1FVHA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
590
structure length
546
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SEC1
total genus 183
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvhA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvhA03
5BV1A 1FVFA 4BX8A 4KMOA 5BV0A 4CCAA 5BUZA 3PUKA 3PUJA 4JEHA 1FVHA 1EPUA 4JEUA 2XHEA 1Y9JA 1MQSA 4JC8A 3C98A 4BX9A
chains in the Genus database with same CATH superfamily
3TLMA 2J3MA 3A1WA 4FMCB 4UC0A 2I76A 4FYWA 2VP9A 1Y1TA 4LPKA 5EXXA 5H83A 5JEDA 3F96A 3LUKA 2H6IA 1QV7A 4I9GA 2CEAA 2XUAA 4CQLA 2FLWA 1W44A 3PIRA 3L4BC 4ND8A 5GADl 3HRAA 4I1SA 2QTCA 3CMMA 3NCHA 3NU1A 2R3SA 1B16A 1RWVA 4Z3DA 3ISTA 2O8DB 2FWJA 2KPOA 1XU4A 3QLTA 1FP6A 1JB1A 2VTEA 1KAQA 3UFBA 5A6VA 5CDSA 2LO6A 4MPRA 2EJTA 1M6NA 4RENA 5FTLA 2CL5A 3V4PB 1G9TA 1Z3XA 4JYMA 5B6PA 2OV3A 4DIOA 1PO7A 4HGOA 5C1DA 1QU3A 3ZYKA 4RNDB 3TLGA 3VTFA 1L1EA 5CT8A 2HO1A 2Q3JA 5JNWA 2QOEA 2ES4A 2C88A 1VJDA 1UC9A 2RGWA 2HIAA 3FCAA 4O63O 2E4UA 2I62A 5GJVC 4FZ5A 3T5TA 3ZDFA 2GN9A 1EINA 1CZHA 5AW1A 4II2A 4P29A 1HK7A 1UINA 3I52A 4NOLA 1GTRA 4QYIB 3N74A 1UMCA 2HAEA 3K1AB 3BB4A 2FVYA 3VNBA 1PZGA 4M54A 4BLVA 1MHTA 4RH3A 1L7RA 1F7VA 4H7DA 1PX0A 2QNRA 3B7GA 4XRGA 1NYQA 1DDOA 3S70A 3TEMA 2RI0A 4NBVA 1L4BA 2C78A 4RZQA 5HA5A 3SX2A 3VR0A 5C0OE 4A1SA 3SHTA 1M6HA 4PDXA 2J3KA 3MTAA 2V4MA 2YWCA 1I1OA 3NWBA 5ILQA 5KYUA 3U81A 2WQHA 2XWBF 4IXWA 1OXSC 4XWGA 3RIHA 1U4OA 2ZYAA 1QHIA 4RIEA 5AM4A 3I4LA 3ME5A 3JAWA 4AG6A 3R24A 1IATA 1KQNA 1DRJA 4US0R 1RQLA 2RAPA 3EU5A 1K8XB 4Z49A 3CUEF 3F3KA 1Z35A 2NTVA 3KT0A 3PNSA 1J8FA 3N1UA 4S0ZA 1BLXB 4AUKA 2BCEA 1A72A 2P6OA 2WHEA 2O8FB 3MKQB 3DDCA 3D4LA 3EVTA 4X7MA 1IXKA 4BX0A 5KU7A 2R6R1 2Q27A 3CK8A 4JENA 3GZ2A 3EDCA 3OOHA 5FOTA 2A9KA 4UHEA 1HKUA 3EBPA 3HCAA 4PNPA 3BMNA 4BV3A 5JQWA 5DSZA 1N0QA 3Q0IA 3L7DA 2FSPA 4JR0A 2WM9A 1PK8A 3KAPA 4X1OA 3FSGA 1NW4A 3AYZB 4CIYA 1NWCA 3NHPA 3Q9UC 2YHAA 1SA0B 1ZLXA 2GRUA 2WT9A 4LIPD 4V0LA 1N6LA 3OI7A 5CJ2A 4E4RA 4F3NA 3UKJA 1JJ7A 2YMMA 2PUAA 4OXQA 1I1HA 1HZZC 2XT6A 1P33A 2EWMA 3HDGA 3PEVA 3R3YA 4IRMA 5JZOA 2ODBA 4UI9J 4LV5B 3HG7A 4TYQA 5TGZA 2GZ2A 1YQEA 3ZNPA 3F2IA 2CFSA 2QGZA 1U2RA 2QVZX 4S0XA 1ZICA 5DP1A 5ADHA 4A3VA 3EF0A 4ZT3A 2PMDA 5C35A 2ZT7A 3FMPB 4OSOA 5AJHA 4IF6A 2AI2A 5HBRA 2WTUA 4OFWA 