC 4XPZA 2C5HA 2Z9DA 2ZT8A 1VPDA 1CUSA 3EUWA 4LF5B 5HBRA 2D54A 4H7FA 1YTLA 1FFXA 4X44A 1FSZA 2SKEA 2AHOA 2H5IA 4QTXA 4I2NA 3EG9A 2A2ZA 3QNUA 1S3IA 2FZLA 2Y1DA 4MCAA 2GBIA 3EZ7A 2GBLA 3AY3A 2QVXX 3CKMA 2WIGA 3EGIA 4W5NA 3AHDA 2XE8A 1UFVA 3G1UA 1NXPA 1HEYA 2WUDA 5DRYA 2PWPA 4WWNA 2EJBA 1U4SA 3G8DA 3PQ5A 2W5UA 3WL8A 4QC2A 2FOIA 4PICA 3SM3A 1Q21A 3MUEA 4ZVKA 2HM8A 1HO3A 4B48A 4X54A 4ER5A 2GHQA 3HCEA 3OWXA 3V48A 3RAEC 2Y1FA 4QNRA 3SFTA 5AKEA 3Q3EA 4XI0A 1JE0A 2X6HA 4WGGA 4R9VA 3ZKAA 3KUKA 4RO0A 1I32A 4CKBA 3K9LA 4HH4A 3LC1O 3ZDAA 3JQAB 4HLLA 5AJHA 2BBSA 2LAIA 1IEQA 3OUZA 2QM8A 3WK4A 4L1KA 1PW5A 4YJ3F 2A3NA 3WTBA 5M04A 4CL8A 4QASA 4WNAB 1MTZA 4DV5B 4AM9A 3NR2A 2WYUA 3G82C 1UBNA 2A35A 3HKDB 1NVBA 5D3MB 4PZLA 1GA1A 3ZU2A 2N75A 2C78A 4ZVLA 4D8TA 3KD7A 2IZ7A 3H1PA 5K0EA 2HCRA 4FMPA 4AJLA 3RQIA 2W98A 2G63A 3KYCB 4TT8A 1COZA 3EA0A 4KQ9A 2Q3EA 4K6GA 3A04A 1CS0A 3I3OA 2LUOA 2WOJA 3MEQA 4GGOA 4HSGA 3H2IA 1L4EA 3HXOA 1Z4MA 3FSEA 4HNSA 1L0BA 5DXJA 2M6LA 5EESA 5EG5A 5JDIA 4PPNA 1VJ0A 5KWVA 1ZA1A 4N7JA 5JI3E 1D0SA 5K3AA 3L7DA 5CEDB 4CQMA 2ISCA 3JQBC 1OC4A 2VQ2A 1CUCA 2DUMA 3JRWA 1XBTA 4U0ZA 4F1PA 3HB7A 3PX3A 2CK3A 4QECA 1OR8A 2AJLI 1Y8MA 3ZC3A 1FU7A 1XV5A 4E5VA 1UINA 3TQCA 5F9MA 3GEBA 1M7BA 4GOXA 5JHBA 2WTBA 4W5QA 1KQPA 3ADDA 4GR9A 2PQRA 3OOYA 3U4QA 4O2BB 4ZO7A 1BKYA 2IF2A 3K0BA 4F38A 4UXHA 3BRWD 1T2UA 3IXEA 4HOUA 4HO1X 5B57C 1W1IA 4EM6A 1VJTA 2G9ZA 4XQGA 1JBKA 4F56A 3WNCA 4BEVA 2VJYA 4BX2A 2NSDA 3F4LA 3IPLA 3OT4A 1RRCA 2JJ1D 4JLVA 4XJXA 3OFVA 4RM3A 2Q49A 4JP8A 3EGOA 5C8YF 3SLGA 4F5WA 3RVOA 3OM8A 1F3LA 2ET6A 2Q6TA 4Z8YA 4D56A 2GAFA 3JR3A 4V0OA 2DFNA 2WOOA 3B1YA 3REOA 1M2HA 1TQ8A 2FWAA 2O7SA 2R65A 4OAQA 1D6JA 4OPMA 4KH0A 4E08A 3KFXA 4C2TA 1U4OA 2AZTA 1HZZC 1ZB1A 2PKRA 2LXMA 1JCSA 2R4QA 3O4IA 5SZIA 1S8OA 4L72A 2OGWA 3PLAE 2Q8PA 2HSEA 2YR0A 3ML8A 1M1NB 2I2AA 2I34A 3IMFA 3NHWA 2ZPTX 2WJ6A 5JFTA 4S35A 4N39A 2VNKA 2QOEA 4MMYB 2ZRLA 1W4RA 3RFTA 4O1OA 3LF2A 5I9TA 2YVUA 4CQNA 1QPGA 3QVOA 4QU5A 4D0SA 1H9AA 2W43A 5IJAA 1D2HA 2XYRA 5EKSA 4MARA 4UHBA 1L7QA 1SUCA 5C2YA 3Q6MA 1TO6A 3AXTA 4ZRMA 4F4UA 5CXUA 3KKOA 4GVLA 1FSPA 3OMXA 4QFCA 1SCAA 2BFOA 3GJYA 1PL8A 3BTOA 4AY3A 1HY3A 4E7OA 1JIJA 3ND7A 1MRZA 4IV0A 2C4UA 2FCRA 1VLZA 5CCXA 3DWGA 4HNRA 3EGVA 3H2ZA 4KTVE 2X8WA 2C8LA 3KFVA 3COZA 1IBSA 3ORYA 3AEQA 1TT7A 5B3AA 2LNIA 1NVDA 1OHHD 3H1BA 1G2IA 1YQTA 3KEAA 3UT6A 4GYKA 1GPDG 4L75A 1EBUA 2WABA 3ZQJA 1PFKA 3FMFA 1SBQA 2GPBA 3RREA 4C03A 2AYYA 1KMIY 3NIGB 3FOEC 3Q15A 1O97C 4Z3OA 4UU0A 2GLUA 2J45A 5J4YA 3AM5A 1K6XA 1MVLA 5DNAA 4ECEA 1ENYA 3TTUA 2I9KA 3KSMA 4C4RA 4X3OA 2AK2A 3BK1A 4IRMA 2YYAA 2OM6A 1TZ2A 2PUEA 3FLAA 5A05A 5JCOA 5T6MA 