1FVFA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
590
structure length
543
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYVEKEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SEC1
total genus 187
structure length 543
sequence length 590
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvfA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvfA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvfA03
1FVHA 5BV0A 1FVFA 4KMOA 3PUJA 4CCAA 2XHEA 5BV1A 1EPUA 1Y9JA 1MQSA 4JEHA 4BX8A 4JC8A 3PUKA 3C98A 4BX9A 5BUZA 4JEUA
chains in the Genus database with same CATH superfamily
2V65A 4F6LA 4W1RA 4J0UA 2IEDA 3FOAA 3TZQA 4DJDC 5EJEA 1V7CA 4LDNA 1GRNA 3B6MA 1HDZA 3ROMA 4QT0A 1EUCA 2GMWA 4L2LA 3GFVA 4B84A 1YMQA 2JI8A 4TKUA 3HP4A 3LQKA 2O2JA 4UUBA 3L7KA 4F46A 3N2KA 3QG1A 1P1BA 1NUPA 3ZEAA 5J2TB 3CX3A 3K1JA 1T36A 2QAIA 3WDSA 1FFCA 5ENQD 2CXRA 4OPMA 4A27A 3DZFA 4PQYA 4RZHA 2A1TS 1MFPA 2D0DA 3VKWA 4BNFA 1WHSA 1IHYA 3FSGD 1N2JA 4JDUA 4OH7A 4CM6A 5C5CA 3W3ZB 4RJJA 4TUMA 1A3CA 2I2FA 1H0RA 1C7ZA 1GRVA 2QZ4A 3BHMA 3KWJA 4H7KA 3V4SA 1E3LA 1XF1A 3J81A 3PGMA 1EVEA 1H2WA 5IDVA 3NNNA 4BP9A 3QSYA 3RUAA 5E1DA 6LDHA 1B26A 1YZGA 4UE3S 1SQSA 3RFFA 3FTEA 4V03A 1MEJA 1E0AA 2WWGA 2WTEA 4RAQA 1ZN2A 1GGHA 2DY0A 4F3RA 3DL7A 2AZDA 2WDZA 3LJKA 2O7RA 3OPQA 1VECA 3ZZTA 4N41A 3G2WA 1MTOA 4GMKA 2ZSKA 1M2NA 5BW4A 3ABRB 2O57A 4TTIA 2KATA 1EJ2A 3P4YA 3WK5A 5DWQA 4B6JA 4W7IA 1NVEA 4Q1VA 4ITUA 4OBEA 1MX1A 1E2HA 4I99A 4EARA 3GUZA 4QFCA 3KTAB 3U5TA 3E3AA 3HSYA 3NTRA 3BMNB 4Q94A 1F48A 4GCNA 3IUMA 3OH8A 5LD2B 4JLVA 4BOYA 2REBA 3PRZA 5CYGA 1V1MB 4HYYA 3IEMA 4I9EA 1TGVA 3UB2A 2VDOB 5CCLA 2YR0A 2R5WA 1T9ZA 4CR8A 5IX8A 4A8JC 3GFPA 1IDOA 1BXGB 5AP9A 2GEBA 4ZAGA 1IY8A 2HMSA 2Y71A 4FC7A 4OI2A 3UUWA 3Q8KA 1AGXA 4PPQA 3K20A 2OFPA 4A5OA 4OO3A 2EEZA 4YJFB 1J0AA 4F86A 2GESA 5ITZA 2V6JA 1IIRA 3CRVA 5EDSA 4NONA 3TF5A 4C7OB 3QLUA 1F51E 4IF6A 4UCFA 3NTXA 1KYQA 2BT4A 3SF0A 1FZTA 5HM6A 1VYHA 1NVUQ 5AJVB 3I0ZA 2QTAA 2XUGA 3EOAI 5IUKC 5IK2D 4PNPA 4B46A 3BZBA 3GUHA 2YFYA 1TMOA 3PLNA 2AC4A 3G5UA 4EMUA 1WZIA 2IPMA 4M9XA 2KSQA 1AKVA 2LWIA 2XVZA 3IS3A 4XD2A 1AVTA 1G0OA 1FVFA 1T10A 3OIWA 3B70A 4BYMA 3TSZA 4IN3B 2FOLA 4JXJA 5H5JA 3ORFA 2LCIA 1QPZA 3AOEA 1W85A 2IOFA 4I5EA 4J0HA 5K6TA 2DHCA 3NWJA 2AE1A 5G55A 4ZRDA 5LJIA 4FN4A 4CEMA 1RAEA 1ANKA 4Z9AA 1JHAA 1MPTA 1PSWA 1OAOC 1CQZA 1TZMA 2G25A 4UEOA 2C2MA 3E35A 3ESQA 2BGTA 3K0SA 4P0TA 2KJQA 4Q00A 3ITKA 3CHOA 1Q3HA 3RLIA 1PL0A 1UK7A 2KW5A 1I13A 1LSOA 3ZQUA 1ENPA 3UM1A 3GUYA 3O8OA 4F7DA 4Q39A 5KWVA 3EF0A 4JWTA 3WRWA 1TEHA 2XUKA 4TTJA 4L08A 2C5LA 5AWFC 1GUAA 1JQDA 1H93A 3L8HA 2FF7A 3L8EA 2E6KA 3M82A 2BMWA 3QPAA 1B8UA 3C3KA 3QVWA 3AEQA 1YQUA 2NO6A 2VXBA 1U98A 2P9EA 5BQXA 3UBTA 2AKAB 3K73O 1O5TA 1QP8A 1D7OA 1ZJWA 4Y3UA 3P7MA 1KEUA 3AUUA 1R5OA 1JR2A 1T3SA 3OXFA 1QYXA 5CVUA 1TQ6A 4XFDA 4JVMA 1II0A 2VVTA 2WV7A 4KZ0A 3R6GA 2H4HA 2NSJA 2FHSA 2QPAA 4HC4A 4XB6B 5EHIA 3OM8A 4HJXA 4BASA 1MZCA 4KPEC 5CB8A 2COKA 2ROQA 3GMTA 5MN5A 4L73A 3CGGA 2JD0A 5C9ZA 1H5NA 3QENA 4TS1A 2E48A 4ND4A 4BMCA 4NJMB 3URKA 1KRWA 3STUA 1V5GA 3O0TA 1ORIA 1O8CA 1C81A 4EHIA 5FPQA 4FFBA 2W2LA 4MB0A 2O1XA 2NPFA 2HF8A 3UA4A 1S3IA 3OOJA 2G4VA 1AHNA 2PVCA 4JXKA 4OBXA 4U2EA 4E30A 4EYQA 3NTOA 1P5HA 2O1SA 1N8SA 1NQUA 4HOYA 1XX6A 3ORSA 1GPWB 1HO8A 4FFLA 1ORVA 4MAMA 3S40A 1LBTA 4LQCA 1G20B 1UC9A 1RCUA 4ZC1A 3LUKA 4M1QA 4G2VA 4Y2TA 1NLZA 4JEUA 2G04A 1L1FA 4D4MA 4AKTA 4D5EA 3VZPA 3I8SA 4PFKA 4QOJA 5ELMA 3H83A 4JLNA 1L9XA 3W3AH 2Y76A 2AJAA 1VE7A 5JRDS 1D8EA 2C57A 2E6UX 1P33A 1HG5A 3NI2A 4LEUA 1ZKMA 5LCXA 3PV0A 2BFEA 2W93A 1KI9A 2X4LA 3GG9A 4HWPA 1Z6GA 4K6KA 5GAJA 3T8KA 3DEJA 5IFKA 3HRIA 4DMMA 3PG5A 4HDMB 3ZZUA 3OPXA 4NAHA 1F1BA 4RGQA 4W8HA 3BXXA 3UT8A 2SBTA 3KT6A 4PGHA 1C9YA 2CXNA 2JW5A 3DHNA 5E1MA 3BK7A 5ER6A 5CFZA 1Y42X 2AYZA 1UPCA 1EK5A 4KLAA 1DEHA 1C0LA 1UN9A 3QPDA 4QU9A 4E3ZA 1LD8A 1C30B 3SSMA 1E2NA 3DVLA 2C7BA 1H42A 1ZGBA 1NKSA 3PD0A 4G09A 4S1PA 2VHCA 4IY1A 3F2IA 3KQNA 1X7WB 1LJLA 1R7RA 5CBPB 3L02A 1QQEA 5L7TA 1HYQA 2VHTA 2R1VB 3KRTA 2RIRA 1TUBA 2OC9A 1PJTA 4PS8A 1JQKA 3B36A 4PSVA 3RSFA 3TLBA 2P3SA 3PNLB 1DJLA 2G5TA 3LRPA 4G56A 1MHPA 4Y1RB 2ACVA 4YAUA 4ETIA 4JKYA 2J9XB 2Q3CA 4P4UA 3LZ6A 3D64A 2HLNA 3NANA 4ZAFA 2XSZD 1KO5A 2P9TA 3RREA 4QGFA 3TS1A 3ZGNA 4BNDA 4EZBA 1IHBA 2I2OA 5DCUA 3A9CA 1PT6A 2V7VA 2JGJA 1N2GA 5HBRA 1Z6PA 4O4LF 2I33A 4RLQA 3V9AA 4X5OA 4CZ2A 5KVQA 3K3PA 2O8CA 4GGOA 2L19A 3ISVA 1IBLB 1R0CA 1UK6A 1U7TA 1UXOA 3VPBA 4YAGA 1MD9A 2NYVA 1H2EA 3EZNA 1E77A 1MO6A 3QNWA 3S8MA 2HO1A 3JD1A 3R0ZA 3U7GA 1QBGA 1ZH8A 3DBSA 4PC2A 5BSTA 3R4VA 3LBAA 4OHBA 5BQPA 3R76A 3OQIB 1UBNA 2GRUA 2RONA 3ZK7A 2ILTA 2BE7A 2O0LA 4FSHA 1OREA 5DHUA 3SZRA 2EF0A 2J3LA 3K4QA 4WACA 1BYUA 4JB8A 4DT1B 1W5SA 3CHMA 3EGXB 3KS9A 3L6DA 2C9YA 5IWAB 4CKWB 1LC3A 1H3NA 4EG8A 1H2FA 2I8LA 2HYDA 1H2UA 1BMFA 4G5GA 2P8JA 2WSBA 5D3KA 1Z4JA 4EECA 5I9NA 4Y7DA 3A26A 3DAFA 4YAFA 4O2BF 4MR7B 2FPXA 4FHFA 2QLFA 2NXPA 2GN2A 2W0SA 3DSRA 2BFDA 4JMLA 3FNRA 4R8SA 3JWJA 4XUEA 4J1NA 4BB6A 5HIAA 1VCIA 3GCXA 4UQXA 3GA7A 3I04M 5AIJA 