1XHLA 4ER5A 1TCVA 2RHHA 3DLAA 3DVQX 3IJRA 3UZUA 4ZYUA 1CLUA 1GO2A 4J8YA 1UBGA 1E7YA 2IY9A 2ZYHA 2E4YA 4OJKA 3IUPA 4TS9A 1CC1S 4D8VA 3R7WA 2IYXA 1YA6A 2XXAA 3KSBC 3A3KA 3OC6A 1WQ1R 2PCJA 2HO5A 1HE3A 2QG4A 3F67A 3S1AB 2MT9A 1JLLA 3TR5A 3FTQA 1SOAA 2JD2A 4F46A 4CRWB 4MGZR 4BVLA 3PUIA 3IP9A 3DMPA 2V4HC 4AKTA 3WBJA 4QOJA 2WVJA 2ZBEA 3G8BA 1Y81A 3CNEA 3ANTA 4CV1A 2NLOA 2JBAA 3S40A 4Q0MA 2J31A 4LRQA 2H1VA 3AHDA 3H8SA 3UK7A 5KTTA 2CLEB 5LOVF 3KZKA 3OCCA 2NXCA 4HFNA 2KCKA 2ZZKA 3H8VA 3IJEB 1F6DA 3NONA 2J4CA 2R62A 5TVGA 4ZYLA 4I9CA 3IBYA 2QJWA 3LCJA 3ZV4A 3S81A 2AN5A 2V7WA 3IERA 2R1VB 4O3MA 2NQ2C 1KKUA 1HFAA 1DAEA 2AUMA 1HBJA 4O4JF 5TMEA 3U48A 3KQKA 3LCCA 5MHTA 1IEVA 1SCBA 3AHJA 5F5XA 5B5SA 2RGBA 2BFBB 5AQBA 3PUVA 4D4IA 4LXIA 1MP0A 3TBHA 5JLJA 2WILA 2Y05A 3QMWA 1KNQA 1W85B 2FGKA 4P3YA 4R1LA 5AJXA 5IM4F 4M22A 4RANA 1ZSYA 1LV8A 3D3KA 3IPCA 4HWPA 2DBZA 4PLCA 1QG2A 2AKEA 5HFAA 1O9HA 1UT8A 2AJDA 3KSLA 1HMPA 1M1XB 1Y8MA 4D80A 3I01M 1GGVA 1KQ3A 2D4AA 1P3JA 4F2PA 2ZSUA 4Q1EA 2JAXA 4KVAA 1P31A 1FPQA 1JPUA 1EK6A 3P2OA 1Z6YA 1N77A 5HGXA 2XJ9A 3C3EA 2EF0A 2KBEA 1NBAA 3OH8A 5AI6A 1M7GA 3SZMA 3ZXXA 3O4IA 5I4CA 1DLJA 4LHVA 4PYKA 5IC6A 1NZNA 3BPSA 3DZBA 4UM5A 3S44A 4KKVA 1GNQA 3JXIA 1WUHS 2KJQA 2QZAA 2QZZA 4FGZA 3VPAA 3C72A 1L9XA 2XTMA 3CGHA 4OHVA 4MMXB 2C00A 2HN9A 2WZDA 4B3SB 4EHMA 1KQOA 1RYNA 2D3WA 3QI7A 1M8FA 1KWGA 1OWMA 1CJTC 1KFJB 5G1OA 1EGHA 3ONEA 1HC7A 4Y9UA 4ER0A 5JZ9A 1JTVA 3R9AB 2FR0A 2CMHA 3DE4X 4QUEA 1JN0A 3MQ4A 3GGSA 3P97A 1JDNA 1Z39A 1ZD2P 3PPYA 4V0MA 1XZCA 5AMXA 4A73A 2HGZA 1PR2A 2YVQA 1TM1E 3HCBA 3MJRA 1DAFA 2WJZB 3W4IA 1QUEA 3D6HA 4MRVA 4K9LA 4LYFA 4ACLA 4RKFA 3ZH9B 4CMGA 3DDZX 4HQFA 5ALIA 4DUZB 1EZZA 3RFXA 4DLUA 3HCFA 2O8VA 1HETA 4GLLA 3QE4A 1AF7A 4N65A 5BWLA 1IFXA 3UM0A 4M86A 3V4ZA 5THQA 3DEFA 3DOIA 5LP6A 2ERCA 3CEHA 1V37A 2PEYA 1CR2A 1RLTA 4PZLA 4WWPA 2YWXA 1Y3CE 4PM4A 1HX7A 5C5EA 1QYDA 2ATEA 5E1BA 4Z9XA 4UJ3A 4YRAA 3PE4A 3HJCA 1K9SA 3D9NA 4N47A 1GL7A 1GRQA 1E90A 1XJQA 2JLAA 4OQYA 4RBNA 1YO6A 1WB5A 1AUOA 1GOTA 1N9ZA 3M6XA 2G9RA 1QQ6A 3OJFA 3LJKA 4NULA 5TDHA 4X1KA 4LN1A 4R5MA 4LTMA 4CEMA 5CHEA 3T0GA 1F2DA 3IEVA 1XAHA 2V5FA 2A59A 2EBFX 5LBUA 3RC1A 1EGQA 1Z4IA 2OC4A 3C15C 3RK4A 3ZV5A 1ZJZA 3ASVA 3NETA 4MVJF 4UBMA 2Y8EA 3O9VA 4OXIA 4FX5A 3VDMA 3H4MA 1GYPA 