1Y6FA 3LVQE 1ZD8A 5IDQA 2VYNA 2HLPA 3BA6A 4KE6A 1QE0A 4JZYA 4HDSB 2SCUB 2WSMA 1DJQA 3LKZA 2VRBA 2RFMA 2P2GA 3SIPA 1N9GA 1CP2A 4JJEA 4I50B 4BN0A 1OV4A 2BFMA 1EJ6A 5G05J 1JVBA 5F76A 4JYCA 1M2WA 3CX6A 3K9NA 1XPRA 5FHQA 5HZHA 4G5QA 1QDEA 4TL7A 3SHQA 1K4YA 3GJ8A 5KBAA 2Q28A 5I6DA 5B4TA 1SO8A 2UXDB 3HVKA 2VGYA 4FT4A 1Z25A 4G0WA 4X7MA 4OSEA 1T8YA 3PR1A 1MB4A 4LJ6A 1WPXA 3MMSA 2JJ2D 3T94A 4JCOA 3I1IA 3VISA 1XZ8A 1WP9A 3PJRA 1RVV1 1SCDA 2WICA 3ROZA 2A4MA 1K97A 4L3OA 2JFXA 2Y1WA 5KVQA 2R2GA 3EEBA 1Y33E 2HEGA 2R1VA 5AK0A 1N5DA 4B8ZA 2REQA 1DTWA 2ZJ5A 7ADHA 3OHPA 3SEQA 5HWSA 3B5IA 4HQ6A 1Q7CA 3FIJA 4AXBA 2IIBA 2VT3A 3W5JA 4LZLA 2EAUA 3W79A 3I4CA 2FV8A 3AVUA 5LZ5A 4R9RA 3VR5H 3V8QA 3UHFA 1SBCA 3H2BA 3RVLA 2WUEA 4BVAA 3IRUA 3V5NA 1AS3A 2FPLA 4BTAA 2X1MA 5C1DA 2FO1E 3V8RA 3HN6A 3K2IA 5FNVA 3IOYA 5CA1F 1QQBA 2NPFA 5KNBH 3EXG1 3TWWA 3PZBA 3BH0A 2ZU6B 5DCWA 4Y6PA 2I91A 3U4IA 3EUAA 3HO6A 5D3QA 1IN5A 1JSCA 4G3XA 1YHYA 4WZ6A 2VUIB 1M66A 4MW1A 1CQWA 4XYBA 4UPVA 3K6SB 2YXDA 4Q7EA 3QXSA 3IJ5A 3OF5A 4EG8A 4WCFB 1Q5PA 4L16A 4ZYYA 4L8LA 3RAJA 1TRKA 1L5SA 1SVUA 2XBMA 2B7BA 3EQ6A 5HGJA 4KZKA 1Z17A 4L4YA 2PSEA 4A0RA 2O2EA 3V4LA 1YDFA 1E0SA 3ZDFA 1DWOA 1A1VA 2Q9BA 2VBFA 4BQRA 4JXXA 4CGZA 3FIUA 3L6RA 4TXPA 4LRQA 1CS4C 1B14A 2HQSA 3O4ZA 2NU9B 1AKMA 5DWVA 4FD3A 4GM0A 2X3FA 4QXAA 1SH7A 4LRUA 5JFGA 5EXXA 3AG6A 4DLTA 2O8BA 4CLRA 5EWMB 2PUWA 2IGBA 1SA0B 1KAMA 2I1QA 4KV7A 4XE0A 1FVHA 3L4KA 3UW3A 1SC6A 4KXLA 4AZ3B 4IGIA 5JECA 3HACA 4Z4IA 3B1FA 3NGLA 1E4YA 4IO0A 2Q4RA 2C4TA 1X1EA 1U8UA 1I7NA 3IDQA 4GMDA 2OXTA 3OE4A 1ONBA 1TD1A 4RJ2A 2VDVE 2GGSA 4QDUA 4BB0A 2XB9A 1HBJA 3AU9A 1ARZA 1SRRA 5IKXA 1GD1O 1YB5A 2J3MA 1XGWA 1P5ZB 1I2AA 1M9NA 5E2IA 2C3OA 1G3QA 2HL6A 4M3OA 3O4HA 3L7YA 3G9QA 1HA3A 1WY7A 4Y67A 4FT2A 2XA2A 3NBXX 2BZ1A 3VDMA 1ADCA 2QZPA 3AEUA 1EP3B 2FSVA 5K45A 4X8QA 1DX9A 1XJ5A 2AXVA 2QRHA 1IM8A 1A8UA 1E79A 1MOPA 4KLAA 3ZS8A 1KPSB 3V3KA 2R6AA 4FKZA 1UAGA 2PKQP 4OBEA 1WCXA 3VYSB 1WU7A 4KBQA 2BFEB 4YDOA 3EZNA 2EP5A 4Q34A 2HRQA 4URUR 3ZHCA 5GADl 3EU5A 1FTYA 1P81A 4E07A 1WHTB 4HDKB 3VU0A 3ZGOA 2XNDD 3DUFB 3G2WA 3B48A 1WF3A 1W47A 1SXJD 3LNCA 1Q17A 2PFGA 4UTRA 3WRYC 3M9XA 1U98A 3DG9A 3PF8A 3P9YA 1BO6A 2FK7A 4GC5A 4QT4A 2ESRA 3ZD7A 3O48A 5EJAA 3CM0A 2VPXA 4FJ0A 2JAOA 1MB2A 4X20A 3EE6A 2GSDA 3H4MA 5I01A 1OYWA 4MQFA 4GDFA 1QF9A 2NO1A 2CL5A 3WGZA 5ARCA 2RHCA 2IQIA 1ZH6A 4EHBA 4N12A 2XMZA 1YFZA 4NAUA 1V3VA 3PXGA 4J1TC 4F86A 4PNEA 2BCGY 1L3IA 4RM2A 2RAUA 4IXMA 1H1LA 4JLNA 1P2DA 2QF7A 1W0KD 2H4YA 3F67A 1N0IA 4Q24A 2AI1A 4IN3B 1KPHA 4FC8A 1C14A 3K20A 2HPVA 1YCGA 3HVEA 4FJ2A 4YWHA 3KS2A 4HDMB 2H9YA 3TXNA 3BXFA 4R68A 4DUZB 1M2NA 3DVSX 4TQ9A 