1UAGA 2W00A 4GEGA 3LS8A 2QUBA 3GJ8A 2P9FA 4WZBE 5DX0A 1V96A 4YP1A 3U6KA 5K0EA 4H7HA 5JJ5A 1E5XA 5D0OD 5BXOA 5BUZA 1QIKA 4IH4A 4DC9A 2XQ0A 4XFJA 2B0CA 1UDXA 2O48X 5IM5A 2R4QA 3U3JA 5JO0A 3BTVA 2P0EA 2W2XA 1MB0A 4FLHA 3UENA 4DABA 1A76A 1ZU4A 2EGHA 3H1FA 4Y6LA 2UAGA 2VXYA 1YB7A 3PJFA 1YASA 4E08A 2F3TA 1BQ3A 1SD2A 5FI1B 1N5LA 4ER0A 1AA9A 2MHKA 4EBAG 4HAXA 1GR0A 1P4HA 3CCBA 5L4SA 1PYOA 2DHQA 2QLNA 2YXEA 4BFXA 3VU3A 1XNQB 3NIFB 2NXWA 1U63A 3IX7A 3A28A 2WWRA 2OO7A 5KKAA 1XBTA 3EAFA 1C3OA 3BXHA 2OVBA 3LAWA 3ZYZA 4US2R 3CLRD 1OQAA 1Z8DA 2ZQ5A 2NTNA 1DFHA 2Z83A 4DDVA 4MUGA 1TK3A 1M2VA 1P5RA 1QO9A 1JLKA 3V2HA 4OM7A 2C5HA 2M6SA 1GPDG 2P5SA 1PT5A 3KB8A 2C3PA 3FR7A 1EB9A 4LV6A 3E03A 3ICVA 4RKRA 2DAPA 2YWRA 3BGOS 3BXFA 1ECJA 4XASA 3RJZA 3AZPA 3RJ9A 4A2WA 1SOMA 4ZIRA 1K3ZD 3EBOA 4OF4A 2P9JA 3EJ6A 5GV8A 2FJ0A 3QPUA 1IXSB 4YRJA 5CFPA 2Z6AA 3UC9A 4BFWA 3UKDA 1I2ZA 1F2TB 3PZ1A 4NE2A 1LQUA 3LBHA 4MW0A 4RK1A 2ZYWX 2EBFX 3LQQA 2OBLA 2YINC 1R64A 1JDSA 2OCAA 3D3JA 4LWOA 5CXXA 4X8LA 1P7CA 3HDQA 3HFRA 2OBMA 1LZLA 3GBVA 3JY6A 3OAAA 3ROTA 2SCUB 1FYFA 4GKAA 3TINA 4IIUA 1Z2DA 3LW8A 4H3KB 1IUKA 3GFGA 3TVDA 1A96A 2I03A 1QSGA 2FFQA 4J1TA 2KMLA 2WWWA 3ZVKA 3SQNA 5JPCA 2K6GA 2P5UA 3RODA 1EFPA 3FOWA 4FGSA 5AUQA 4UUMA 4UDXX 3H9JA 1GILA 4B3XA 4EL5A 5EJ9A 1CR4A 2OV4A 5FWYA 3GLHA 2FZ4A 1QYVA 1JHYA 1XRMA 2Y9MB 4I2WA 3FCAA 3IIMA 3N7TA 4I66A 2UU9B 4P8RA 1D8TA 2FE1A 5L3QA 1XO1A 1K4YA 2ATCA 4OXXA 1YL6A 3LBFA 5FP0A 2I6QA 3BU8A 2EBHX 2FCAA 3D7KA 1O54A 3FMOB 5PNTA 4KAFA 1WXHA 4CXMA 2QBYB 3GPDG 2WXOA 3Q5MA 4RVBA 3DV9A 3T99A 2JBAB 3ZWCA 3T5TA 1I3CA 4XYLA 4RSHA 4WXRA 4MV7A 3FJYA 1XU9A 3MWEB 5B53A 4DKJA 1WHTB 1WQ3A 2EFCB 5JSYA 1COWD 3AJEA 4CMHA 2WXMA 5DE3A 2JBWA 2UZ1B 4P1ZA 4L4XA 4RA6B 2X2OA 2RC5A 2ZI5A 3K09A 4HR7A 4YRDA 4BXOA 4DUIA 1MT0A 1QB7A 1WPGA 2RGGA 3DBRA 4JC0A 4OATA 1NW3A 4HH4A 5FFFA 2Z2ZA 4RZSA 5GQSA 2IV7A 3TQOA 2PRZA 5TVGA 1ADGA 3RGWS 5KINB 4RWZA 1PUXA 3QTLA 2VNIA 3KQTA 4KOEC 2CGEA 3NETA 3TOSA 2FR1A 4Q7LA 5FF9A 3R75A 3UXHA 2Y1XA 1F0YA 2R2LA 2AR9A 2G72A 3EDOA 4CI0B 3AYZB 2E5LB 1FDSA 2HDNB 1A9PA 2WF8A 1PI3A 2Z8XA 3IHLA 4Q3EA 2BMFA 5KTKA 5M34A 4PFQA 3UJAA 3C8ZA 3QX9A 4JHXA 3LUBA 4U39A 4YFVA 1KK2A 1UJ4A 3OHSX 2ZXUA 3H8WA 1X8LA 2I29A 2HQ1A 4B4DA 1ZHFA 4KO1S 1IUOA 5B7PA 5BXYA 4Q24A 4N76A 4AQDA 4CPDA 2DZNA 3GLQA 3RUCA 4IDFA 5K09A 3K9LA 3EPKA 3H5IA 2OHVA 4OP1A 4XSHA 2OORC 1FUUA 3QOXA 1JVSA 2XMPA 5AK0A 2K7FA 1CKEA 4KO3S 3VJKA 1MABA 3KJNA 4ZMSA 2V55B 1J5PA 2B8TA 5JS1A 4ZGBA 2P9GA 4MVYA 4YLYA 4Q4HA 4ZRNA 3N3AC 5H80A 1T25A 1MNQA 1RQGA 3WAGA 2FPIB 2RARA 1PYDA 3USES 3FXAA 4TMYA 4XCVA 2X0IA 4CQJA 1QCZA 2IOHA 4IOKA 2IFTA 4LYHA 1F2UA 2EYQA 3HJCA 1ES9A 1WD5A 3K0EA 4FFDA 1PJLA 2R1TB 1LPMA 1KFJB 3FSRA 4V0LA 3PNOA 1E58A 3ICCA 4DB2A 2WMNA 1GNVA 3I58A 1Z6AA 3KQMA 5F98A 3UGKA 1BHSA 4ZV7A 3EOZA 3U7EB 5DHFA 2H1VA 2WQZA 1JKMA 5LQNA 4FDTA 2C5BA 3KKKA 1F8UA 2J4BA 5A2GA 2FPRA 4W5RA 3QVJA 5DIZA 1B0PA 4N5MA 2FUEA 1P4AA 3CHSA 3D4NA 3Q72A 4WZZA 4EY6A 1Z0FA 3FGNA 2H3HA 3OCXA 3SHWA 1P44A 3ND6A 2WJPA 4GWLA 1UM8A 3NZSA 3ND8A 3WVNA 3TLGB 3VZDA 5JDCA 5KQMA 2BF7A 1GITA 5GPBA 3ZWNA 2C7PA 1P1FA 3M1IA 4YJ2B 2DZOA 2ZJ0A 1RWOA 3UK1A 4IYPA 1PFWA 5KTSA 4NJOA 3PFNA 1A4RA 3KQOA 1TMYA 2AMYA 3C8DA 2PRJA 5BN3B 3FUTA 2VLIA 4DADA 3QLTA 3FUWA 3ONVA 4Z8YA 5A1TA 1X74A 4GPZA 3U64A 3Q10A 3K70C 5EC8A 1PJAA 3SC6A 4PS1A 1PZHA 4UMDA 4WZBA 2XGJA 1DZ3A 1U1FA 3DCYA 4XTCS 2CJYA 3P27A 3KX2A 2GSDA 3HY6A 3Q6MA 4LNAA 3HYMB 5JCOC 1J8MF 1Q21A 1XTTA 4PNEA 1N5RA 2WMOB 3BS4A 1VLMA 2D5BA 1E3JA 3NOVA 4LXIA 5E6RB 2G6TA 1I8TA 2C61A 2HMTA 4V3BA 1O57A 3PVLA 4LHSA 5JZVA 8GPBA 2WJYA 3CKKA 3GEDA 1ZH0A 3OTGA 4ZVLA 2OGUA 4MB6A 1V4VA 3EHQA 3NFYA 5EZ5A 1FX0A 1UJ6A 3ZDQA 3U7RA 1VJCA 4Y2HA 4JUFA 1E99A 2YNMC 3V5NA 4D4JA 3HL0A 3V2XA 4QHSA 3G85A 1W25A 5KPDA 4TSKA 1XI2A 1W96A 1H6AA 4KPUB 4C2UA 1YU6A 4ENPA 1GU1A 1WTAA 4YMTA 2JFHA 3TXAA 3QF7A 1T2UA 4QDKA 2E55A 3DZDA 2W2KB 2FW1A 3AQ4A 4ANUA 5E75A 3QUAA 3O8RA 2JJQA 3V1TC 5CEDB 1X9IA 1UPXA 1VCOA 2UYOA 5DX8A 2DETA 2XRFA 1WOMA 2ZREA 2FEKA 1GCGA 3B95A 1V3QE 3AV3A 5LD2C 3DM5A 3Q0TA 1MJGM 1V6SA 1X6VA 3DAOA 4MV6A 1ZOIA 4PC6A 1SWVA 4M7PA 2OCLA 5CT8A 4E94A 2F4VB 4OHYA 2FETA 2QQ0A 5IAJA 4WXHA 1JFRA 2WF7A 3NBMA 3L05A 4JJZA 5A9RA 1HI9A 1DWPA 1AKYA 2XKAA 3DUFB 3AHHA 2AUTA 3ONEA 5B58T 1NIJA 5TGTA 1OASA 1SBIA 2E0IA 3NJRA 2VJCA 2GXUA 4DCOA 1B15A 1QRTA 5CJPA 1Z2CA 1OWLA 3MA5A 2WHXA 2XV1A 1Q12A 1NKTA 4E5YA 2GROB 4G07A 4H35A 1B16A 1V9CA 1FDVA 4BNNA 2CN1A 4FR0A 4HWGA 5LYYA 1K8XB 3JQRA 4H6PA 5C1BA 4RHTA 2VAMA 5CNJA 4LZAA 3LC7O 1V7PC 3QEAZ 1CJMA 1EWVA 1WMFA 3HN7A 4AK9A 5CDFE 3I9OA 4WZ6A 4BB5A 5AVZA 1BTOA 5AK4A 3KQWA 2G08A 1YR1A 4KVOA 3MOSA 4NMXB 3ZZNA 1J06A 1CP3A 4R69A 3FTXA 2VAXA 2FG7C 4IJWA 4AN1A 2CXTA 1NMEA 3OJXA 5LDHA 1TT5A 3G8YA 1TC2A 3NORA 2WB2A 5TQ2A 3GZNB 4KFTA 1YGYA 5D87A 1QHXA 3UK2A 5HRUA 3ISMC 1OX4A 3A3YA 2NQTA 1CB0A 3FUEA 4WNDA 4BEBA 1LDMA 2QTLA 2MYOA 2XMQA 3ETJA 5DRYA 1KGSA 2PBZA 3NEAA 4KNYA 4DMKA 5CPBA 2HEIA 4EDFA 3OM0A 3B52X 3GUCA 1KSJA 2PS1A 3HCBA 5E6UA 4PX5A 2XS1A 4MEJA 2WXQA 4QPPA 3MIIA 3N1UA 3PKZA 3K0CC 5FBZA 