4IF4A 3QA9A 3H9CA 3FHTA 3RC8A 1FYFA 1CIPA 2NVBA 3DMGA 3N05A 5JDIA 4U0ZA 2EJCA 4CEJB 1WZCA 2VHZA 2CBZA 2IXTA 4IOLA 1U5BA 4N0QA 3V34A 1RRCA 1XCLA 1O6GA 4ZK6A 3WP1B 4E09A 1J22A 2UY1A 1SXJC 5JS7A 1BVHA 1C0IA 4BU1A 1N2ZA 1AUXA 5KOHB 1ARZA 2FMFA 2FEKA 4RD1A 5EWJB 1PWYE 1N75A 4KPYA 1CY1A 2NG1A 1KJYA 2OB2A 4BNKA 4XYBA 1FP4B 4U0UA 3EA5A 1H23A 4KPEC 2Z6VA 3H2ZA 2RHMA 3BH6A 4ZYYA 2E9SA 4TVSA 2ZJZA 3PHCA 3AI3A 4X0EA 3DMDA 4K1XA 5BWMA 1Z88A 3GWZA 3JR7A 5A02A 2C3YA 2R6FA 3L08A 1E2GA 4UDYX 4Q02A 2XMSA 1UP7A 2ZCUA 3AF0A 3GRAA 1W49A 3HYTA 5C4GB 4Q96A 1U3CA 1Y98A 4TQGA 1Y1KE 2JIQA 4IH9A 4N0PA 3GX1A 3ZCXA 3QW4B 2FO7A 4G97A 5D86A 3WHIA 3O95A 4TWAA 4Z9AA 3IOMA 3TEFA 3G9QA 5GONF 5IF3A 4KYIB 4UOEA 2BFWA 1KRXA 4Y3UA 1FYEA 3E37A 3EZ9A 3FEXA 1YK1A 1M0EA 1M2NA 2RC6A 5LD2C 3X2QE 4FBGA 4JJFA 4P32A 3STXA 1OA1A 4ZODA 3TRFA 4XEIG 1YH3A 4EHFA 3VKHA 1DUSA 4OHBA 1UBTS 5D3ZA 5AM0A 4MJXA 1YUNA 2ZJFA 4TTPA 4AP6A 2XUKA 4EA8A 3OZAA 1YHNA 3MZ0A 1QWSA 1U28A 1XRSB 4HB4A 3RUAA 1DC6A 3H16A 3B20A 4KIWA 4MLCA 3F7MA 3ZWCA 1EB8A 1U8AA 3HKCA 4FJ1A 3IHKA 1UT6A 3CLSD 3GQBB 4QDXA 3SC2A 4B6EA 2XEEA 3Q3EA 3I8XA 4JFRA 4JUCA 3GLIE 4NJMB 1II8A 3GLHA 4YUYA 3RFVA 1UR5A 1VB5A 3EQ2A 3IGFA 4NRHB 5CMYA 2OSVA 2JJ2A 2ZE7A 3EXFA 3UK1A 1JQAA 4C1NA 4Q69A 4NK4A 1IB0A 1TQDA 1ISSA 1WCYA 3JAWB 3UO8B 4K9MA 3KDAA 3S2UA 4RSMA 2HSEA 4A5OA 1SUSA 4A3SA 1JKJA 2DBYA 3OURA 4KE6A 4YXFA 1PIWA 1PEKE 3DSSA 1M2JA 1RWBA 2QM3A 1ZUNB 2C4UA 3L93A 4TRMA 4FJ2A 4K9DA 5BV2P 3CVXA 1VB3A 2ZISA 3H4TA 4GX2A 1EGMB 1W35A 2WXRA 2FF5A 4O4HA 5G3YA 4XOIA 1F8XA 1X87A 2HU5A 2P0YA 1E1QA 4Q4HB 1VE1A 5DYTA 5ENQD 3GP8A 4BQIA 4M1ZA 1YCHA 3PC4A 4CIVA 5BWOA 2ARKA 2B8JA 2OGZA 5E8RA 1L5LA 3WNBA 4Z3OA 4X1IB 4BUCA 1T43A 3NDPA 3OAAA 2HK6A 1USWA 3GH3A 3Q3VA 4JJGA 5ALFA 4OBBA 3RTCA 2BFEB 2VUSA 3BQ9A 1P3Y1 4S2UA 1A7UA 1J1ZA 1T34A 2ZRMA 2XZPA 1JPJA 2ZRCA 1ZC3A 3AEXA 3FPEA 3H1TA 4NDNE 4QX6A 5HKKA 3KCQA 3PPVA 4RS4A 2ZTVA 3W5SA 4INOA 1QC5B 1OY3D 4DX6D 2QTLA 2XB6A 4YVQC 4JX8A 1R1DA 1WMDA 4JHXA 4JLPA 3U4DA 3HR7A 5FEUA 4EG6A 2Y1XA 3TIFA 1XJ5A 4B4OA 1GA1A 2G9NA 3PXEA 4KIUA 4QFCA 3IKOB 5DSXA 1ENZA 1EHIA 1FLDA 3U64A 5IW8A 3GCDA 2X9GA 1NW6A 4H7IA 5FUQA 1JNYA 4QPJC 1KZGB 4WNAA 4YRMA 5B2FA 2DVWA 4CYMD 3RVKA 3ZG6A 5LU9A 2GT1A 4RV9A 1GAJA 1UDAA 2XNSA 3HZOA 1ONPA 2O7RA 3IODA 5EQFA 1YS7A 