2I4LA 4EPXA 2GQ0A 5GM1A 4ND8A 1HYEA 2WHRA 3TEJA 1V7PC 5FYQA 4MW9A 4D9GA 1ODSA 1E94E 3PXDA 1RJ9A 5TY0A 4G67A 1E2NA 3IR6A 2LE0A 3EULA 3SNKA 2B5VA 4BASA 1GGNA 1L5OA 4GVPA 4IEIA 3QI2A 1FCJA 2BUGA 5I7AA 3R0JA 4KHZA 3HLKA 4E0BA 3KDAA 3Q75A 3QITA 5FPKA 2FMIA 4RD3A 1U0TA 3H84A 1KVTA 1CY0A 1JEJA 3TEMA 1WSWA 3N2GA 1HWYA 2QLFA 2ZRQA 2CCJA 4P3PA 2I78A 1MA3A 3OZGA 2MSKA 4MR7A 1VFNA 4DLKA 1Z56C 1VGQA 1XJQA 5HF9A 2DWZA 2LZ0A 1OW3B 4Q48A 1KRWA 3CLKA 3D4PA 1NJSA 5REQA 4AJ9A 1CUIA 4Q9LA 5L95A 4KGDA 4BV8A 1JI0A 1IZ7A 1KBOA 2XS1A 3UIEA 1NMQA 4EGSA 4K2AA 2F9MA 2G76A 5BRJA 2ZT7A 4IAOA 1VFPA 1ZICA 2G25A 3P0JA 1LD8A 2G40A 2WXIA 3I76A 1M6EX 2ZXEA 4REOA 3NOOA 1OZFA 1E3QA 2P9UG 2C57A 4LWOA 4MEAA 3HR8A 4YTEA 2AS0A 1NBAA 4D3YA 5GJBA 1A9XB 4G0MA 5BSHA 1C4OA 1PIWA 1OLSA 4BLVA 3QX7A 4B74A 1I7PA 4JP3A 1EP1B 3IALA 1UC9A 2GBFA 3MS2A 4RK0A 4FINA 3EVBA 1AUQA 4QYIA 2FN9A 1L4HA 4AXHA 3EXEA 4CU5A 8GPBA 3PWSA 4NZMA 1EWTA 1XTBA 3URZA 1GPLA 3PX2A 1LH0A 4NK4A 3CRZA 4QDXA 5EKTA 2ZJ6A 3AP1A 1NDHA 1AHNA 4GRDA 1OXXK 4EYEA 4KN8A 3AH8A 2N9UA 3REQA 4WSOA 2LNDA 5KZMB 4DX2A 4DAEA 2QX7A 5B2EA 2VH1A 5LFAA 5JSHA 4Q3LA 4TMWA 2WM9A 3U9WA 1A27A 1N8NA 3H18A 3J81A 1UOEA 3SHOA 1MH9A 3MG9A 4LPKA 4F2GA 2QTMA 3TUIC 3OTOB 3TF5A 3NRBA 4UUPA 1I13A 1J24A 5G0UA 4AWAA 2GZHA 2QROA 3I9FA 2Y4UA 4CHGA 5E38A 3IERA 2Z2JA 1RXSA 1PDVA 4J07A 3ZCQA 4G41A 1RCTE 4KBYA 3W5AA 2C20A 1YGYA 4MPPA 2I62A 2V4ZA 2H7VA 5FQ4A 2F37A 5K4GA 4XIFA 1PS9A 4GZ6A 1NVFA 4DPLA 2XEVA 3LEWA 5IJ0B 3T7DA 4E2FA 3ZQ6A 2EKQA 4RZQA 1FJHA 3AESA 2R8YA 2VNHA 3EVTA 2JI7A 4AJOA 1EX1A 3OT1A 4KIJA 4BQIA 3RFFA 2DT5A 5J2TB 2QL9A 1N1MA 3PFHA 4HNTA 3S2SA 2PX5A 5GOTA 1Z28A 4WOBA 3NAZA 3FCYA 3WLJA 4IRUB 3V7YA 2QUJA 5CP8A 4ENWA 2UYOA 1QHHB 1GXSA 3C3XA 5EE1A 1G3NB 3EPPA 2QZ4A 3Q9UC 1R0YA 2NZWA 4FLMA 4TN5A 4KLCA 3E81A 3FBTA 3FWHA 3RRZA 3P96A 4B3FX 2MSEB 4I2VA 4V3CA 5CFQA 3BWVA 3DXXA 1UBLS 4OX9B 4LXHA 1RQGA 3SQMA 4ZKDA 2PKQO 1KO7A 3PVLA 721PA 3HK2A 3NAMA 4EYQA 3EWAA 2Y93A 3P2MA 2VXYA 4JP1A 2HLDD 3KXPA 2PGIA 4XEIG 3GGPA 4D97A 1DBVO 3SYTA 1Z08A 1N1EA 2O2YA 3PDWA 4MCHA 4FM9A 2ZIRA 4A4DA 1C3OA 3MPOA 4MI1A 2AG1A 3NV9A 2J4FA 2GASA 5BSMA 2E87A 4XARA 2GZ1A 1HFJA 3E34A 2XDYA 2IEDA 3OU2A 4M99A 5KCMA 1YB1A 3QSGA 5HDQA 4DEVA 4YQFA 4KBGA 1YH3A 1GGFA 2W71A 5B3KA 5IULC 2BF4A 1W29A 5DB4A 4X3CA 5AVXA 4QOHA 4MRMB 4AZVA 5DSTA 3WYBA 2ZISA 3ESDA 1JQ3A 3FB1A 4JI1B 2HA0A 3S2YA 2OHJA 1RT9A 4WN3A 3D9HA 3HHEA 5G53C 3OZAA 3T9KA 2OMKA 1W49A 5KC9A 3ZE8A 4ZU6X 4KO2S 1H66A 3AETA 3NT4A 2W83A 4J43A 1SG6A 4QLOA 3A3KA 2A0UA 4RA6B 3GQBA 3TRKA 1YS7A 3GPIA 4RVHA 4AO7A 4B9AA 5B1YA 4PS0A 3RODA 2C95A 3LY9A 4X1KA 4AOFA 3EQ8A 2FZWA 1XTZA 4UCXA 1C4WA 3S3TA 