4HBDA 2VWQA 4CGVA 1LWOA 3MWJA 5FHQA 3MT7A 5C34B 5FUQA 2V74B 1U2GA 5J59A 5HRAA 2VBCA 2SICE 5JCOA 4WDQA 1GTZA 1JJBA 1II9A 3O8LA 4UI9K 2IYSA 2ADFA 3AHJA 4JKOA 2V3VA 4DQLA 1JH9A 4XM2A 4XARA 1B76A 1OBVA 2JCSA 3CMMA 2R85A 4WFKA 1A2OA 3R7NA 2X42A 3A4YA 2ZUFA 2JJMA 4LK2A 1HE2A 1JWAB 4YGXB 2Z1DA 4NHOA 3FDZB 3M2PA 2XMRA 3WYCA 3AFOA 1DC4A 3I4CA 5BYBA 2XI4A 3DMRA 4J16A 2Q8PA 3L6RA 2IH4A 3HBMA 4E03A 2CHEA 4UVIA 5EE0A 5ECYA 5GZ6A 1T91A 5KDLA 3HC7A 1ZSYA 1M5RA 3HPQA 4TL9A 3HKBA 3AVPA 3PC8C 3ZVLA 4UTPA 4KBYA 2P6NA 2V8OA 4C0EA 2QB5A 5JASA 4B40A 1JAXA 4W5NA 1BE8A 4EQ6B 1TJ5A 4UBLA 1KDOA 2BBWA 4A3VA 5MFPA 3C8UA 5AI9A 4DX1A 3FCSB 5JTTA 3PZDA 4MDHA 1K7YA 3LCAA 1RKVA 1TYCA 4LJ5A 3AR7A 4JJIA 4EPYA 1DFIA 1NVAA 2BRUA 1M6WA 1ZK1A 2C9CA 2CY0A 2VF4X 3P0IA 4LRSB 4X44A 4V0QA 4X62B 2ECKA 2W2MA 4KUGA 4EJ6A 2OAGA 3QBVA 2B1JA 3L93A 5K3BA 4GXQA 5BQOA 1LNQA 1BW9A 4FA6A 4UPEA 1C7RA 5BSFA 4L5CA 4BS9A 2X9GA 4QODA 2Q0SA 3K94A 1NW6A 2KZTA 2RK6A 4R1TA 1A8SA 1EVJA 3KO8A 4IP0A 3L77A 3ESDA 1PR2A 1BWRA 1MORA 3UJNA 5LLTA 3Q6NA 3MF4A 4ZPXA 3SC4A 1WP4A 4FTWA 2D4AA 4CEHA 3HJGA 3LX5A 1IHUA 2CKDA 2D1RA 2G4LA 4ZPJA 5D8DA 3HRAA 4LI0A 2Q3MA 5KHOC 4PPFA 3QYPA 2RI0A 4ZOEA 1CQWA 3QW4B 1J25A 2ZCVA 3WSVA 2H16A 2C2LA 1QO7A 1K88A 4JOQA 2BKKB 5BP7A 4A23A 1OI3A 1XAGA 3SIWA 5FNVB 3ZX4A 3W6ZA 1VKOA 2CFRA 1I1NA 2XZDG 1USUA 1I5OA 2PX4A 3MSCA 4M1ZA 2KBEA 4X71A 3IUPA 4BLSA 3K2EA 1FLVA 2GUWA 1VJDA 5G04J 2X4IA 1JHPA 1KIMA 3BEDA 1B8PA 3FHLA 4UAVA 4AZ0B 5IVHA 1YZYA 3AUKA 4IJVA 4URVR 1GKKA 3F67A 5DNCA 1KR5A 2XOEA 2GZSA 2V5AA 3GPIA 4RV5A 1CR1A 2HA3A 1S01A 4GPEA 4S2UA 1RYBA 1EJ6A 2PX0A 3HXKA 4DIDA 3M7IA 5TT1A 5IPFA 4BN0A 1NZJA 1RYZA 1EFPB 1RSZA 4XGNA 1LBEA 1DQNA 3ZCQA 1BDBA 4JQSA 2QMEA 3D3NA 2AFIE 4RKQA 3ZU2A 5FV4A 4IG9A 5CJ2A 4D7AA 4FI3F 1XDBA 1WIWA 4AQ7A 1Z6QA 4GMDA 3WKCA 4KXYA 1TO1E 3A37A 2E49A 3VOSA 4C6HA 4G0PA 1EHCA 1SB8A 2NXEA 1FRZA 4UBMA 5ECWA 5TPWA 4BBPA 1RAHA 3NNSA 2OV3A 3RR2A 5AKKA 3IH5A 3GEMA 4A4DA 2ZZNA 1O2DA 2HMAA 4JEHA 1S3SA 2GEVA 2XEEA 4J6FA 3E15A 1O1TA 5CDSA 2P2YA 1OIVA 2QJTA 1P77A 1EK6A 3W5DA 2C4WA 3DMTC 3MXOA 1U3CA 3ETLA 5F4ZA 3OZIA 5E9WA 1E1DA 3LTNC 1KBZA 1MV8A 2QZAA 1Z5GA 4WBNA 3JS5A 1XZQA 4F96A 2HN9A 3FFXA 4ZODA 1OBCA 4J2TA 4RQIA 1VXOA 4I9FA 4F3KA 3R9MA 2X6TA 4HI0E 5HKLA 2DZDA 3AERA 4ZJYA 3AR4A 4F91B 1LRLA 5HUQA 3W5JA 5K2MA 3ZV6A 5ALQA 3M4JA 1QOQB 1ISPA 2WJVA 1O96A 1FMCA 2ZATA 4KWHA 1CWUA 4AMGA 1W75A 1GLVA 1GG9A 2FXVA 2XT0A 3BIJA 1YDEA 2O23A 2J7KA 2EKPA 2FSSA 3DZHA 3HP7A 3JQGA 4JQOA 4X7BA 3PXXA 4Y30A 1NVXQ 4E21A 4I1YA 1XMJA 4QTUB 3VZCA 2PVSA 1OPXA 4LZWA 3HSSA 5KMGB 3N74A 2A88A 2VCEA 3UHFA 4I46A 2WOJA 4CL0A 1LCIA 2QORA 3FNBA 1VRWA 1ZN8A 1N9AA 3HXFA 4G26A 2P9ZA 2W6PA 2JH9A 3DAPA 3H7IA 3K92A 3QE3A 4UATA 3S5UA 5AJUA 1CQIB 4R0MA 1MJ5A 5TIIA 1ZCJA 1ZM4A 1JG2A 2FZ5A 3ANXA 3PZBA 4L8VA 3ESCA 4NE9A 3V4ZA 4ZQCB 1OA0A 5BWCA 4GXTA 4KW7A 1AMUA 1JFFA 3VXKA 4LRYA 3JD3A 4BFRA 4MI9A 5IARA 3UHJA 4N3BA 1R4MA 2R7LA 2IYNA 1VYUA 3LHKA 3DLPX 4XIIA 4KN6A 1SN7A 4RHCA 3ENEA 1QBQA 2FSFA 2NV0A 4FFPA 4PTLA 5F78A 4MKXA 2YCBA 5JZOA 2KS6A 1D4ZA 1UXHA 1U0BB 3LL7A 1T29A 1V16B 1VBKA 5CIWA 3V8MA 1RPJA 2BELA 4NFSA 1NQVA 1ID1A 2POQX 4XIYA 5LIRA 2PRIA 4AKEA 3ULEG 3K8OE 4KBFA 3T0IA 4TVOA 4F5WA 3INNA 1DGQA 4G9EA 3EXEB 2C5FA 4KR3A 4QUJA 3KKEA 3KUDA 5I8PA 4U2KA 3C7TA 4GTTA 5B3LA 3EEOA 4QIHA 5FDFA 1EFRD 1OR8A 4AJ1A 3RIEA 2AZ4A 4LV5B 4ESEA 1Q0UA 2NO7A 1VHJA 2QRPA 3KCNA 3WB1A 1ZM7A 5LP6F 1Q7TA 3DPDA 4E5DA 5HK9A 3ONFA 1RIIA 2H2AA 2ONJA 3HEAA 1REQB 2A1UB 1H1LB 3LUAA 4CGZA 4I1SA 1TNOA 3H86A 1LLDA 4OQQA 4LFAB 2WNSA 3P0HA 1YC2A 2FR8C 5JLJA 1VMKA 1J0DA 3MOGA 4YGYA 1UG3A 4F04A 4DZTA 3Q15A 3Q3CA 4GD3Q 5F3RA 5B3KA 4R4JA 3IT0A 4BGIA 3WGUA 3U4MA 2X2FA 1MIOA 1NVDA 1K5GA 2OUIA 3MERA 3PHHA 2BUCA 2PPVA 5ALHA 5H59A 5DNEA 2C0MA 5CDGA 3W3AA 1YGPA 2VI5A 1JMKC 1NWCA 1MOSA 2E82A 2EOAA 2FE4A 1OXBB 2PZAA 2QM0A 3P2KA 3ZW8A 5T4YA 1F2TA 3UUXA 2P4HX 1IZ7A 3GRUA 2BBOA 3OEWA 4TMKA 4QPZA 1G6OA 3B5EA 3UINC 3LDHA 4ZU1X 4U0ZA 1HQYE 3K09C 3LSYA 3QUBA 4DUGA 1J1ZA 4WJZA 4DXHA 4JR0A 3FTYA 3BTSA 4NF2A 2XUFA 1JECA 3MHPA 3ENVA 4OTZA 4BAZA 5L45A 1G1AA 2A1IA 5LXTA 5EKSA 4PN3A 2VF7A 4EYEA 3RV4A 5EP3A 5CCBA 4BY6A 1MDBA 1YZLA 4B33A 3SIXA 1TRKA 1Y33E 1RC0A 3DJFA 3EZYA 1F06A 4NL4H 1GAWA 1TW3A 2B4YA 2OZEA 1NNI1 2BGLA 1NE2A 1SXJE 4V1CI 5JSZB 3OTQA 1UL1X 2F3SA 4Q4AB 4XW2A 4IV5A 1GSIA 3TW8B 4YJKA 4DSTA 2MSDB 4IIGA 2UYCA 1D09A 3UWSA 4DLAA 2QY6A 4FMCF 3AVWA 2QV7A 5BYJA 3ANYB 4BTAA 1N1GA 4GZLA 2VBIA 4GMLA 3AQIA 4IRXA 5KJ1A 4G1VA 1I7QB 2LSVA 1LNZA 3GK3A 3B9QA 2P2ZA 1NQTA 3O47A 3TD6A 5BNIA 4Y0VA 1D7AA 1NR5A 1OXKB 2BGNA 1V2HE 2H06A 4IKPA 3KUXA 4FFMA 5EP1A 3WLNA 2GFIA 3ZTTA 4Y0AA 3WHIA 5U9CA 1J23A 1UXGA 1U0HC 4DIEA 4PVDA 2UZ4A 1X2BA 2OT3B 3D4OA 1U1EA 4QXAA 1WUTA 3D9HA 4UM8B 5TRTA 4CV1A 2DSTA 2FUG6 3HPRA 5AJYA 1VB5A 5JHAA 3NXKA 4X6XA 1WU8A 2DRIA 2WD7A 3WWCA 3O3MB 1VPEA 3I2HA 4ZHQB 1YBFA 2EDAA 2H2HA 1R9MA 2HKIA 4MWCA 4O2BB 3ZGLA 1FTYA 1P0FA 5J4LA 1OH6A 5ESDA 2PQ2A 3PEUA 4DUZB 3A4MA 4JXZA 4YQEA 2WXPA 5LOVA 2F1JA 3QMVA 2QLBA 4TYYA 1Z18A 3HN6A 4G1EB 5T67A 4D80A 4PQFA 1UKAA 