4LEIA 4BVFA 1JCRA 1VSTA 2YUIA 4M7PA 3RS5A 4CF5A 2P27A 4NEHB 3PNVA 3KZ1E 1M34A 4O1IA 4ADSG 1AT1A 2DFKB 3BK7A 2XQKA 5F3RA 2FUCA 5HG0A 5CCDA 4YMHA 1Q7TA 7ADHA 1A8IA 2XYQA 1OXMA 2O2IA 2PYIA 3OPQA 4ZC8A 4D8UA 3M4NA 5ALQA 4CR8A 5B1DA 1LD8A 3IEGA 5EWMB 4WLOA 3HLYA 3RM3A 3QIAA 4NAVA 3S68A 3TPZA 4K1LA 2LKDA 4FFPA 2PX3A 5AESA 5HW0A 2IVZA 1ORIA 3S1AA 2QD1A 4DNFA 1TYCA 2WV9A 1ZYUA 2H5LA 5DTIA 2B20A 2VDWA 4GOKA 3TZKA 1X7XB 1DCTA 1YZNA 4KSCA 4KYTA 1K7YA 2GMWA 2YOFA 5JHHB 2DWPA 2HDOA 3AYXB 1P7YA 1E6EA 1HDZA 2J5BA 3FY4A 1JU9A 5LM3A 3DMHA 4DLYA 2GPTA 2PJDA 3C1UA 4IIJB 5FQNA 2P4EA 4BLPA 1H22A 1SZPA 2XZDA 2ZIGA 2N9UA 2IU6A 4EJFA 1ZVVA 4OAPA 4BYGA 3MQFA 3NORA 4HLLA 4P3NA 3UWKA 3N39C 2E5FA 2V5AA 3SHFA 4UXHA 1K8ZB 2DZDA 2QAGB 3A9TA 2GRAA 3QHQA 2CWDA 5B4UA 1NSYA 2A9FA 2QTAA 4O2AB 5FL7A 3WYGA 5CA0B 2BBWA 4ZPXA 2EEZA 1S4QA 1FNNA 1TM2A 2FMIA 4PXAA 4C9BB 1DO0A 5ENVA 1ZSNA 3SZOA 4PHFA 4EHBA 2V54A 5T6BA 1P2BA 3NHFA 1T36A 2Z08A 3GQVA 1L7PA 1ODTC 2ZUTA 3P2BA 1W0JA 4DBLC 4JJAA 4A55A 3I4GA 2Y27A 2JHCA 2QRZA 1L4NA 4OB6A 5E6UB 1G9XA 4J0KA 3REQA 2Q9BA 3CEQA 3UT4A 5IJZA 4XIJA 4RD6A 3FGPA 2RG1A 3J7AC 2BGLA 1OXKB 2QBYA 3CSFA 1X9GA 3LC7O 4R2KA 1X1AA 3UN1A 2O8FA 3VR6D 4MQBA 2FJ0A 4LJ7A 4WLUA 2QVYX 1A2OA 2YIJA 1YMQA 1TX4B 3IHWA 4OTZA 3R7NA 1FCJA 1AKEA 5EXPA 1C7RA 3L1KA 5A6SB 3WLHA 2RBGA 3LWNA 4XPZA 1K88A 3WK6A 2QXYA 5CBOA 2OXFA 3QMVA 3SCZA 4IZ6A 3ABSB 1JECA 3HA3A 5JY6A 3I3NA 3DNMA 1GU1A 3L0OA 821PA 5LZ2A 3OTWA 3HWRA 1AK2A 1GZDA 3AUFA 3IEKA 4JA0A 1OX5A 1QRRA 1T0JB 1BS2A 1T9BA 4R98A 1ID1A 2IYTA 1Y33E 3WGNA 3THYB 3PLRA 4MPJA 2VJPA 5BSHA 3TQTA 1I3LA 5EIHA 5EZ5A 4O3FA 4GI3A 2I2CA 3PE6A 3RU0A 2QYSA 4RFSB 1M1NA 1H2AS 4K5CA 2RGDA 2TMKA 4YNBA 1IMJA 1XQXA 2CW5A 3I58A 2VJMA 2DHEA 4S1NA 1SCKA 5LYJF 4MKTA 2QU7A 4XQ0A 3R44A 4WWOA 5DLDA 3GP5A 4IP0A 5CAEB 3ZDZB 1AA6A 1FUKA 4MW2A 5CG1A 2CCJA 2HPAA 2RHJA 2EG5A 3DZHA 1INZA 1ZA2A 2EFYA 4U96D 2FW9A 4WCFA 4OB7A 4P2GA 3T3MB 3UHAA 4EUFA 2J1LA 1EIZA 5K5EA 4BX9A 3HDXA 1PJRA 1YFKA 3ETJA 3GT0A 2WYOA 4KRYA 4Y6SA 5LX8A 1MVNA 4MUBA 4BX8A 2P90A 4UNQA 2JFVA 4ZOLA 3RTEA 3ZQKA 4B75A 1DP4A 3VLDA 2FF7A 5ECYA 2O05A 3N2EA 4AAYA 5CNMA 1MNQA 3LHIA 3PFCA 1E1QD 2R02A 3CPJB 3MWEA 3RVDA 3SKYA 4DTCA 1F8UA 2G04A 2HRCA 3ET4A 3LH5A 4JJIA 4EYSA 4ZDIA 4JVMA 1T3LA 4U7WA 3GLGB 4DKJA 3GUUA 