4PNZA 4YRCA 1I3LA 1L5HA 1JEEA 1O2DA 4A3SA 3KWMA 4EBAG 3W8FA 1P9OA 1ISJA 1CD5A 3UCFA 5DDIP 5HKLA 4S2EA 4AF6A 2YZGA 4OIFA 1OA1A 1K3ZD 3BWCA 1C7EA 4YRFA 1U9YA 3PXBA 4UFNA 4Q5IA 1BFUA 3AL3A 4L73A 1KZ6A 7GPBA 2REXB 1O96A 3X2EA 1H3EA 2QDXA 1QHYA 1R5JA 3N2KA 4R8MA 4FQ8A 4D9JA 5KO2A 1IBRA 3M1YA 3WLLA 1HXIA 2EHDA 1HO8A 4QDJA 5LCWC 3A25A 3AP2A 3V34A 2Y1XA 1CVLA 3VR3A 2J3DA 4B71A 1SHLA 1Z35A 1Q1ZA 4IGKA 4UUBA 4UXIA 1GRQA 4QREA 3PRJA 2Z9BA 5C32A 5TMPA 2FTKE 1JEYA 3KOOA 4LCBA 2QDKA 2HO5A 2YN2A 3G6WA 1EXVA 4TV3A 4ND3A 2C96A 1AURA 4JT2A 2XSZA 1HNXB 2PJUA 4JUFA 5FL3A 3ZDCA 2FEPA 5ALXA 4NJMB 3ZUGA 1Z7GA 1MJHA 1OTYA 4ZOCA 4Q00A 1DJNA 1KZHA 5EYPB 3BG1B 3B1JA 4I6JA 3PXAA 3FMOB 4WK4B 2H1OA 5JNLA 3R41A 4MYRA 1CUHA 5HKKA 4LY3A 4BNDB 3BXPA 3DJFA 4YRLA 3ZXYA 3P1JA 1N2XA 4LX8A 1QTIA 4YRSA 1LPPA 4C0XA 2AFHE 3IQWA 3E8MA 2Q4TA 2WXFA 3IHVA 4MS3B 3GRFA 1IHUA 1YR7A 4E5SA 2DEUA 3AI1A 5CB0A 3KYDA 2H63A 2XB2A 1TIPA 1SKMA 6AT1A 2FPMA 4R8VA 4L6AA 2JAXA 1T8SA 3U48A 2OV2A 5FOQA 4FHZA 3UINC 2IS2A 2FQXA 5A06A 3SLRA 2FLKA 1LV8A 2IHZA 1R0ZA 5BWLA 3ENKA 3V9AA 5K3SA 1EHCA 2HK6A 5AW7A 5KDOA 3LGAA 2WTEA 1BWSA 2VCHA 3ONKA 2IYXA 2R6CA 2QN1A 4DMLA 2DSTA 4FDLA 1Q95A 3AR9A 4NG5A 4DR3B 3ZDRA 2CUZA 4UNIA 3CLUC 4ZO9A 3NU1A 2RKWA 4KPUB 1PQ4A 3PQCA 2VGEA 5BSRA 5T7BA 3HUEA 3MJTA 4Y1RB 3A2MA 2DLDA 4I5FA 2UZIR 1US8B 4HV4A 3RRNA 5FTWA 4E1VA 5C37A 2C5LA 4DX1A 1Z8FA 4N0EA 3MA0A 4NU5A 4F6CA 3IUEA 1R0WA 4ANWA 3G0HA 3RT9A 3UH0A 1OGYA 3GOQA 1QP7A 4HMQA 1RYDA 2W2KA 1X1CA 4L0CA 4O4HB 2QD2A 1CUGA 3DMNA 2IH5A 4KT6B 3D3NA 2DTDA 1WVIA 3IQZA 5HM6A 3FI0A 3ETJA 4WY8A 4A5SA 1J0EA 3A4IA 5ECDA 4JELA 2WFLA 1B73A 2IC5A 3RI3A 4I6EA 3LT4A 3MTAA 4HJRA 5EIBC 3BORA 1JQLB 4B6EA 2DFPA 2CN1A 4YAUA 5HHTA 3EYAA 4IS2A 1R12A 1PZEA 4H1VA 3ZKJA 3FUHA 5FAKA 1KK1A 4M87A 1ZUNB 2VDMB 4WWOA 5GZ3A 4NPCA 3NXKA 2HI0A 3SR0A 2X0RA 2WVGA 1JAHA 4GOJA 3DV2A 1DNPA 3IV9A 3VKWA 1LFAA 2IOFK 3R3UA 1YRQA 4IXWA 2WIJA 4XWKA 1GZDA 4R0MA 3UHJA 5CDFE 4CG0A 1SOUA 3I5XA 3LUKA 2ECPA 5DN6D 5FR2A 3N39C 3EPLA 3ETGA 3N58A 1LTXA 1ZUHA 1V47A 2R00C 5EE5B 2EILE 3OJEA 2OY0A 4MYCA 2C2HA 1Q7GA 3RC9A 4TYYA 3NOCD 2ZI7A 3G7SA 1AS0A 3HKBA 5AQAA 1U2GC 1Z22A 3UTDA 2CE2X 4E4RA 3IBGA 1M8PA 3N87A 2JGNA 2ZWIA 4PWYA 1VMKA 2I2DA 2EQXA 3UMCA 4URVR 1E2JA 2X23A 3DPUA 3T1TA 1JAIA 3ABOB 1QIIA 2DFKB 4I5DA 4ZGGA 1DIOB 4Z49A 4G5FA 5DGCA 1Z18A 3SC2A 5KJMA 3RS5A 1QOQB 2WF9A 4ZJZA 2OHVA 2EZ4A 1D5WA 4UHEA 1ZIPA 4BQNA 3GRAA 3R5FA 1JBQA 4I7EA 4J0FA 3OZCA 5CT6A 2D2XA 5FOVA 2GXQA 4DKXA 3OWOA 5EP1A 4HFNA 3V1LA 2XMRA 1IVYA 3T5CA 1PS8A 5I9MA 2JD2A 4NXMB 3TQRA 4Y6QA 2WM2A 1ZU2A 3F98A 2OUKA 4BNFA 1QRSA 1UXGA 4HPXB 1W19A 3LKUA 4M53A 3GP3A 3WL7A 1N2SA 2JATA 