2UYGA 3WB2A 5CA0B 5K7SA 4MIOA 4R1MA 5LQRA 5T4HA 4BN5A 4TV8A 3HKDB 4ZD6A 2HYIC 1V8PA 2PN1A 2GBFA 2VTDA 3F6SA 1GDTA 1W0JA 4DX7D 2XE8A 2H4ZA 3RUIA 3ZU5A 2ST1A 3GDOA 5CMYA 3WO0A 4BFSA 1M6EX 2W6IA 2MYPA 3A1TA 1Y9EA 4RKYA 4FGJA 4FU3A 4UUQA 3ET4A 2VSYA 2Z98A 1T1JA 4NC9A 2YVLA 3BIXA 4TMZA 3KOZA 3JVDA 1UDBA 3AYXB 4BQPA 3CIAA 3F0TA 2LPMA 4S0XA 2BFNA 3D1LA 5E8RA 2ZJ5A 3JYSA 1DCEA 3AJRA 5AKGA 3H19A 3JQ1A 1ZGGA 5FJIA 2QL5A 1FP7A 1NA5A 2LUHA 1IEXA 4QGBA 5FRDA 2NYUA 1CDOA 1SXJC 2GK4A 1JYFA 1UBRS 2HWXA 3A36A 4C6TB 1OLXB 2XITA 4LFCB 1NW7A 3ZDDA 4YT2A 1AZSC 1LJ8A 4RY2A 2XA9A 2XADA 2FWMX 4PZCA 4NDNE 3TWXA 5AHWA 4RZQA 2ERCA 2HUPA 2VJ8A 2Y92A 1RACA 2Z0MA 2ZYAA 4RK4A 3A2MA 1E6EA 4IUDS 4TKZA 4YWHA 3BA1A 4PTZA 4RTRA 3PF9A 1LX6A 3AB3A 1JXOA 2EZUA 2I22A 2JAQA 4WADA 1KEPA 4TKUB 2PJDA 2HA4A 4XLZA 3QV2A 1SUAA 1Y8AA 2M6RA 1MAWA 1P18A 5BV0A 1POWA 2RC6A 4XJVA 3ZWQA 3UFBA 2DH5A 4ENTA 3TEJA 4IJMA 1RI2A 1ZNZA 2YUTA 1E7UA 3VGJA 2Y6VA 1VZ3A 2WICA 3EHNA 3COPA 2V7QD 3K4HA 5EXSA 4QO8A 3TRKA 5JANA 4TT8A 4Z4IA 5TVKA 1KIFA 3KZOA 4GM1A 4E5PA 1H2YA 4JP1A 1Q7GA 4UJ5A 2CV2A 4NQRA 4EO9A 2NAPA 3GEGA 3PC6A 4XQGA 5DOVA 1O1RA 5EZQA 4C30A 3T3GA 5BN3A 2D2VA 3UMRA 5JOQA 1M10A 3D6NB 4BO3A 4FEGA 4YQYA 3VKGA 4OQMA 1YZTA 3FZNA 5ELXA 4MZDA 3FTNA 1XD2B 4IGIA 3NP9A 4G85A 1DDOA 2JGDB 3RU0A 5KTOA 3HA7A 1NW9B 1YE3A 3PNBA 1B4DA 4BQOA 4D46A 3EC1A 3FZQA 2GFHA 2ZVQX 1CS0B 5LDDC 2IIPA 4TYQA 3MWDA 4ES6A 3AVYA 2ID8A 1NVBA 3EIHA 4DRZA 3IAM6 1M33A 4MW1A 1QIJA 1WQ1R 1RJWA 3EAQA 1QM5A 3AV0B 2WKPA 4HNHA 1VG8A 1ESZA 2KWIA 5KWIA 3MS2A 1YZNA 3JWGA 1QMGA 4Y8VA 1T3GA 5TS2A 4TTRA 3T9AA 4DY4A 3E53A 3L6OO 4BZXA 3GP3A 1KJYA 4TKVA 4KN5A 1NONA 2PS9A 3G49A 3N3BC 1TT7A 2RE8A 1XLWA 1QE5A 2A7QA 4FFNA 4JSYA 3AM3A 4XI9A 2FK8A 3W5SA 4RHFA 1VE3A 3R9XA 2GRJA 2QY9A 1XZMA 1JB1A 2IYVA 2GZ2A 2RK3A 3QRWA 4G9BA 4GICA 1P1JA 2PH3A 4WVLA 1XMXA 2Y1OA 4NEQA 3VKUA 3H0KA 1XDWA 4LG6A 1XDGA 1YS4A 5I9LA 5T7BA 2EW8A 3E8MA 5DNDA 4RZXA 3NHJA 4PLZA 1VIMA 4JYCA 3CWQA 3M49A 5D6NA 1YNOA 3DZJA 3IKVA 3K30A 1JHQA 3MRVA 4NYMR 4UZEA 1Z73A 5C3UA 4GUDA 3T61A 1R6UA 5C4IA 3U40A 3AJ8A 1VMEA 4YT5A 4C05A 1YJCA 3AIIA 2OWEA 5J63A 3UWMA 3ADBA 2C4NA 4GMFA 4V1CA 1JTVA 5JVDA 4PR0A 4YP9A 3WGNA 1HDOA 4C2TA 3FHTA 2F8MA 5LP6A 5DHRA 1P1HA 2XD4A 3Q40A 4MI3A 1USVA 3OIVA 1NVMB 2E4AA 5FZQA 3DBHB 2WXJA 3LBYA 3NKLA 4M4SA 3VVCA 3WMFA 2AFRA 1SK9A 2V45A 3ILVA 1GXSB 3TL5A 2J3IA 4UTXA 3VO1A 1RQLA 3W5HA 1ISJA 2YFHA 4AG5A 2J08A 1U94A 1U3WA 4OB6A 3COWA 3D8SA 1FXUA 4BJHB 5L40A 4RTMA 1U90A 3DTYA 2AX4A 4XUDA 1TF5A 1ZIDA 1NJ1A 1ZQ9A 5E4FA 4OFWA 5JATA 3M4ZA 3VNBA 2DKOA 2CE7A 3IMFA 1VLJA 3V8QA 4WJLA 1RQRA 4MVJP 1E9VA 4HB5A 3CVLA 3OU2A 4QTZA 4S1NA 2YMQA 1C3OB 4DA7A 1BRMA 3SJUA 4BZZA 3U7HB 4GI5A 3ZY5A 1OMOA 2EDCA 3KZ1E 5JSQA 2WFZA 5FWXB 1HE1C 1NXPA 1E2PA 3FB4A 4F6RD 1PCXA 1PAQA 1YCSB 1T0JB 1VFNA 2EC5A 2IHYA 4PZUA 3HFGA 4WESA 4UXJA 4G3XA 4C7XA 1OZ0A 1RR6A 2ZJAA 3C70A 4NBVA 5FTPA 4QECA 3DM9B 2XENA 4KDEA 4U5XA 4R1SA 4PO8A 4Z0TA 3W7BA 2ZSBA 3GAZA 3Q1LA 2CFTA 3D6HA 3RIBA 4CM3A 5CFRA 2H5EA 5KVSA 2SKDA 3PEYA 4LYDA 2F67A 3J5PA 4RVCA 4TTVA 4N3AA 3FRHA 3SI5A 2LD4A 3CX7A 3ONNA 2X23A 2PPLA 3ADOA 4Z1OA 4DPKA 1E61A 1M8KA 3DBHA 1VPDA 1JIQA 4GXNA 1Q6ZA 1RADA 3KJXA 1PAUA 1ZRNA 5HF8A 1LQ2A 1YK1A 1VHWA 4ETMA 3QXGA 4PLPA 1XAIA 4LFBB 2DUWA 4JOCA 3F1LA 1M7BA 3KEAA 4E2ZA 2VPTA 3DRAA 3QW2A 2WD8A 3PSHA 4YXFA 3P0RA 2HOQA 5I9BA 4JI6B 4OQXA 3EIJA 3WE7A 3L4EA 1GNLA 4EUFA 4C7JA 3IAXA 3G9ZA 3OSZA 2WYWA 5LUAA 2O8VA 3TGOA 1DRKA 2QYJA 3NOCD 1XQ9A 3OX1A 2PUDA 2I55A 6NULA 1YBMA 3SQMA 4JVSB 3WY9A 3TRDA 2NTEA 3JQ7B 2IHJA 1B3BA 1FS5A 3FRIA 3CRZA 2CLDX 5AQ7A 3I64A 1UFKA 3HFSA 1VMIA 2JA1A 1OWNA 2C59A 3HKBB 1M34A 1KH3A 4RD2A 4AX4A 4E33A 4WINA 4L1KA 4DSOA 5IN4A 2HXYA 1KKMA 2AK3A 2VDLB 3CEAA 3R8XA 5AW3A 5KUTA 2Z6QA 3BJZA 1Y4AE 2A5GA 2AI2A 3DMNA 4IVQA 4QSHA 1QRSA 3N2NA 1DKNA 3OOYA 3RABA 1P91A 4F9EA 4KN9S 2ZE5A 5F5LA 2OQIA 4R1LA 1P6QA 3ETGA 4E46A 1PNTA 1IXRC 1NY6A 4CKBB 1NNEA 1KY4A 4KO8A 3IBTA 4UCXA 2Q45A 3K0FA 4UVDA 5IT9A 3QWFA 4GL2A 2JLAA 2NO9A 4ZQGA 3MUEA 1PF7E 1Q1EA 1P8JA 2P30A 2OHIA 2VP4A 3D0QA 4MQLA 5HOEA 5ICMA 1MMFB 5TMPA 3I05A 2KCKA 2VZ9A 4H1TA 4ER6A 4NBNA 1PZEA 3FPAA 3R4CA 5AVOA 2EL7A 5C81A 4UPVA 3RSOA 3WAKA 1I6LA 2ZZKA 4C0QC 5AM2A 4EY3A 2B6NA 1PT8A 1ZRMA 1B41A 2GZ1A 3C3PA 1E59A 4PTYA 4EYOA 3ASYA 3L41A 4F4FA 4EHMA 4NYIQ 4BKMA 2WXIA 3QVGA 5JCXA 4FBGA 1NF9A 4YQZA 3AG4E 2NU6A 3AF1A 5DLEA 2Q0QA 1OZGA 2XCUA 1L7NA 3SGHA 2NVBA 1K1EA 3C98A 1XDSA 3RJVA 1WCYA 1WXEA 3GCWA 3L8YA 4KGDA 5AJHA 3EG5A 8LDHA 1PBTA 4TX1A 4GECA 1PSDA 4EB0A 4WNAB 4LBWA 1N0IA 2UUOA 2R00C 2FV8A 3DO5A 4NESA 4MKIA 5KYWB 3GP5A 1Y3IA 3DYBA 3DL0A 3HXPA 4YP7A 5DXAA 4UDYX 1J00A 2ZXFA 1XWWA 1OJLA 2HWYA 3AY6A 3SFXA 2BHRA 3D2AA 1WV1A 3JD0A 3OG9A 3PZ3A 5EIDA 1VYTA 2NG1A 4XPIB 1KJ8A 2R7NA 4YMUA 4M49A 2IQIA 5IASA 1ZCBA 2I4IA 5FA8A 5JYCA 1BKDR 1KI4A 4B3JA 3CW9A 2R79A 3KR2A 4AF8A 1TTTA 2PSSA 5B1BE 3R3UA 4FGKA 3IPYA 1OT3A 1FU7A 2NLOA 4EO4A 4EH1A 4MQBA 5K3AA 1G8JA 1Y1LA 1WVMA 4LYGA 1RM3A 5K0JA 1XKQA 1WDKA 1SBZA 3UWOA 1CZKA 1NU8A 3T3EA 1STOA 2VWGA 4JD5A 5A6SA 3L7BA 2Z2IA 