4DGSA 3V4FA 1TIBA 2BFDA 2BAGA 3IMCA 1O0BA 3VNUA 2PVSA 4JT9A 4NBLA 4XLTA 1MAUA 1O96B 1FDIA 1SCNE 1XEAA 4J90A 3SVTA 1DJMA 1ZIXA 5CMLA 5B3KA 2X6KA 2IZ0A 4D02A 3L8EA 3ORRA 4QWMA 3R5JA 4RULA 2WWYA 3L0SA 3ZW3A 4RPKA 3BZUA 1N92A 4G0WA 1CTQA 3QOUA 1J06A 2BL4A 2IF0A 3KD7A 2CMGA 4TWJA 3C48A 3B9RA 4LNAA 1DJOA 5FBHA 2XKAA 3U16A 4IXDA 1K86A 1Z73A 3IL2A 1ADBA 2GLUA 3ONWA 2VTDA 7ABPA 1Z3YA 4L5YA 1NV8A 2R7NA 5SZJA 1OPXA 3F6PA 2LAHA 1WVGA 3CYFA 2NUBA 5GJBA 3I53A 2OYSA 3N0TA 3OIVA 4RY2A 5EKDA 1B6RA 1E2JA 4DUPA 2C77A 1L4GA 1G3MA 1OPRA 4URZR 5DV9A 4QQNA 4EECA 2ZRJA 3U13A 4TXLA 4F85A 4JGIA 3VJLA 5L4SA 3KD3A 1I6WA 4HRYA 2C9BA 3B7TA 2P7IA 4IDDA 1GITA 4MVJE 4YDQA 5DVZA 1RP1A 3A6ZA 2VVTA 1P0IA 4N12A 2Y93A 1AKWA 4C89A 1J24A 1IYGA 4QKQA 4CDRA 3K6SA 1KT0A 1U7OA 1IHGA 4DNQA 3DB1A 3S8YA 3SNKA 1I7NA 2QM0A 1HRKA 1NG9A 1N2JA 4A0SA 3JQ0A 5AKLA 4F4UA 1WV0A 5I3CA 4Y1RB 2BHSA 4DR5B 1P9LA 2B34A 2BHRA 4MI6A 1IUPA 4BKQA 1X7DA 3H18A 2F8LA 3N2LA 1T8YA 3DDUA 2CNDA 3K9QO 1TEZA 2BF4A 1TNYA 3ML8A 4M76B 2QL6A 2CXTA 2VK8A 3FI9A 4QJ4A 4PV7A 3T7AA 3H42B 1E7UA 5KNBA 4MUIA 1QO0A 4M21A 1R8XA 2AI1A 1HPLA 1O6CA 2YJNA 3D3WA 3FYCA 1LQTA 4J8FA 1W48A 3M1AA 3N0WA 4IZIA 3TXYA 3WGJA 3ULEG 1OLUB 2VUUA 4B17A 4PPFA 2PCLA 3H2GA 3AKZA 1H5QA 3WA7A 4JP5A 2PRSA 2ODAA 3MRVA 4GXQA 2CLHB 4TMWA 3D9QX 3G02A 2QN9A 4P4LA 1AQUA 1SVKA 5J47A 3FTNA 3KU1A 3DSXA 1DC8A 1DDIA 3U17A 2HLNA 1J2TA 3BVPA 3QVUA 2ZIAA 3TLXA 2J7PD 4HAYA 1E79D 3OPYA 1XA4A 2Q6KA 3Q9LA 5EUCA 1QFSA 2HA3A 1UUFA 2XKJE 3OLVA 4RK5A 5L3QB 1ZI8A 2C2MA 1DIGA 3HSKA 4O59O 1PDWA 5AUQA 2X19A 1U63A 5CT5A 1TJPB 5FA5A 1ZCBA 3DBHA 2ZE5A 3NQ41 4PLWA 4WT7A 3F1LA 4ZYZA 4E85A 1PEDA 3GV0A 3A4VA 2FLVA 1OGJA 1RI4A 1TTPB 4RZ2A 1RRKA 4ND1A 3ZWXA 1NUAA 1U98A 4WD3A 4UEJA 3SI5A 2YNMD 3E35A 1FEZA 2QN1A 2DGDA 1MOPA 4FU0A 4LQLA 4B74A 4FHKA 1KR2A 1M34E 1T5DX 3R3VA 2P9SG 5CCEA 1U81A 2ECOA 4GHWA 5DGHA 2YXLA 1WDTA 3NTRA 3ZXUB 2O0HA 4QUAA 2RCYA 1PYDA 5A4MS 3FOZA 4EPWA 4EW6A 1TMYA 2FQXA 4IMRA 4Q39A 1X70A 2HR2A 2GN1A 4BC0A 1QBQA 1JWFA 1XHFA 1NA5A 4B5LA 5J63A 5IFKA 1CY0A 4LG6A 2BBOA 3U4QB 2DR3A 5H70A 2RHRA 3P96A 1RKUA 3MWGA 1UK9A 1OOEA 3I2HA 2ODTX 4FW9A 4YIHA 1II0A 3G2TA 3DWFA 2AJAA 2F1JA 4IDOA 3AHHA 3RV4A 2NUPA 1YDHA 2XMDA 5CB4B 3EVFA 4N76A 4FC7A 1B26A 2ZT6A 3DTVB 2WMNB 1QIIA 2YW2A 3RF6A 3WIUA 2XB9A 