1E1RD 2FPUA 4QJ5A 1DO2A 3T5VA 3GBPA 1P7ZA 5JCPA 3KJEA 1FSFA 1T3LA 2OYRA 3ZCPA 1ZONA 1MC4A 4NU0A 1INLA 2P2SA 2VQ3A 1NZJA 4O4IA 3GZ4A 4DLVA 3R09A 2M63A 2EFEB 2WRZA 2IY8A 4U3JA 4Z54A 2YWBA 2OGTA 4YAGA 3KT8A 1KO5A 1RYNA 1TYEB 4QO8A 5JO9A 1WZCA 5CCMA 4H3SA 3UAYA 3CYFA 2P9TA 3DE5X 3F5SA 1O6GA 3O92A 1CEXA 3NDIA 3B60A 1XXLA 3PYMA 2W2QA 2VF5X 1ZD4A 2Q3MA 1BX0A 2PX6A 1QCYA 4DQVA 2BFCB 4ETWA 3UGJA 3E70C 2O5VA 2H0RA 3RABA 1A4UA 4UWHA 2Y2VA 1J9ZA 4FIZA 1RIIA 3UKDA 4IXDA 1T0PA 1WJGA 3KXIA 4XA8A 2WVHA 1AVTA 4ACBA 2LD4A 1HR0B 3HCNA 4AKIA 1NIJA 2O5CA 4YAJA 4OKIA 4A6XA 2JD0A 3MLAA 1N92A 1PN3A 3LLCA 2QI9F 5BUSA 3UF0A 3FJYA 3TVTA 3KJZA 3BN3A 4N47A 3CZ4A 3HBFA 2Q0QA 4F4DA 1V26A 4XIYA 2VJBA 2H0QA 2ICAA 4ZCLA 3MWLA 4HB3A 4QEKA 1NUQA 2LGJA 3MCAA 4G65A 1ZBPA 4XSVA 2XPYA 5EPEA 2MHCA 2F1JA 3KAQA 1VPEA 2OEWA 4S2UA 5CXSA 3FHTA 3L02A 3GLKA 3MTGA 2R6ZA 1D2MA 4C89A 2BZGA 5KYTA 5A6VA 3MJVA 5JS8A 1Y8ZA 6ABPA 3CJRA 4BE9A 4G25A 4A10A 2ARKA 4W1SA 3H5NA 4H77A 1DZIA 1EX9A 4MAMA 2VF8A 4WASA 4EZLA 2SKCA 1SZJG 3LX4A 3A3PA 4F53A 3BCSA 4BVEA 4J4TA 2XUGA 2F9FA 3HVRA 5IABA 3DEAA 1LSOA 3OJCA 5D00A 5KHOC 4B6SA 4OQMA 2M1XA 2P2CA 1EEHA 2I2XB 2JLRA 3F5FA 2EIKE 2SECE 5BWBA 4E85A 1CIPA 1WBDA 2HE0A 1QQTA 2HPAA 2IZ1A 2PD3A 4W8GA 3MPUA 1QO0D 2HDOA 3LT2A 4KXMA 4YJKA 2UYYA 4C4AA 1TYQG 4GTVA 2PZJA 1EK5A 4TTPA 4EJ2A 4JA7A 1FNCA 3F6BX 4M21A 1CVRA 4IPTA 3MFYA 1JPJA 2JGDA 4L3WA 4OL0A 3C3RA 3LQQA 1GGEA 3QKSB 3L1IA 5CCBA 1D2GA 5F9HA 1OX4B 3QBEA 5FX2A 3L01A 2YV3A 4PZZA 3JRNA 4FC7A 3HB0A 3E4DA 3HA7A 3C72A 4FMCF 3UMRA 2BKKB 4GPBA 3FCEA 3EY4A 5L4LA 5LQJA 1KI6A 1R8JA 2B6HA 4MSUA 4NV3A 3LGXA 1TKRA 3KV1A 1ZAKA 1MENA 1BMTA 4F3TA 3GAMA 1GQRA 3IV7A 2UAGA 4GICA 3QWBA 1FDRA 3P4YA 5IARA 5ETJA 4BDSA 3QK7A 4ZQCB 3RYHB 4RY2A 4ALNA 3ML9A 3TOCA 4Y2UA 4AW9A 1STOA 3GEDA 3KBOA 2PD4A 3V1KA 2BGKA 2CNWA 5ENPD 4OJTA 1JLHA 1G8HA 2GNOA 1ODIA 4KE7A 5JMOA 4Y98A 1PVOA 3MTBA 3M70A 9LDTA 5HP4A 2EG9A 5F73A 3DMGA 1X94A 4OHRA 1NTRA 4GRAA 5ILGA 2O23A 4CMCA 1XALA 5LD2B 2E4YA 4LOHA 3GLGB 3CVVA 2ZBGA 1AXRA 2YINA 3WQBA 3CY6A 4UJ3A 3KD2A 3M2PA 1KETA 1AGRA 1YJBA 5MGNA 4LHYA 4HAXA 4UREA 1N6KA 1I4WA 1J56A 3RHSA 4R9SA 3C6KA 4F60A 3GGOA 5FUXA 3R5KA 2IT1A 3IIIA 1Z9BA 2ECOA 3NTXA 5JAZA 1XQ6A 1BA2A 3JQ1A 1E66A 1TL7C 3HA3A 2P9EA 2WJPA 3TWOA 1EWRA 3P5SA 3DVAA 1EWVA 3DO6A 1AK9A 4L02A 1OXKB 1I51A 4QBHA 2NSJA 4DDKA 2JBAA 2LXLA 5F7XA 3C0KA 1WZ2A 2C59A 3CUVA 5TIIA 2DETA 3NHLA 4AM8A 1S9HA 4C4TA 1UBHS 4HF7A 4CZ2D 5CT8A 2P75A 1J1UA 4I3GA 1YU6A 4E3ZA 4UHCA 4CQLB 1G2OA 4OHUA 3NWOA 4CBVA 4KQEA 5AYVA 4FYWA 3EIFA 1LQ2A 1XPUA 4Q9AA 3ADCA 2R11A 4G2VA 1PJLA 2X76A 3D81A 2BF7A 3SS8A 4WRRA 4N0DA 5JISA 4YYEA 2X1HA 1O1SA 