4FC6A 2P27A 3F9CA 1R6VA 3P9PA 1KMCA 3GDFA 5FNVA 5BVHB 4C78A 4Q9IA 3FH8A 4TXPA 3IVXA 3TZEA 2VR1A 4DK5A 1Q17A 3R3HA 4HT3B 1HNXB 1KMNA 4NIMA 4Q1FA 2RHOA 3WP1B 4FYYA 3HUUA 4G4JA 1W8DA 3ROXA 2JCBA 4LWQA 5CD1A 2FR8A 4PPYA 2AMVA 2IZ6A 2OB2A 2OOKA 2B35A 3IDSA 4ZCLA 1RQXA 5AVXA 4HNUA 3HVEA 1C0KA 2YJNA 1Z4KA 1ST3A 1WXWA 2Z9DA 3EQZA 3JATA 2OENG 3KB2A 3QK0A 4KX3A 3WGLA 1V9SA 3A7DA 5TT0A 1Y8CA 2H2FA 2PXCA 1XVUA 3LCUA 4DV2B 5AENA 3TXXA 4OQNA 2LIVA 2WSYB 3L6AA 4TPKA 1AUOA 2PD3A 1N4SA 2RIPA 2XEXA 4ZQFA 3QUQA 4LE1A 2EIJE 3CH5A 3HKEB 2OGZA 2HCFA 1EK0A 1UBJS 2VJAA 2ZRHA 1J1UA 4EGSA 2R1UA 5F2KA 1SKMA 2P65A 3NZEA 3WL8A 2GN0A 3GB9A 5AIBA 5HHTA 1E2IA 4B34A 1NG1A 3W4KA 2J3QA 3E22A 1OJ7A 2ANBA 4P3PA 2B21A 2INGX 4ARAA 1GN8A 4FUQA 3ZXSA 4OCZA 1JHXA 3HU3A 4E6HA 1QPBA 1SC6A 2W8BA 2O14A 2I1JA 2HV8A 2QR2A 3E7FA 3O4HA 4G4SO 4XGQA 2NNLD 2ZI3A 5A5GA 1R6XA 3TL2A 3UGJA 1ZL0A 4J3NA 5DTJA 5DLQC 3A7EA 4C9BA 4MBGA 3VNVA 3C97A 3PBKA 2D59A 4EQFA 1QH9A 4QOFA 5KYYA 4YRNA 4LMRA 2PR7A 2WKQA 4O1MA 5IN5A 3CWCA 1ZI8A 1S64A 3O38A 1IHPA 3VUEA 4ZYYA 3ZV5A 4MVJM 5AT1A 4HYEA 3H3JA 3WX0A 1C2YA 1NPTO 4OLBA 3LO8A 2QD2A 4LX8A 1SPBS 4IV8A 4K6FA 5LYJF 5LU9A 5DX1A 1SEVA 1AMNA 4CLOA 3U39A 3DKKA 3GCZA 2FO1E 3OIDA 1T8YA 3PPWA 4ZDKA 3NT2A 4LYYA 4O2BA 4ZO9A 5EWJB 1XZIA 3IULA 4HNQA 3Q73A 1M1NB 2HSGA 3OPYI 4OQYA 2MSCB 2WSSA 4BRUA 3R24A 1XK7A 3VSDA 2BFWA 4AX8A 2JFWA 2NACA 3WK6A 3ASDA 2YZ2A 4KE8A 3E7WA 4RELA 4ZK6A 1QO0D 3UUEA 1Y4SA 3UO8B 2PBLA 1GP2A 5LBTA 2ZJ6A 4D9CA 3A9UA 1V9LA 2HSEA 1ZO8A 2QRZA 2HJVA 2XUQA 5JCZA 3EBLA 4M2LA 4EY5A 2F43A 4ARZB 4FJZA 2Y4UA 5E2BA 2FP4A 3G5LA 1JKJB 3T5PA 2O8DA 4GPD1 3ML8A 3FROA 3PNQA 5E3IA 1D07A 4IQGA 1MEEA 3B1XA 2C07A 4N9WA 2BC9A 2O20A 2GHQA 3TPZA 4N49A 4UFNA 2IKSA 3BIFA 2ZUVA 4ZOCA 1ZS9A 3GWZA 5I8WA 1WW2A 2XA1A 5FQNA 5JZSA 2V6IA 5DYIA 1AY0A 1U28A 3TUZC 1UXIA 2LNIA 2DJ5A 3I23A 2A1UA 1Z6ZA 3T94A 3WQSB 3WYNA 1TA9A 5EN4A 2HO5A 4JPSA 2YWCA 3HSKA 1EWTA 4TL8A 5LQAA 1CY7A 1QUEA 3KVOA 3OIYA 4FI3C 2JJ1D 5HILA 3RYIB 4I4TF 3PF8A 5F76A 4EA9A 2R6R1 2BBTA 4EM6A 3LPCA 3H75A 4PE5B 3A9RA 4OU5A 4QUDA 2AL7A 2X0EA 1JLLA 3UMFA 4EG6A 4KWIA 3KPJA 1R74A 1PSZA 1X1TA 2W7TA 4E5KA 2FB9A 5JNTA 4RTPA 2NPOA 2J3HA 1YT5A 3GGPA 4GTVA 4I14A 4OMFG 5AVWA 3UM2A 2D6FA 4WRRA 4V0KA 1Q1ZA 4PRLA 3SYRA 1EKXA 3S70A 1ZRSA 3PVCA 3E3NA 3FWHA 3H11B 4Q7KA 3AERB 5TV2A 1D9ZA 1XKXA 2BGRA 4IIJB 3SIPA 1H2VC 3H0EA 4BDSA 4EPXA 5A2QA 1K68A 4NQZA 2VK4A 4TRMA 1R27A 5G4KA 1HT1E 4H17A 1NU6A 3NX4A 1JHRA 3QA9A 3X2EA 2WZCA 4GW3A 4X1YA 3L1KA 4PZPA 2Q5EA 3KPVA 1DDIA 2V4ZA 3OA0A 1QF9A 4WNEA 2JIMA 4L2IB 5F1YA 5C2YA 2D1YA 4O1HA 2C4TA 2P2GA 5IC6A 4UM9B 2DM6A 3OE1A 3EIFA 3F4LA 3N2ZB 4GBED 1EFLA 1NBAA 5HZGA 3K5IA 2PCJA 2H65A 4ZEOA 4PRKA 1WO8A 3D3WA 4FKBA 1UZUA 1G5RA 3UJ9A 1VYVA 3QJ5A 1VGRA 1WCXA 1EPUA 4PO3X 2YRWA 1DC7A 4DEXA 2AW5A 1DXHA 3DCNA 4D9IA 4P3YA 3WLPA 3QXCA 4I8IA 4JUDX 5KNCD 4UNIA 1XRRA 1X7YB 2IH2A 3EASA 1DKLA 5E38A 2GRPB 3K2IA 2EQBA 1L5OA 2F9FA 1BJTA 3P0FA 3TR6A 1G5FA 3ZLBA 4HFRA 2BRUC 5DT2A 5TQJA 2H4JA 5CT5A 4V02A 1F4PA 1X1BA 2YW2A 3Q9LA 4IR7A 1C0PA 3TK1A 2B34A 1P2BA 1QGDA 3CE9A 1C9MA 4MQFA 2AQKA 2R5NA 1N78A 4BNHA 3WBFA 4B3HA 4DEYA 2UVPB 1A4IA 2VDWA 4KZPA 5AVTA 4KT6B 1WAMA 5A4IS 3G6KA 4H0FA 4UQOA 4CVNA 5CB4A 5HKPA 1R50A 3T95A 3RBAA 2XB6A 2ORWA 5IVPA 3STWA 1I0IA 1MJNA 2HCBA 1BROA 4Q3NA 3EE6A 2O06A 2EJUA 2CNWA 2WVGA 4GTQA 3D7MA 4DJEC 1L4YA 2E89A 2Q1TA 2WV9A 1CULC 3VHQA 3B3GA 1R6DA 2NN3C 4J29A 5A3VA 1T9HA 4GX0A 1WEKA 1ZESA 5DH9A 4ZT6A 3VLFA 3HO1A 1WULS 1BSVA 3S7BA 3ECCA 3PHCA 2GXAA 1NLYA 3PIIA 4X24A 1KMHB 2WY2D 1LFAA 5TY0A 3MQ4A 1Y81A 1PU2A 3RC9A 1AXGA 5HZHA 1SO8A 3MWEA 3GQBB 4FONA 4HRLA 4A3TA 4LGCA 4NE7A 4Y2QA 3R7AA 3GFTA 2Y0BG 3A1WA 1YIDA 1W5AA 3TKYA 1GXSA 2C4UA 3DVRX 4O2LA 5KYXA 4W5WA 4C4YA 4ARCA 1SKAA 2NT3A 2G88A 3MTIA 3DOFA 2XTAA 1L1RA 2VEDA 2M6LA 2W71A 3UGQA 1H4VB 2JFYA 3MNFA 4DRXE 2FDRA 5LFAA 3BZWA 3G1TA 3FM9A 1BW9B 1PR3A 3KQQA 3QFFA 4WMLA 3U4AA 1V43A 3N8KA 2GVNA 4M7OA 4JA0A 2GARA 2F3QA 3GLVA 1T9AA 1F9EA 2ODPA 1T0PA 4B48A 3F73A 2D5IA 5FOSA 1S5PA 2P58C 1F8XA 3DPYA 2Q46A 1ZIXA 1OBOA 1A4XA 4R3NA 5J2UA 3I2KA 3SFVA 1F0NA 3MKQB 1F4VA 1HPLA 2ZU6A 2OVFA 3R0XA 3JU3A 3GEHA 4OGFA 1MU0A 2HRBA 3A05A 4ARBA 3QDNA 4HXGA 1N5OX 5ISMA 3U3MA 4JHJA 2FPMA 4Q3OA 4GE3A 1Z0ZA 3OTHA 4W1SA 3HDGA 3RVRA 5CFQA 4URKA 4M1OA 3IBGA 3IL2A 2C3OA 1LD3A 4EF6A 4C5AA 1YR3A 1L7OA 4RS4A 2KZTB 2R5SA 1M6NA 3JR7A 5HKAA 4AP5A 1JEQB 4K40A 3OPVA 4D82A 5LZ9A 1FRVA 1IZ0A 2X0KA 2YHIB 2I6HA 1W35A 1X7GA 5HS4A 4QOIA 3CSTA 3BIOA 1MN6A 2O2IA 3HWRA 3T38A 4XVRA 1QHHA 4M55A 3ELUA 3E0XA 2UXCB 1EFTA 3MXTA 1QHSA 1Z6TA 2GEFA 3DA8A 3RVBA 4ZHSA 4QVKA 2I65A 3PPVA 3GXBA 1BDIA 2A4ZA 5HTOA 5LQJA 2C84A 1DEAA 1W5TA 3PQCA 3TM5A 3SZGA 5JALA 4EQ6A 2IEJA 5EHNA 1KGDA 1NSYA 1TKAA 2JGNA 3EMBA 1MT3A 3PNPA 3WJ7A 1TCUA 3T0FA 4PM4A 3DHWC 2QT9A 4CU5A 4EVIA 4AWXA 1L4FA 5BMVF 4E4YA 2MINB 3SBDA 4AY2A 2ZRPA 3HXEA 3DFKA 3KWFA 4O0LA 2QTVA 5E9JA 3U62A 5I7VA 5F9FA 1MAHA 4JGGA 3HHEA 3AU4A 3JZMA 3TDNA 3WLAA 1WR8A 2GYVA 5LB4A 3R7FA 1XRPA 2YY7A 1LV8A 1X80A 3EOBI 4B71A 3LX8A 2BZSA 1T1EA 2CMFA 1KSFX 3RI3A 