4K2AA 2ERYA 3KKQA 4QAJA 1RABA 3I9V6 4GSYA 4RMNA 1OJLA 1W581 3WY9A 4XSHA 4DIMA 4DTIA 1LPOA 3ZU2A 5KDDA 4MYHA 1EUYA 5B58C 3OM9A 2P9KG 5LZ4A 3KAEA 5EMHA 5EXSA 2I65A 2OA0A 3CQGB 1AS3A 4D9HA 4X3PA 1SW6A 3IHYA 1GVNB 2ZS9A 3NVMB 4KQHA 2HLDD 2WTNA 3FMOB 4OOFA 5ED0A 1CWUA 1GEGA 2GJ4A 3E2PA 4M0MA 4MZXA 4AIRA 3U60B 1W4BA 3WXBA 3H65A 3T8MA 1RD4A 3PQ5A 4LHYA 4C7MA 2X41A 1FLAA 5A7DB 3QWPA 5AIBA 2MMCA 2UUBB 4OD0A 4YJ2B 2KATA 1QFJA 1N2CA 3JYPA 3K31A 4G67A 2P69A 3U3ZA 1KY4A 1RRGA 3BQMB 3R8CA 3RT7A 1SKAA 2Z6UA 3G1UA 3BMQB 1V8BA 3K09C 3PF8A 1HFKA 4K26A 1XD9A 1MV8A 3UV7A 4QUJA 4EHLA 5JC1A 4OL9A 3GT7A 5IUJC 2J0SA 3IA2A 3SG0A 2V6JA 4EFKA 1FFCA 1SEPA 2ILTA 2GRLA 3L0ZA 5C1OA 1NPDA 4EPYA 1XELA 4UM9D 4A6DA 3LT2A 3NVDA 3QE2A 4AD8A 4G25A 2Q07A 4UCQA 2REQB 4BP3A 4EZLA 1D7AA 3GOQA 3RYIB 2AB0A 3CSTA 3W3AD 3AP1A 5FLKA 2AFIA 4DSZA 3PRYA 5LYJB 5J2UA 2ZUFA 1VPLA 1Z12A 1CB0A 5G0VA 1LBEA 1DEKA 3C85A 3DE6X 4HVBA 2WR8A 4LRWA 1AS0A 3UVEA 4FA6A 3FTUA 5LDGA 2V55B 4J3NA 1NLZA 2AFRA 4BMPB 2K6GA 4JXXA 4HGRA 1Q0SA 1HZJA 2ZJ0A 3SIRA 2VJQA 2PIAA 1AQLA 1RZ4A 3FCXA 1G60A 1D5WA 2WF8A 4E12A 4IHJA 5SYMA 1SZCA 3DL2A 5P8WA 4FOLA 5AHRA 5FBZA 3ZEIA 2RHTA 4OLBA 1HEIA 1KP9A 2MOKA 2ZJ7A 3UOWA 4C6SA 1SFRA 1V43A 2QRVB 4RABA 4ZEVA 3X43A 1PQUA 1V1MA 2AYZA 4MW0A 4HUQB 5I48A 1HM5A 1YVDA 4OGGA 1R4NB 2DY1A 2FSFA 3PWSA 5EJ6A 3OEYA 3EHRA 3FPHA 5FTNA 2PXHA 3R7FA 4DA7A 1VIMA 3H5WA 3NFRA 3OFNA 1GZHB 1CUJA 4U0SA 2GTPA 2YHIA 4MW7A 5ARBA 2YCLA 2ZE6A 2VQEB 1PP4A 2R8YA 4JJ6A 3ZV6A 3QKYA 4GZ6A 3R3UA 4R1QA 4Z1MD 3D9OA 5JLAA 5C80A 3A36A 3O2NA 1YFZA 2W6QA 1ISPA 2R7LA 2R751 3IV9A 1VHDA 3ZJ5A 2XY4A 1AO0A 1J5EB 4DIEA 2VYNA 3FU3A 1BVRA 3NBXX 3OTIA 5IN4A 1UKYA 1C14A 1FTYA 5JNTA 1P0QA 8AT1A 1WXIA 1YE5A 3CBGA 1UK7A 2VUIB 1JKIA 2ZUCA 1KQPA 1O5IA 4R9VA 3A3YA 5AHWA 1H3NA 1NPYA 1RIFA 1UFOA 2OY0A 3R6LA 4P82A 3V8QA 2IUSA 3I0MA 4WADA 1JIUA 5EEHA 4HNQA 2BFMA 4C4ZA 3FE2A 1SD5A 1O6BA 1KFKB 3CUVA 3DO5A 4Y6GB 4ZA2A 4Z2YA 3IYLW 1SWWA 3M9XA 2G25A 4DLQA 1Y37A 3NEJA 4TKVA 2RG7A 2XNCA 1R5BA 4KL8S 2NXWA 3BXXA 4RVSA 2JABA 4AT1A 2CSXA 3GJ3A 2VHTA 3HVHA 1MZCA 4DXDA 2YJTD 1P80A 5DYIA 4JMLA 1GCGA 3VISA 2HU8A 2M1ZA 1RM5A 3RYCB 2UYCA 4HX5A 2Y1FA 5I7RA 4GI2A 4AY5A 3O0TA 1GPMA 1HLFA 1XKQA 1XQYA 2Y1WA 3A3PA 1JLLB 2A9JA 1Z38A 5LNK6 3AVYA 3O91A 3DOFA 1K5GA 1T5HX 1ZL0A 