2C4NA 3H2KA 1L5FA 4EMTA 2A1UA 2XTAA 1TJFA 4IINA 5DN9A 2GOYA 3CW8X 5L51A 2X6KA 4WWHA 1F5SA 4DPRA 4C4OA 5C8DA 1PJSA 4FTWA 1FE8A 1ISGA 1X1BA 5KJCA 4FHKA 1K08A 3SXPA 4D9HA 2B35A 1G2QA 2WIBA 4WFQA 1WUTA 1P4SA 1A0OA 3OQOA 1L8QA 3FTZA 4PX5A 4IS3A 3BCRA 1RBQA 1D9SA 3LUFA 4KO4S 1TJPB 3UXEA 2D0DA 3QTTA 1G5FA 4IDDA 3DPYA 2PAFA 3MKRA 4W5OA 4YH1A 4DJDC 3VJKA 2XX3A 4JI7B 3UEOA 2GTPA 1UBSB 3OZSA 1HTBA 1LX6A 4C0BA 3FYDA 3MJWA 3ZJUA 2UZAA 3OFNA 1W96A 3DTVD 7REQA 4KEAA 5BV0A 3WNDA 4JNKA 4Z1MA 1M67A 1Z4OA 4MUJA 3PNLB 2ZRJA 3VM6A 3MAGA 1GL7A 1Y81A 4E5DA 2OZKA 1QWOA 2GF0A 4A8JA 2QNBA 1M76A 4YAOA 2GBLC 1VYHA 1FXWA 3PV0A 1ZHFA 4EKGA 2VSOE 2E5FA 3QHQA 5C52B 4ZRDA 3AM1A 4KRFA 3IE1A 3M4YA 1ZRHA 2VDPB 2N46A 2XUZA 1FJGB 1SVMA 5ISMA 2VDOB 5G0TA 2RJ3A 3HP4A 2BFFA 5KX5B 3QPUA 3IPCA 4KPFC 4JN6B 1EUDA 2BH2A 1OLOA 4KBFA 4TLEA 3Q5DA 2C7PA 3LZCA 4EWLA 2JH9A 3BL5A 4P2GA 3BG0B 1XHEA 2ON6A 1E9SA 2BSQA 2DUJA 1KI7A 2WTNA 3BHNA 2H4XA 4L9SA 4RULA 2H3HA 4PX9A 4I9FA 2BKXA 1NOKA 1YDMA 1YR2A 3TJRA 5KHAA 3ERCA 2H29A 3NETA 4R6WA 5A7FA 3HYNA 1QAQA 2QHXA 2P6NA 4D8YA 5CIYA 1G4AE 3NHAA 2WJVA 4AIFA 4AKTA 2HW8A 1I6KA 1CF2O 5AJVB 4HKTA 1U8TA 3QQPA 3W3ZB 3AYZB 1ZH4A 1NN5A 4KN9S 4KI0A 2X2FA 2PWZA 5AP9A 3N86A 1Z2PX 4JMLA 1G4HA 4NJOA 3IO3A 2FPGA 1ZOIA 5T5QA 2JFGA 5E3IA 1N2ZA 2B0OE 5E2BA 2ID9A 5TR9A 5KTSA 2AVNA 1D07A 1TX4B 4GMJA 3JASB 5B2ZA 4W1QA 1H8HD 5GZ1A 3QELA 4PRKA 3Q0IA 1SKQA 5HILA 1C0KA 2B92A 2W6IA 1T10A 3RSLA 1H0RA 3PNQA 4ZD6A 1HYBA 2O8FB 5AI9A 3NWEA 4QEDA 1T4DA 4FBMA 1U2TA 3NBMA 3I62A 2X8BA 4X97A 2XGGA 5A9SA 1X2BA 5ELMA 5CDSA 1J8YF 1EAYA 1XAIA 1UT5A 3AERA 1PF7E 1HE1C 3COWA 1U3CA 3PGA1 3ANLA 1T5LA 4ITVA 2PRKA 1U3DA 5B1EA 2ZRMA 3N70A 4BO9A 2HXYA 4ZAVA 1I24A 4QYXA 1RWNA 3SJAA 4X91A 4KREA 5G3YA 1S2DA 3PA8A 2E89A 5KQSA 1J21A 3PEUA 5IKOA 1T5TA 1VE5A 5LOVA 2BAGA 1NN0A 4MOWA 4W8HA 3N5KA 4E94A 4KQGA 1MFPA 4YI5A 4EMUA 4MKZA 1QK4A 1SVLA 2TMDA 4NMWA 5AVRA 1JG7A 1V35A 4WA8A 1BKDR 3AZQA 4I4CA 1Z6QA 3FXAA 1A8SA 1SK8A 1YS6A 3ACDA 3SSNA 2HQOA 3R7SA 2Z1MA 3MZLB 3LSTA 2W2OA 3PIIA 3HJAA 3CKLA 4FD2A 3UT7A 2B36A 3TQHA 4LUNU 1KDTA 4CUZA 3CUWA 3FDJA 3I9MA 3RV4A 4M49A 5DBEX 1R66A 2QUBA 2FWNA 2RD0A 4FE7A 4HYQA 5ICMA 1T1GA 3UPDA 1N9AA 1N5OX 2OVBA 5H3CA 4A3TA 4TV8F 1F17A 5DI3B 3GPCA 3ZJ5A 4TRJA 4WESB 2GTHA 4J76A 4C5BA 2GN1A 2DUWA 5EZYB 2CDCA 3WGQA 1UFKA 1T15A 4KPEC 1QH9A 3U5ZB 2I1VB 1FNSA 2ZSDA 3QGMA 1ZH8A 4KQ6A 1DCEA 3RKRA 3N2EA 1JDVA 2QMZA 2X6FA 4EEKA 4GLLA 4TWIA 5H4HA 3TSWA 2JJYA 4H6PA 2ZAOA 4BSZB 5EUCA 5BVGB 3EWSA 3JS5A 4F6RB 4FGWA 4C4YA 4AS3A 4YMUA 2VK8A 3OOSA 3DOFA 1UOHA 1P39A 4Q4HB 4FYPA 3VV2A 1NW7A 3MIZA 3IV6A 5I7WA 3HEMA 2V5UA 3FB4A 5ANRA 2C9MA 5L40A 2VP9A 