5THKA 3PTLA 3W1EA 5CP8A 1FUYB 4DGSA 4LXHA 5EMMA 1LJUA 1ZNQO 2ZWOA 4X20A 5E4YA 1VHTA 1E6UA 1ULZA 1Z83A 5GWXA 2R02A 1G7RA 4U3JB 3AEXA 1WMSA 3S2FA 4FU0A 3EQ8A 4RCZA 2V1UA 3DMTA 4KH1A 3RS7A 3TBHA 1JDBC 3B7UX 4CI9A 3MBIA 5KJNA 1JBQA 3P8ZA 3LOQA 1YR2A 4MWTA 1VM6A 3CCFA 4JBYA 3Q3IA 3ZWYA 5BUQA 3UMGA 1QFYA 4FWBA 4XKCA 4OSEA 3LXMA 3OCYA 1SBTA 4CKWA 3MB5A 4FULA 2CB9A 2X1VA 3GUVA 4NTZA 5BR7A 1P4GA 1MPXA 1F5NA 4OB8A 2ONCA 1DHRA 4TN1A 1K2WA 3ZWDA 1QIEA 1AGRA 4NCIA 2F17A 3RK1A 1T0UA 6REQA 5EMHA 4R6WA 4B17A 4GEKA 1LVUA 1JN0A 1RHRA 3DMHA 3KZNA 3OJLA 3B38A 5DOZA 1ADBA 1GY8A 3PFHA 4G8DA 1VRCA 3ZGQA 2KI5A 3BWXA 3E9DA 1W0KA 4MW6A 3OX2A 1GQQA 2VAWA 2DHRA 3C4VA 2B8WA 3GRZA 3KZVA 3DNMA 3ESZA 1N7HA 3KEOA 4IIJA 4Q1DA 2IEBA 4P5EA 2DBQA 4HAVA 3Q11A 5A06A 1KAQA 1QV7A 4DJAA 5FT9A 1YA0A 2GPWA 3VJLA 1MHQA 2D2EA 1GEGA 3OQOA 2O2GA 1LPNA 1Z8HA 4JJKA 6CHYA 1FPQA 1TI7A 1Z15A 2PUJA 5EIFA 2VJMA 1PDWA 4QXPA 5AIAA 1KRXA 3ZH2A 1Y7IA 5DN9A 4LXTA 4OYYA 4OIFA 4HNVA 2ASEA 2QM7A 2PYIA 1JHDA 3IT3A 3OMWA 1NJ2A 2J9YB 3Q9SA 2HSDA 5TSDA 2R1VA 3GVXA 1L5GB 2BBSA 1LI7A 5IU6A 4EABA 5BYAA 1R5JA 3CZ9A 1Y63A 2HCRA 1Z39A 1E6WA 5IXYA 3GH3A 3F4KA 3VKVA 5CB4F 5IJWA 4GQIA 1CV2A 4UI9C 3RG2A 4NRHB 1HYGA 3O4FA 1JKXA 1L4BA 1ZDMA 3B1ZA 1KZPA 3ZRHA 2HA0A 3LQ1A 2FEZA 1HDIA 3VAZA 1R9JA 1DC5A 1JKIA 1PZNA 4YHBA 5ILGA 3B5JA 2W58A 1JDBB 2PUHA 3Q8XB 3RUPA 1NV8A 2RHDA 1KTIA 1SCUA 1XRNA 4CIVA 2IDKA 1E98A 3B12A 2HT1A 3HZZA 5B3SE 3JD4A 4LX0A 3SS8A 3WKDA 2Z56A 3RAUA 1L7EA 3DHVA 4QYXA 3O4VA 2V8BA 1KI3A 1FU4A 4NCHA 5KC9A 2IF4A 2BMVA 4I1OA 4XCQA 3H97A 4CLXA 4TLAA 5FUYA 4UHCA 2WXGA 3E4CA 1WMDA 1JE1A 3VISA 1EFVB 2H07A 1JKJA 4DT1A 2J33A 1SZAA 4ZI7A 4HH0A 1ODFA 1PYGA 3CZ5A 4RK7A 5HJEA 1P61B 2IY8A 5BORA 3M5DA 4UDOA 4HD8A 2Z3VA 2F8SA 3JVVA 3BD9A 4GP7A 1KOFA 2YYYA 2G80A 3OJ0A 5F1PA 3LCCA 4C89A 2PLNA 3X1WA 1PX0A 4I9NA 4JI8B 1Z38A 1L7BA 3FOCA 1RYYA 5K01A 4IXTA 4LNGA 2WJWA 4UEWA 4CZ2D 3OIGA 3M3DA 1OHHD 3HDHA 3VDNB 3JAMA 3KELA 3WP0A 4U0JA 2YVUA 2A94A 3F7TA 5B2FA 4BC0A 3U80A 3FVTA 4OY3A 4Z0NA 4X8MA 3GT3A 3LWDA 1WY6A 2ZI4A 4A0RA 5BVHA 5K3OA 3F71A 2W2KA 2FPPA 3D6TB 4BEPA 1FY2A 4ZHQF 1QH8B 3F8WA 4BO4A 5FOVA 5HPYB 4Y1RA 1JFTA 3I1IA 3K70B 1W46A 3CUUA 3CSUA 2PYDA 3EQ2A 3DEKA 3NDPA 4YO7A 2B98A 1Z13A 1ADJA 4AIIA 2WFAA 5AXDA 3UM0A 4N82A 5CBPA 2IBMA 4BCCA 1GW6A 1U80A 2VYVD 3AKCA 3GYGA 2YKGA 1IY0A 1E1CB 2IO2C 1RQNA 4A0HA 4C0XA 3VQTA 1EWQA 5JAPA 4MKFA 2P6MA 4DA8A 2WJZB 5KZMB 3H84A 1QH8A 3PCXA 3T41A 3Q3VA 3VR5D 2FG5A 5IBPA 3OJOA 1YRAA 5F4BA 4DLXA 3H2GA 1E9EA 2CL7X 1MO2A 4P92A 2CD7A 2P0YA 5AOAA 1TNZA 1CUJA 5B1HA 3QG5A 3ZBPA 3IPCA 3O8OB 3OT5A 2O5EA 3K0CA 2QD3A 3I3OA 3IRUA 3C15C 3I37X 1ENYA 2GZDA 2OG1A 5JAHA 3I62A 2ZI7A 3R3XA 4JQZA 2Q50A 4EX6A 3FBTA 3Q85A 3UJBA 4FGLA 3LVFO 1CUIA 1BKSB 1CUAA 2QVXX 1DMRA 1HQKA 4C0HA 1U8TA 4FJ2A 3IP9A 5HP4A 1OSNA 3IKJA 4ZVNA 3WS7A 1SCDA 3N2IA 3DL4A 1YC5A 4FMDB 3FDJA 4BE4A 2QVYX 4GDFA 3RD5A 1HSOA 1IULA 2EIME 1WXFA 3GX1A 5FPHA 3HVJA 3SVZA 4CHGA 4H3SA 4YS6A 1KDVA 5KIAA 3OPYA 3HCCA 1EH5A 2NM0A 3NBKA 4PXYA 1W1IA 5E2AA 2X8JA 3I6QA 4UPDA 1WB5A 4WHMA 3CXRA 3GG2A 3UTMA 1N75A 1J9EA 4B2PA 1VZ2A 1Q7RA 3B13A 2J6CA 2FMIA 1JFLA 1MABB 2JGMA 2VQSA 3AUFA 2OEVA 3KKNA 3P9SA 3O8QA 3KXPA 5AM5A 3V7WA 1OZFA 2I1QA 1W7AA 2VCHA 3PH0C 4D97A 4BV3A 4XRGA 1G291 1ZN7A 2O2XA 4BV8A 1MH1A 5KU1A 4PZDA 3OX4A 4KIFA 5KREA 1C50A 3PQ6A 1CLUA 5G1PA 2FLVA 3HEMA 4PU0A 2PM8A 4N47A 2QGNA 4NCBA 3DV2A 3BL6A 1BFDA 2C98A 1D0SA 2JEOA 3DVSX 3Q3JB 2FSVC 4L5IA 4O6VA 2HXGA 4YACA 2VF5X 4BVJA 1O94C 2FPOA 3BWBA 5DIFA 4Z7OB 3B7BA 2QTVB 1E9FA 4R9UC 3VU9B 5JY1A 4QO7A 2P1RA 1SHUX 2WWYA 2IYUA 5EWLA 3AB8A 1II8B 4IBOA 4BFVA 1U8XX 2AVPA 2D74A 3DG9A 3HN2A 4BO5A 5IEJA 4D2IA 5JBQA 4XWGA 3DE2X 5JQGA 3J5QB 2QZPA 4Q4HB 2Y1LE 2ZXWE 1PK9A 1Q5PA 3V46A 4GI7A 1M54A 2A6PA 3L9WA 1JR3A 2ZDHA 2WIBA 2Q9BA 4B7XA 3MLBA 3DBRB 3IPLA 4CDGA 3NM6B 2H0RA 1OFUA 1UBFA 5DSZA 3I6YA 1ATZA 3V2IA 3LA8A 5HSGA 3VR2D 3TGPA 1M72A 4S1TA 5GONA 3OESA 4E7PA 3ZCRA 5CDTA 3KAKA 5F23A 4FDUA 1PNRA 4GCOA 1VSVA 2YQ4A 5HQ3B 1SZCA 1IVYA 3LPAA 3QE2A 1N0UA 4L5BA 1U5BA 3ET5A 2WA2A 2WUFA 1ONSA 3U7QA 3JASB 2QG4A 3AUXA 1PLJA 1PO7A 1QORA 3KSRA 3PXDA 1WDYA 3WOHA 2AQIA 2WT9A 3CZMA 5HGXA 3C3OA 1GYRA 4CQMD 4U6SA 4YP6A 4I55A 5IC4A 3TTSA 4A91A 1QQBA 3D6AA 4KJZA 4L8LA 1E1YA 2HSJA 3BB4A 1AQLA 3WBJA 3FSEA 4MMYB 7ABPA 1WB6A 3B60A 4PZEA 1E1RD 4N5LA 3TLKA 4D3FA 2IF0A 4H15A 1DV1A 2FX2A 2GPAA 1WU7A 1KP3A 3V2OA 3PQ5A 2BFMA 5MHTA 3QJYA 2B7CA 3U3RA 2BUAA 4O2AA 4BNKA 1U8UA 2OHFA 1FB5A 2XGGA 2AEFA 1JUDA 1LU9A 1FDIA 4PF1A 2W4IA 2C8LA 4JXTA 3PVZA 2JNWA 1EXDA 5B4TA 2P9NG 5IW8A 3KTOA 3K4PA 1U2EA 5CJJA 3D0RA 5AAOA 3A4LA 5DHAA 4WEOA 3E61A 4NPHA 3SBOA 1HL7A 2DYKA 3IIEA 4LGVA 3C1TA 1CY1A 1WDWB 2D2FA 4YDEA 3JTEA 4QATA 1G19A 1I2BA 3RWBA 2EATA 1O6ZA 4AXBA 1USWA 3ROGA 5AJLA 3PUXA 4TXMA 1V48A 3IOEA 3WQHA 2JLWA 1MJHA 1PL7A 4CM9A 2W42A 2RAFA 4QNMA 2OILA 4LCJA 2X38A 2OBYA 3ONKA 1DX6A 2X6QA 4KIWA 4POAA 1COWA 3C3DA 2V7EA 3WADA 3AS8A 1GUDA 3MD0A 1EE2A 1H4QA 1MRZA 2W2TA 3T6KA 4NIKA 3SBXA 5IS2A 3DQQA 1ECLA 1M9NA 1I3NA 4FP9A 1U0OC 2WNIA 1KHTA 4RA6A 