5DHAA 2IU3A 3WGLA 3T5BA 3TFQA 1HXHA 1IXZA 1YB6A 1RLMA 3F3SA 1RW2A 2B7CA 3FDZB 5BNWA 3QJYA 4RS3A 4J43A 1QH9A 4U2EA 1GGEA 1PEAA 2YWGA 1S8FA 1F2TB 3FNFA 3IQHX 3U9WA 4MUAA 1N6KA 3GWGA 3SLRA 3AEYA 5AM2A 1KEPA 3ZY6A 1BE8A 1ZJ4A 2P9TA 2XEDA 3LGAA 4L7TA 1IZ9A 4KDCA 3B7WA 1KRWA 2PMKA 2W2QA 1FQKA 1JAYA 1E89A 2GFHA 4YMSA 3TKYA 1K7CA 4E5KA 3GPCA 4RDHA 4GP9A 3JVDA 3SBEA 4I3HA 3CK9A 3ES9A 1QGDA 3U7EB 4EHKA 1IJBA 2BDEA 4N18A 4B0ZA 5FFNA 4PS1A 4Q7MB 3C3PA 4MSUA 3O26A 2B5WA 4JUAA 1I2CA 2F9FA 4KB5A 1L4UA 4ZFHA 1LZKA 4KTVE 3ZBUA 5BW5A 1EXVA 1CQXA 4DMMA 4WN3A 2JIBA 2W8BA 5FNVF 4CKBB 4ER3A 2KB0A 3EFEA 1U0TA 1POWA 1H0SA 1GQFA 1WDMA 3T1YB 4JXZA 1ZITA 4I2VA 3RSHA 1R0KA 2OB1A 4KO2S 5JZVA 3FNRA 3VYWA 3L8ZA 2ZATA 1KMCA 1HYBA 2FSGA 2WUFA 4TPKA 1R9JA 5JA4D 2JLRA 4GGPA 1Z25A 3GYZA 4NIKA 1ECBA 1EQ2A 1L4FA 3HDJA 3KQHA 4J1NA 4TUMA 4FSXA 2F59A 2ENUA 4WXEA 3RWOA 4G0OA 5EE3A 3JZAA 3D7MA 4NZPA 5HP4A 2EU8A 5HOQA 1CUFA 1GY8A 1Z26A 4WL0A 5ALXA 4BKOA 1RE1A 3ZNQA 3BXFA 2NO9A 4AV7A 1K4MA 2PX6A 2ZIXA 4L1KA 3LY9A 4HS2A 1XR3A 1T9ZA 3U7QA 4DJJA 5K3FA 2ZAOA 2UXCB 3DMFA 3WDKA 3L4KA 1R4AA 3ENWA 2NWQA 5ALEA 2RD0A 4Z7JA 5GVSA 1Y7TA 5FYQA 1PS0A 3F6QA 3RVPA 5EHIA 4PQYA 5JD5A 4GTTA 2C2GA 4G0XA 1UMBB 2CYCA 4QGSA 3IKTA 3FWYA 4HEA1 5ADWA 3IVRA 2AN9A 3RVSA 3E5HA 4ZCIA 1JUQA 2OHGA 3D3EA 3KEAA 3FHLA 4L8LA 2DM6A 2PZ8A 5HQJA 4DYVA 4B6RA 3PL5A 4RVOA 3HRIA 2HMTA 2RGNA 2I5PO 3EMVA 4BL5A 1XZNA 4E30A 2RIRA 3KLNA 2YZKA 2WC1A 1ZN8A 3T99A 5IBRA 4BMYA 2ZUSA 2C8LA 1L7XA 1USVA 1YR1A 2GN0A 1VHLA 1P7ZA 2WWWA 4LOHA 2NPFA 5JJ5A 1XRPA 4XFDA 1Z5PA 4EYOA 2XDAA 3UEOA 2YOGA 1L5FA 5JARA 5DNEA 2HDHA 3QUQA 3DV0B 4OA8A 2P65A 4YRNA 1LFDB 2Z58A 4I81A 2J0UB 1KEKA 2Q8NA 1Y4DE 4GX0A 3SYLA 4S1VA 4Y18A 4GL4A 3EZ6A 4BLUA 2PRIA 2YHSA 1U8EA 1ZGBA 5A5VA 4GSKA 4URXR 2NX2A 2PSDA 4ALMA 2PFKA 5T8KA 5K0FA 2K7ZA 2VC2B 4ZO9A 2ZS8A 1NMYA 2KI5A 3SVLA 1R37A 2PX0A 3A1DA 4BQNA 3EEFA 3PZ1A 1H2BA 4YJ2F 1NRWA 1J00A 1HOTA 1QCZA 3OCXA 4TTJA 3ZPJA 3TR6A 2O2SA 4DC1A 5LQKA 3I83A 5PGMA 6GPBA 4BUJA 3RREA 4L4UA 1RS0A 4BAZA 4F11A 1GTL1 5AVYA 1YBVA 3WXMA 4YRBA 4ZJUA 3RF7A 2ZWAA 2XS8A 2VCEA 4Q1BA 2WXPA 4IIVA 1E9VA 1W1WA 3CH4B 4V39A 4ZV4A 3SQMA 3QUSA 4YDHB 1K7EB 2HCBA 5JCOA 4HDSB 5CB4A 3ITKA 3MOIA 5BMVF 3MX3A 3KOYA 1I2DA 1ZN9A 3Q5DA 2BRUC 4MPDA 3QVMA 4UNIA 3CMCO 2O7NA 