3UM9A 3ZZNA 1GG5A 1T6XA 2JGKA 5BRNA 4HNAD 4UEOA 2J0UA 3RTGA 3C3EA 2XXAA 3WIVA 3AR3A 2QMOA 4UQZA 1UOOA 3WWZA 4R7GA 2X41A 1TJCA 1U0EA 3W2GA 4U2EA 4H3VA 3BGIA 1DOHA 4G0OA 4ENPA 3O03A 1KI3A 2NACA 4Q4CA 3EASA 4QUAA 4X6LA 5JJKA 1ODJA 1VL0A 3UAGA 3SC3A 2QW8A 3LCUA 3OESA 3IV0A 1MX5A 2QE7D 2HLHA 3FUEA 1Z36A 2DTXA 5TT0A 2YJTD 1RKVA 5A9RA 2YMLA 3FMGA 3EGWA 5LIPA 2NVWA 2XUQA 4ARZA 2D8MA 3U31A 1RM5A 3ILVA 4DJFC 4N18A 3C8MA 1JEAA 2PQMA 2DQYA 1NV9A 2GWRA 4YJ2A 2L0IA 5EJMA 2HZBA 2G5GX 1U9IA 3HABA 1HE5A 1WVMA 4MK4A 1UKVY 4MV7A 3ZV5A 4R40A 4JJ6A 2G1KA 2WG2A 3RS8A 3ITDA 1QH1A 2JLCA 3EPRA 5IM4F 2FG7C 5AVSA 1UK8A 3GC6A 5JEEA 1LTQA 4NOJA 2Q62A 2NVUA 2NUPB 4W8OA 4RSYA 2NU8A 3KUDA 1X0VA 1XKQA 3V4FA 3H05A 1K7XB 1X7WB 1U31A 5I7EA 3GJ0A 3L7MA 2VJLA 5EMHA 1FZTA 4GIBA 5ELLA 3U7HB 4CVNA 2XZDG 2P4EA 1HFKA 2DY0A 4JFAA 4OXKA 3SG0A 4RY0A 1G21E 3QVGA 1G20B 3U44B 1C1XB 2R3SA 2CFCA 4GYJA 2W6NA 3NDBB 2K87A 1YQEA 3SYNA 2F7SA 3FKSA 4KR6A 4JBHA 3QK0A 4YP0A 3FSGA 1S3SA 3CNBA 2VNIA 2CWWA 5L7YA 4TT3D 2XVXA 1YJ8A 5A0FA 2RHJA 4B8CB 3BMCB 4DBZA 1TAQA 2RHLA 1TUIA 1U7OA 5FQ8A 3ZE0B 5E8RA 1E1CA 1YVPA 2Q99A 3CB2A 3GCWA 2NNWB 1BH2A 4ETNA 3DV9A 3NH9A 4GMFA 4C22A 5SZHB 2L2QA 1ZSNA 4OMFG 1TN7A 3C98A 1BGVA 4R83A 4IDHA 1I14A 4C14A 1RXEA 4EA6A 5J40A 1T1IA 5CVJA 5I4IA 3LYHA 2ORVA 4JQCA 4YFVA 3VNUA 2ECFA 3FPKA 2B4RO 4YT2A 3AFGA 1AZLA 8AT1A 5EILA 1SHJA 4J29A 5A5FA 5DM4A 3PQ2A 3EZ9A 4XX0A 2ZATA 3OBIA 4BRSA 2R7KA 2BZSA 3A9CA 4NMXB 3LY5A 1KQGA 5AHXA 4GQBA 2UZ0A 2FZCA 1L7OA 3HZOA 2XS8A 2CXUA 3TNJA 1Z29A 4N0PA 2WZQA 2C1EA 5KB3A 2CFSA 2PKEA 2C7GA 4RUKA 1X87A 2IWRA 3DPSA 5A2GA 4A2PA 1J7JA 2OOKA 1NNUA 4LV6A 3WQSB 4I4NA 1M1YA 2Y05A 3ROEA 4UU7A 3WYDA 3ER8A 1EDEA 1XMJA 4XKJA 1WQ3A 1X39A 2HHJA 2VQDA 3O4JA 3HDGA 1E5LA 3W3AD 1ZJJA 1ZO8A 4I17A 1DCFA 4L1BA 1ISIA 1YASA 4HC4A 3UJ3X 1C3LA 2VGXB 2VJDA 5LNK6 1I7QB 2I6HA 1LK5A 3D8BA 3ONFA 4DR6B 4Y6CA 3WGHA 1JHQA 3O4RA 3Q7FA 3S5JA 1TVEA 4K5AB 1G1AA 1Z5ZA 2Z2KA 4ZKEA 5CVCA 2FDRA 3OLWA 2QVBA 2YXPX 1Q0RA 3I58A 2X13A 4FYHA 3Q8KA 4HK4A 3M4JA 1MAHA 4MKXA 1LBQA 1AZWA 4ICIA 3LUAA 1R2QA 1YI1A 2H7YA 5EMJA 3E9CA 1E89A 3AEZA 3L8GA 3F8WA 4R2IA 1V71A 2QV7A 2CFOA 3HXFA 1SQ6A 3SLKA 4WN9B 8ABPA 1C3XA 3SQNA 2HKIA 4Y2RA 1LPMA 1QIFA 1ZGCA 2CBZA 2BMJA 1J33A 2R4TA 5GJWC 3QX8A 3BERA 1V7QA 2WYWA 3ADPA 4L15A 3SYKA 4MQMA 3ANMA 1FYDA 1DIBA 2UXCB 4NVRA 2QJTA 1IN8A 4CT4B 4MWZA 4UDXX 1JDSA 1UDXA 2BSAA 2Y1EA 3F6CA 2HWUA 2VAWA 5K99A 1RJGA 2Z1DA 1WL8A 4UARA 1XMSA 5LB2A 2WF5A 4ZCSA 5E1DA 1MO6A 5JRDS 1TCVA 2PRJA 4J49A 1E1YA 4JQSA 2UU9B 3JZAA 1Z75A 4XWTA 1T29A 2HRRA 1WE2A 3F71A 3K4QA 2A9QA 2ZIVB 4ESEA 1N36B 4FN5A 2HM7A 3IEKA 2G04A 3UY4A 3H4TA 1V8FA 3QKUA 