2HHLA 4DAOA 4MP3A 2WM3A 3D2LA 4JC8A 3E58A 1ND6A 4L6AA 1Y1KE 2QN2A 4MK4A 4KVMA 5LU8A 4OHFA 3EN0A 4TVBA 3AZQA 4CYMA 1OXTA 2VNSA 1KT1A 4OFBA 2Y4NA 2VAPA 4ZVPA 1QP4A 2NP6A 1T5HX 4PN7A 2YHIA 1Q15A 1E2DA 2Q9CA 1TAQA 2AZTA 2W8ZA 4WK2B 1O58A 3RSSA 1LW7A 4CLHA 1JG3A 1TXGA 1Z36A 1PFVA 1RFGE 3IELA 4M36A 2DWZA 4X1OA 5AKXA 4ZREA 2FVXA 1IQPA 3ROPA 4N3CA 3UEOA 3WYGA 2WR8A 4KBGA 4YALA 3ZCSA 1IBKB 3HDYA 2XTNA 4B4UA 1Y6ZA 2WZBA 3RYHA 4YPOA 4HI9A 1SUBA 3LNCA 2R4TA 5T41A 3K9HA 1SMKA 4LJSA 4ZGWA 3AR8A 3BQ9A 1C9EA 4L6IA 4MPTA 4OA5A 4BQFA 3E7XA 4RL4A 1NUQA 4HHEA 2NZVG 4I3GA 4KXVA 4EZKA 3ZK8A 4F9TA 4OJQA 5ALRA 3HB5X 1R2QA 4K81B 2F1KA 5JMPA 1P4JA 3PX2A 5IZ4A 2HW8A 3B7PA 5ULLA 4JU8A 3MHTA 4W9NA 1KS2A 1CW2B 4ADSG 1UMCB 2HMWA 3VPSA 1ODLA 2RGDA 3S7FA 3DOIA 4EA8A 4EMTA 4M7CA 3I1YA 2ZITA 4O3FA 1ZI9A 3MJTA 4OQ4A 3ULKA 2DERA 1N4PA 4BP8A 2OFOA 2F0YA 3AH8A 4HXIA 2IZ0A 2Z5LA 3BDIA 3QAQA 4PYRA 1L5ZA 4TN5A 2OPHA 2O7NA 1E3EA 2WU8A 1XYGA 3BJRA 3KL4A 4YR7A 5IABA 4KLZA 2R3SA 2NQ2C 5GINE 3KYCA 5DNYB 1W1UA 4EGJA 4BFUA 1GQSA 4JL5A 5T8KA 1Y7PA 1JT9A 3IXMA 3HG7A 2H1IA 1YZUA 4MO2A 2FX3A 1F20A 3BMXA 4LSGA 3ZGVA 1RXSA 2Q21A 2J8ZA 2JZNA 3VKHA 3E82A 3UXMA 3PP8A 1Q74A 2FMUA 3ANLA 4P3KA 1KYTA 4MRNA 1JKFA 2PEYA 4FNAA 4IVRA 2JJYA 3MUOA 3R44A 1XPOA 1EUZA 5M3BA 3EJWA 4Y67A 2XEDA 3TTVA 3W6UA 4E1BA 1NFFA 3G0CA 2OK8A 1E4EB 1CQXA 1E0SA 2ZRKA 4N5NA 5LVAA 2BZ1A 3AP2A 1WUYA 2QJOA 2VSQA 3LHSA 1KVUA 5BWOA 2OEWA 5CFNA 2PH7A 4I9UA 1FDUA 1OF1A 4EVQA 2VP0A 1MHTA 1E2UA 2PYZA 4EY7A 1EWRA 1VJ1A 1XELA 1T6XA 4JL6A 4GUAA 1CK4A 4W5HA 1C7FA 4FZ3A 1ZKDA 3NR2A 3VBCA 3WMWA 2Q5JA 5CCEA 4M7WA 4U96D 2ZIFA 5H7PA 4Z9FA 2GCOA 1J8DA 3L6EA 3BG5A 3S44A 1TIBA 4XPZA 1WDMA 5FTLA 4HOUA 4E7OA 4E0BA 4R83A 3R5SA 3VC1A 3G8CA 2PGNA 3B1KA 4IJ5A 4IHQA 2QU8A 3WLKX 3BCRA 5B1DA 2FDCA 4CU2A 5KEIA 4GI1A 4HPJB 5I01A 1EMDA 4FXOA 1TIKA 1KYWA 5G1OA 4C4RA 1PQYA 3R5TA 2JJ2A 4IWXA 1R8JA 5ENSD 3MAJA 4EVSA 5K8VA 4D10C 4Z68A 3DTTA 3DC7A 1NXWA 4P5PA 5EWJA 1UINA 4Z3KA 4AJPA 1UZAA 2X40A 2AJCA 1OBFO 2CSUA 4MGKR 3KSQA 2VBGA 3THXB 4YRCA 1IJEA 1DARA 1DIRA 3KSZO 1LLCA 4O25A 4ASUA 1B74A 3UZUA 2Q6VA 2IO3C 3WLHA 4DHWA 5CAEA 4DHEA 1YB2A 4B3GA 1X19A 4TWIA 2WG2A 5B6IA 4PGAA 1VA5A 4N40A 4RETA 1CT9A 2EKDA 3RTGA 3W77A 3BWYA 2OQRA 4EG0A 3GEIA 1E7SA 3ZXXA 1THZA 2FCRA 8MHTA 1FSSA 2LVBA 3VH2A 1YVEI 4QJ5A 5ICEA 1U2QA 3FCCA 1QX4A 1SJ9A 3K9WA 3KFLA 3PFGA 4EI7A 4MR8B 4B2YA 1EYZA 3NDBB 2QQFA 1Z8FA 5BN1A 1CDDA 1E2KA 1RWVA 1MW9X 3AOGA 4LWZA 1AH2A 4NJMA 4GOKA 3QMMA 4PYMA 4JI5B 5HVNA 2GXSA 2GD0A 4HOSA 4Q34A 1P2SA 1NMXA 3E1KA 3FPFA 4QBGB 4CLOB 4F21A 3NHFA 3RC7A 4QC2A 9GPBA 3OPYB 2A9OA 4G4SP 2BMDA 4J8SA 2F8LA 4JA7A 1RPTA 2DBAA 2AF4C 3DMFA 3DWIA 3FCOA 3OURA 3GL9A 4IOJA 3UGTA 5CG1A 3LKUA 1XQ6A 2CHQA 4ENVA 1FTGA 4F2PA 5EX3A 4B0ZA 1HKHA 3AFGA 3M5PA 1VSQA 2E4VA 5CLLA 1XR3A 4JUIA 3ZHYA 2JAXA 1NRJB 2IYOA 4JH0A 4H6WA 2XPIA 3AEQB 1IRIA 4ISBA 4K28A 1AKMA 1H2HA 4JZKA 4AFNA 4HNAD 3AEKB 3FSJX 3VH1A 3ZE8A 1IPHA 2ARKA 3NQ41 2FUG1 1GEEA 1M5UA 2VZLA 5KYNA 5L3VA 2QSYA 5CEEA 4DV3B 4LWPA 5BNWA 5EEHA 2FA9A 2X4DA 2VXCA 3FU0A 1E4YA 4U7TB 3MMNA 2JIRA 5IJAA 4G0NA 4Q21A 3RRMA 4Q7QA 4O2RA 3LLVA 4O4HF 3QHQA 2XF8A 3AY7A 3CPHA 3IDQA 3GT4A 1U5AA 1MZVA 1E1CA 2ZBGA 5EKQD 1EIWA 3SNHA 4CRWA 1ECFA 1ONBA 4ZV9A 4P7JA 4BLRA 4CTJA 3Q0EA 4M98A 3CM0A 4Y2RA 3GLGB 1XV5A 2A3RA 2IYAA 3IHTA 2HDHA 4NY1A 3A25A 4PUCA 5LXTB 1SA5A 3DUFA 4D0SA 2DUMA 4W5TA 5F51A 3O8CA 1XCMA 5ECGC 5FUVA 1H8EA 1VLLA 5AHRA 5D3ZA 4CKZA 1BFKA 1SOWA 1P17A 3C3JA 3PKJA 1Q16A 2RH8A 3E37A 3D54D 3KFVA 4ABTA 5DT9A 3FAZA 5DULA 1HNNA 5JJIA 3GLGA 1CHDA 1GYPA 1FUKA 2J49A 5EP2A 2IUUA 3OXGA 4URWR 2V97A 4M3NA 2TS1A 4YT8A 3CK8A 5GJCA 1C3LA 5E0OA 3I9KA 3WB9A 4ANVA 2FQXA 1UFQA 3MTQA 2F62A 3UT5A 2L9BA 1B6TA 4X6UA 2J4FA 2P68A 2F8TA 1IHGA 4K3UA 3RVLA 3CPSA 3UWKA 3ZPXA 3MN1A 4BMVA 3LSTA 2O1WA 1NBHA 3QNUA 4KOAA 4G67A 2HRDA 2WT8A 5C32A 2VJDA 5FBVB 1DU4A 3TOZA 4BAGA 1DS6A 1F2UB 2FFBA 3D8RA 4JNCA 4QRHA 3JQBC 3SVTA 4CEJA 1HG1A 3KLNA 3UAXA 3T3MB 4DQUA 3U56A 3W34A 3PUKA 1O6FA 1T4CB 2OCGA 3ANTA 4AJEA 2XXJA 2UZ0A 1C9DB 2I7TA 4GKKB 1U0FA 2VS1A 3MTAA 2XMCA 4HLNA 3VR2A 1JRLA 3VYTB 2RFLA 3I2GA 1IMJA 2QMHA 2QTBA 3JQQA 3P9RA 2P4EA 4ZYVA 2AG6A 1ZUIA 5ILOA 3A3KA 1TNUA 4MUJA 2AVDA 3DF7A 1IAVA 1CP2A 2IK8A 2Q2NA 4Q4JA 2Z95A 4CKBA 5LWQA 1PRYA 2M1XA 4C3VA 1OXXK 1J2TA 2N46A 1JWFA 4IRUA 1R0KA 3IP5A 1X2EA 3NIDB 2O3TA 1EM8A 1XCPA 2MSLA 4MIEA 2YVQA 5AO9A 1I94B 3PNYA 1SC4A 1FQJA 1Q22A 4Q3LA 3MWLA 4WGFA 3EZFA 4X66B 4GHWA 2PUAA 4P84A 4RLHA 3G2NA 4QU0A 1ZMOA 4DLKA 3FHCB 2TMDA 1UBGA 4I1VA 3N2YA 2I3AA 1KPSB 1QIFA 2XOXA 3ANNA 3H6GA 3QVKA 3SHOA 2C20A 4GLOA 2YWDA 5GGXA 4AJ2A 3ZCUA 2HE0A 5JD6A 2PD4A 1N57A 2QAJA 2YJ6A 3IBCA 2XUHA 4GI2A 2GCEA 5DSTA 4G97A 2ZJ7A 1GQFA 1QXSA 3CH6A 3JQ7A 3M6MD 2Q7OE 4KR2A 1MP0A 3I76A 5ES4B 2P1DA 4QVGA 4RBNA 4UZFA 4DIUA 1EIZA 1SUFA 3KJIA 1V6CA 2O4CA 3BMQB 5CVDA 2WM9A 1EAMA 3EU9A 4CMAA 1T8SA 1EFDN 3ULYA 1XTPA 2PSDA 1M5TA 2L69A 3AT1A 1WB9A 3WLLA 3IAM1 3QIAA 4AURA 4RDXA 1I7DA 4QYTA 1M2OA 1CJVC 1X77A 3IC5A 3BWMA 3UMJA 5JFTA 5KX5F 4PYJA 4REQA 3CPJB 1E18A 5AKIA 3HGMA 5HG0A 5FFMA 3IEPA 4LF4B 2HJWA 2FWPA 5SYNA 1YS7A 3DKRA 1DWOA 3M2TA 3EU5A 1FK8A 1ZC4A 1PNVA 1CIVA 4HNRA 4IJKA 2NUTB 5CB6A 4PAOA 1VOTA 5IC5A 3HV2A 3DDCA 3LUHA 4EJMA 4ALLA 3NTLA 2JFVA 3SDBA 2VGXA 3Q41A 3HGTA 4NOKA 4AJIA 2AG8A 4RTLA 3T1HB 1XZFA 2GGSA 1BI8B 3U26A 5BY2A 3CNLA 4DM4A 1ZH4A 2A4MA 4G25A 3CZAA 4ZCRA 2X5JO 1H66A 1Z33A 3E30A 1UJJA 5JYDA 1K66A 3BTUA 2XNHA 4HAOA 4R2WA 4R7TA 4HN2A 1JH8A 2N47A 3LHDA 3S5JA 4CKXA 3TFOA 3E8XA 3CF2A 4D3YA 1SQ6A 3GJ4A 2EKZA 3SS7X 1JR3D 1VKRA 1LWNA 3BIWA 3I42A 1IHXA 1PD0A 1BIFA 4WEQA 2A5JA 3RTBA 3DSUA 3IFSA 4D81A 2CD9A 3FPKA 5A23A 3TNFA 2R8BA 2X86A 4YV1A 4AJLA 1LLQA 2QRVB 4LDJA 3FFWA 2Z5FA 1G60A 4XUCA 5I3CA 2BEJA 2Y0PA 3ZW3A 3HJRA 3ZXPA 3EZ7A 3FEXA 4YP5A 3T8YA 3GRFA 4DZRA 5EQJB 3H3FA 2J0UA 3Q7EA 4D9MA 3JQ0A 5I6DA 1O9HA 1CZOA 2YH2A 2FN9A 2JK0A 3FYUA 3AY0A 5EIBE 3HR8A 4KV9A 3SYNA 5AM0A 3BKWA 1GG8A 2FWNA 4HLLA 3BFPA 3EZGA 3P9NA 2VDUE 2SECE 3EFOA 1T2DA 3PC2A 4NBTA 2VQ6A 5JXIA 3Q0IA 4J0KA 3T4PA 1LTXA 1IOLA 1Z35A 4RG9A 5DCLA 1D8AA 5H02A 1A9SA 4FYHA 3SC2A 3THYB 1W29A 4TL6A 4C4PA 2IUTA 3QVMA 4MWZA 4MX8A 1A9XA 1Z4LA 2DTEA 3M34A 1HR0B 2KXPC 3S7TA 1SHZA 4OQEA 4Q9JA 1R0ZA 4DC0A 3I92A 3S1AB 3V2UA 2QVGA 4MJLA 3HI4A 2YFQA 1QHNA 1SY7A 5HFJA 1FBTA 3SJZA 3SLKA 1A5AB 3MMPA 1Z7BA 4NZZA 4ZVUA 2NZWA 3FTPA 3NEJA 2BV3A 3GRCA 4WWHA 2JZCA 721PA 4P34A 1BMQA 1H65A 5TJHA 1IZ8A 5EE5B 1HDCA 2Q07A 2Q62A 3AI1A 1EGHA 2OOSA 3ZOKA 4D4LA 4UTVA 3AVVA 1JAIA 2XCTB 4LOKA 4MCJA 1U02A 2GA9A 3TG5A 3HO6A 2Z6UA 2O1EA 4GKBA 3HU2A 4OAUC 2I1VB 4DR6B 3EXHA 1GRQA 4L4UA 2QT1A 2JCXA 4U7DA 5DGHA 2P9KG 3GLGE 3L40A 1KDZA 2YOHA 4M9ZA 2ONZA 4BNVA 1MJFA 3K0AB 1POXA 3LUJA 1JVNA 2CNDA 2WJIA 1NYTA 2I54A 2IP4A 3PTZA 1N7GA 1E3IA 2P4QA 1XJQA 3CUSA 3REOA 3TW8A 4DTIA 1KI6A 1ZIPA 3AF0A 2DBVO 2YJGA 5GVRA 5L3ZA 5JC8A 1RAFA 2HLDA 2RGAA 3NHMA 5CH8A 1UWLA 5BR8B 2HT6A 3GY0A 1SVWA 4BMDA 3ZVNA 4QPNA 2QD1A 4MYSA 3OLQA 3RPEA 1RI1A 1I1QB 1YI8A 1E9RA 2H4XA 1V45E 4C4AA 2ECFA 1W73A 3D5TA 4GPTA 2CFIA 4TUYA 3TR5A 2XIJA 3E27A 4Q4DA 3G2HA 4DV4B 1VE9A 5HCUA 2AXZA 3BCHA 2PS3A 4GR9A 3SR4A 5JNWA 1E2LA 4KGVA 5DBOA 3TEFA 2DQYA 4YJ2F 2GRRB 1YJBA 3F7NA 3YASA 3FOFC 4KV7A 1Z07A 4CTKA 2CJPA 2LUOA 1XJCA 3HGQA 2JGFA 2VCYA 3C5HA 3KYDA 3N53A 3OO0A 1JA9A 3TRJA 3AIKA 4EP1A 2Q8QA 1B43A 2GNOA 2G77B 2IGBA 4R8MA 1V71A 3MT8A 4TTQA 3QNMA 3IUEA 5K51A 2GBLC 4KQKA 3RYIA 4BFLA 1G9SA 5KNDA 4FFVA 5JH7B 4BRZA 4EIWA 3GJRA 2XCBA 5LZ7A 3U3XA 3R3YA 3KEZA 3KBBA 2VJLA 2DXIA 1C3XA 2J3JA 3HBLA 3EWNA 2WPNA 2PX6A 4BLUA 5K8IA 1N2IA 3QKYA 5AARA 2GCGA 1N6PA 2WHYA 3EVBA 1GPMA 4I17A 3NAZA 4BNXA 3ORHA 3PC7A 3J80A 4RFSA 4MUNA 1XN4A 1D3AA 1JEYB 3DGFC 4MWSA 5ARDA 1QFJA 3D5EA 5K45A 5LQSA 1TLLA 5I7AA 3THRA 3VPDA 2C8VA 1R6TA 2W43A 4X85A 4BB0A 1SXJA 2I76A 3TKAA 1TT5B 3IVGA 5TQ2B 4IIVA 4DNXA 2R6AA 4ATZD 2DVMA 3C8HA 4FBMA 4HO1X 5FBKA 4U2CA 3RYCA 4B9AA 1TD9A 1AXEA 2YIVX 2CVQA 4JIGA 3IQEA 1JG1A 1ICEA 3U3KA 3V8EA 5K3FA 4DIKA 4ZICA 1H23A 2HYZA 2J3KA 2XLBA 3ZNOA 2HU5A 2CHVA 3GXOA 4B4WA 3R9XB 2C2OA 3AHEA 2QU7A 3RRMB 1RWQA 3I28A 2OCBA 2QXYA 1IBMB 3B1VA 4KVZA 3V4FA 1YCDA 5BWNA 1II8A 1UDCA 1NPYA 5C3MA 2WAYA 1ABFA 2G5CA 3G7SA 1EDOA 1QGYA 2H7XA 2PUFA 2W9XA 4QQKA 4CTMA 4F7WA 2PA0A 5B7NA 1OZHA 4PG8A 5KOHA 3EEIA 4AUNA 2IT1A 3CRMA 1FSFA 1KI8A 3ETDA 3GAMA 5HOQA 1NVGA 1FDOA 3B7TA 3MEKA 3DQZA 3FMFA 3IQGX 4DV5B 2I6UA 1OVMA 3SZLA 3LQRA 3A1DA 3I2IA 4JLAA 4UMEA 1G5TA 3QOWA 3SHFA 4LKRA 2ZIGA 1PNQA 2VK1A 3FMIA 4I50B 4HB0A 3IVMA 1W8IA 4B09A 5KOHB 1UCFA 4ZVVA 4G8CA 4JBIA 2ETBA 521PA 2WAMA 1YOVB 1XB2A 3H17A 1VSTA 1XTIA 2PMEA 3QEMA 3O48A 1OI2A 2OSVA 1W581 2XQFA 3HS3A 1OTYA 4R2KA 1ZWLA 3VLDA 3ZCTA 3T5BA 2BY4A 3DAGA 1JWGA 1TTHA 1Q1BA 3CU5A 1HE5A 1XTUA 3HB0A 4JASB 4JOBA 1UOQA 5IY5E 4WA8A 1QH0A 3FOEC 2ILVA 1WTCA 1JXAA 1JPVA 2OO3A 4S0ZA 2G5GX 2QAGC 2BM1A 1S9HA 4WCFA 3ACCA 3PGJA 4Z7QB 2Q7FA 1E7RA 1KH1A 4K7JA 1EM8B 1ZU5A 3W5AA 3T7TA 4MWBA 3SVLA 1Y1RA 1RHMA 4E22A 5H81A 3PEUB 2XRZA 3QLVC 1JEAA 1A7AA 2YUIA 4EHHA 4MS4A 5ECDA 1XZCA 2JFZA 3TPCA 1HEYA 1M8FA 4A6EA 4Z1MA 4LJ9A 1CUEA 5D51S 4FYWA 3SBTB 2CNNA 3GAAA 4O4IF 4X9XA 2Q27A 1MX3A 4MZXA 3V80A 2WXHA 1U3GA 1E89A 5K8TA 5LSAA 1Z2OX 3HXCA 3BH7A 4LCEA 5C1PA 2ZGGA 2FG6C 2OCCE 2IHTA 3EXAA 4IJUA 2AEMA 4M0UA 1QOPB 1ZD1A 3BD7A 4EPWA 1Z16A 3H5TA 3NHKA 1QGUA 1JHUA 2WOOA 5G0SA 1X8JA 4GGPA 2DMRA 2XTJA 2AR0A 3Q3EA 4R3WA 4RF3A 4RZ3A 2R17C 121PA 1OYOA 2LRHA 2JJ8A 3UK6A 3TWRA 3QF4A 3RQSA 1Z0AA 2FEOA 3NOOA 4MQEB 5GM1A 1JQEA 4FR5A 1CFJA 1Z62A 4RQBA 4RTNA 4E2FA 4DCSA 4B3RB 1PJBA 4P7FA 3Q8MA 2RAVA 3FTDA 3O75A 2QUHA 4GZDA 2YJ3A 2COUA 2XE4A 3Q15C 4W9NC 2Q29A 2PGXA 4BQSA 2EKBA 1G7CA 4ZQEA 5JHBA 2CHZA 1VDYA 2C9OA 2YXLA 3LJ3A 1P4RA 3WQRA 3TXMA 4TLEA 1Q20A 4G5FA 3PGLA 1BS1A 3QMPA 4IINA 4KQ2A 5EYPB 5DXFA 5REQB 5AW5A 1DBSA 3SYMA 4B83A 5EJ4A 1TAUA 2QTGA 2FWAA 3ZEIA 2PXHA 1J90A 4WCVA 1CBUA 1ZJZA 3AVTA 2ZSFA 4ZT4A 2AI3A 3EHMA 4WXYB 4GSLA 1U81A 2A9JA 3UHAA 3V1YA 1OILA 3M4YA 3ZE1B 4Q7MB 2YMLA 3E4BA 1CUXA 2Y9PB 3WIBA 1DHTA 4G8KA 4P36A 2ZBPA 2IA5A 3AJ9A 3JUIA 1IPFA 2HJGA 4DLBA 2HPAA 3BQMB 1WRBA 4UARA 1UKEA 1CQJA 5IP5A 2BUBA 2VWPA 4JLDA 2IUEA 1B6GA 1U0JA 1U3DA