5F2KA 2BI7A 2D2IA 3KSZO 4K86A 2EKBA 3NKLA 3TRFA 1TCUA 1ZVKA 2GLTA 3VSAA 4EX6A 3V4ZA 4I5IA 2UXBB 1GN9A 5AVTA 4I9GA 3KQMA 1BFDA 1TNZA 3DEIA 5JNVA 5HRCA 4MRVA 4BTLA 4B82A 3GJZA 1ESMA 5JJIA 2IZ6A 2J30A 4BBPA 4FFNA 2YHIA 4OYSA 5JQWA 4FCWA 3PB3A 3KOMA 2XGJA 4A3VA 2AJTA 3O8RA 4BFVA 3GHHA 3AVYA 4ZODA 3UPTA 3K15A 3EDRA 3SR4A 1JMVA 4W4TA 4KIFA 3GJ5A 2EZ9A 1EE9A 1YDWA 3LP6A 3ZQKA 1L7MA 4ED9A 5FLEX 4BCBA 3BQNB 3GVIA 3HMQA 1UJ5A 1GUDA 1YR3A 4QARA 3ZDQA 2A1IA 4I43A 4EKDA 4E7PA 3TZBA 1CQPA 3HCCA 2Q5QA 1EUZA 1QO7A 4YY3B 5ALTA 3WYAA 3HYCA 3QYPA 3G68A 4HLDA 1OPRA 3B1VA 4DTIA 5IT0A 3I4GA 1GYRA 3QRWA 4AO6A 3DYBA 1TEHA 2QRNA 1UWCA 4EJFA 5LP1A 3T1NA 3E9MA 3K7EA 5GOZA 3CHMA 2KQUA 2G82A 3GMSA 4GPAA 5J47A 5BWCA 3D6TB 5EIDA 3RRMB 1ADYA 3BOSA 3NDRA 2QJWA 3ND6A 4XCXA 3TZKA 2UYGA 3BICA 3I83A 4CTJA 1V6CA 1PX0A 2G70A 3TECE 2GM4A 5F3RA 2INGX 1Z16A 1QP0A 2AGVA 2HH9A 3IKOB 2IF4A 5JDCC 5JW6A 4JFRA 1SY7A 4I4TF 1E63A 3IEUA 3EZ2A 3UT5B 3IODA 1KS9A 3KLNA 1RYZA 1M2EA 4F8JA 3DT6A 3PE6A 4C0MA 2O20A 2VZ0A 3AQIA 1SVIA 5KOYA 3ZBQA 5D2CA 5F2OA 3RANA 2I66A 1BA3A 3ECAA 1J9EA 4GU5A 1LEHA 4M3NA 1RAAA 4IFEA 2GERA 3V4RA 3BGWA 4E13A 4YQEA 1UPUA 2XCLA 5IN4A 1JAXA 1M2OA 1CIVA 4EGFA 2WF7A 4YMGA 1LTHR 1YMQA 3LG2A 3V2OA 2XVAA 5AKXA 2ZJBA 1WU8A 2R5SA 3AS5A 1V55E 1F20A 3OCWA 3DVLA 2YRWA 1YC2A 2H1WA 2QXYA 3UG6A 3GH3A 2HHCA 2VTBB 3T06B 5DW3A 4OMDA 1RXWA 2H1VA 3FPAA 1R16A 2ZIZA 1ULHA 4JLJA 4MV1A 3W5CA 4I9HA 4DY4A 3O8BA 2HREA 3N53A 2BRUA 2RG8A 4QHSA 3O38A 2AW5A 1BN6A 4L08A 2FOXA 2IXBA 3VX3A 4YDEA 2C9ZA 1G8FA 5ERGB 2VPPA 4EK9A 4HYTA 3U2QA 4IZOA 1Z5OA 2XCOA 3MWDB 3N0VA 3FBWA 5DBIA 3TCKA 3EZ6A 5CLJA 4U7HA 4PSVA 4TUYB 5AXAA 2A9RA 2FKNA 5KWIA 5CHEA 4A63B 1RACA 4G0YA 4ERXA 2QU7A 5JQGF 2QXTA 3RSFA 4M38A 4UCQA 1JFLA 3I6ZA 4BO5A 3TPFA 3H4IA 3HY4A 1NYRA 4DHEA 4JR2A 2WILA 1D0IA 4RH1A 2CFTA 2IYWA 4YJGB 2VDLB 4MCIA 5LM3A 3THXA 1MQ8B 3T61A 3R5JA 3LHFA 1R6DA 1YI8A 2YNMD 4UE6A 5F98A 3BJIC 3CWZA 2C29D 3INNA 1E1KA 3TFWA 3FRJA 3I23A 2PSJA 1L4BA 1XCJA 3UJ9A 4AP5A 5CIWA 3PITA 1TECE 3KQUA 3NOGD 1EVKA 1GG2A 2Y2UA 1Q3KA 3DVRX 3SP1A 5T64A 4CLOB 4PBTA 5HNKA 4LV5B 2JHCA 5IHPA 3UW1A 1QFJA 2HDNB 5FTNA 4DVGA 3EGXA 4HWRA 1DB3A 1UFOA 4MNTA 1MW8X 4OREX 3C1TA 4NCBA 1E3LA 1I5RA 2J41A 2B0CA 3CVJA 3JALB 4JUIA 3VHXA 2BMEA 3UGKA 1FRVA 1V8BA 4BO7A 3SVLA 3ISMC 4KXNA 2C82A 1NJ1A 1EA7A 1GUYA 2VBCA 1U0OC 3HU3A 3CKCA 2TSYB 4GZLA 4IMRA 3WISA 2FCAA 3EOZA 3ZHRA 1KBZA 3ZE2B 1KPIA 3C85A 4QYMA 5DULA 4YVOA 3ND8A 1HDYA 3D9IA 2IZZA 4J8PA 4GLBA 4N4AA 3UFBA 3CH7A 2P6OA 4MIKA 1VLQA 2XTMA 1YQ9A 2YCLA 1J49A 2AOUB 1YCHA 4B6OA 1U0HC 3ESKA 3QUTA 1Q15A 1DBPA 3T5BA 4DJEC 1E0AA 2H2FA 2RH4A 2ETXA 3Q5EA 4W63A 2GJ4A 1EM6