3TUIC 3PSAA 5EFOA 4PAWA 3LQ4A 2JNWA 3UJ9A 1U02A 4CKEA 3RRMB 1GR0A 1XCPA 3COYA 3ZEAA 1I01A 4BZZA 3AHGA 4DMGA 4RQIA 5EJ7A 5IDQA 4OB8A 4RTLA 2K5UA 3DBLA 4O4LB 1R4MB 1GTMA 1VLMA 4LRUA 2FKAA 4LYDA 1I7SB 5LLDA 1FTGA 4B3GA 3PGKA 1LF0A 1DZ3A 1OYVA 1G8KA 1TMKA 1UMCB 2EGUA 2ZANA 3K1AA 3NBMA 4MA5A 4TN5A 3VTKA 3WJ2A 2JZCA 3Q15C 3IIKA 3QX9A 2FZGA 4PHTA 4J0DA 2PGDA 3MEKA 2YXEA 5IS2A 1FSSA 3RIBA 1BHO1 2Z09A 3B6IA 3E27A 3S2FA 3BN3A 1M9NA 1XC7A 4R9SA 1I4TD 2H57A 1P81A 4PPGA 3DKKA 4LRSB 5KQRA 4GZ5A 3W2IA 2YS6A 1R4NA 2ZG6A 4B35A 3MJTA 1FE8A 5A0FA 3CLUD 4AOFA 1CP3A 5BQXA 3DWLG 1FT2A 4JBLA 2XNDA 5JANA 1EFCA 2C7VA 2HHLA 4IUDS 2ZSJA 4IH4A 2A14A 4E3ZA 1ZHOA 1TT7A 1AK9A 1DOHA 2AMJA 3W2EA 2C29D 3ZWVA 1PJAA 2F43B 2CN1A 3QFRA 4ANFA 1NQVA 1WNFA 3A4LA 4RDIA 3QE0A 1KI6A 2PA3A 2ZFUA 2OECA 3MUOA 4W7HA 3RSLA 1YQUA 1RPZA 3IVMA 1G5FA 3WGKA 2OKGA 5JNLA 4WNEA 4MP8A 4OGLA 3WO1A 4A2QA 1L5MA 2JATA 4W9NC 5IMSA 1BW9B 4XAQA 2OHFA 3UK2A 3OJWA 1V48A 3L8DA 2A1UB 3UH0A 2YN4A 4UPEA 5KWSA 2BKVA 2Q5JA 4BWVA 3HJNA 2ONDA 1KO1A 1XQWA 4KITB 2QRKA 1M1NB 1OCCE 2CHVA 1P1BA 2VO1A 2ZVJA 3U9LA 4S1PA 2PRZA 4K40A 5EQJB 4D6YA 1Z45A 2R00C 1JDUA 1F0NA 2ZU0C 2F3SA 2CHGA 2FW7A 1P2SA 2P2LA 4OP2A 4WFKA 5LQMA 4HOTA 3D9KA 1WVIA 1HL3A 1VKRA 4ZU6X 4BC1A 3OT1B 4GA0A 1C7ZA 2I6XA 5EPEA 5CCLA 4N5LA 1GT6A 4WCFB 2OBLA 5J5AA 2L9BA 1PV1A 3O4ZA 2D7JA 2I2FA 3GEIA 2FEOA 3ZOKA 4F3KA 5EMMA 4OHXA 2XXAB 5IJXA 2BSAA 3BJZA 4KE7A 4BNLA 1E6LA 4DW8A 2IEYA 3BILA 4D98A 3TMKA 5A6SA 4OYHA 4G6ZA 1KZHA 1BDJA 1PR5A 2RHCA 5AW2A 5KMGA 2Q9CA 3E9CA 4KX3A 2XQIA 3VR4D 3D8NA 4QHSA 3OZVA 2AR0A 5DBFA 4MTLA 2EJUA 1HUQA 4EHNA 3OM8A 3R75A 4DMRA 2G76A 3GCZA 1V2GA 3JPWA 4XVHA 1U94A 5BN5B 3NBUA 4HUQA 1ZCAA 2QYUA 5E6SB 5EGNA 1TL7C 2HJWA 4RZHA 4W9MC 1Q6ZA 5A0TA 3F5SA 3LBFA 2IP1A 4UAVA 3CQ9A 1DMRA 2R60A 3GI1A 3EIWA 4Q37A 4XEUA 1NQXA 4R6WA 4MA0A 5KTOA 3ZE9A 1EVZA 2NUPB 1B23P 421PA 4C3ZA 4DREA 3G1TA 5AT1A 3ADBA 4YDWA 4QOEA 4KGDA 3FRIA 2XGGA 1YRQA 1VPEA 3OQOA 3UV6A 3N8GA 5E2BA 3ANYB 1WMFA 2VAXA 2FZ4A 2Q4EA 2QSJA 2W58A 3G79A 3AW8A 2Q1YA 5B4TA 5DP2A 5JHGB 5HIJA 2MSKA 1TJNA 2IHBA 3OJEA 3GLFA 3DR5A 2QTWB 4O4JB 3ZHZA 1WXGA 2VF5X 3R77A 5A7FA 2GM9A 2G8LA 2PM8A 1XJ0A 3HB7A 1IAQA 3HYLA 4C4SA 2Y6VA 1H4QA 4KXKB 1D8DA 3SF4A 2ZIFA 2XT0A 2PBZA 1XAJA 3GBPA 1EE9A 4D41A 2BKEA 3P5SA 5A4AA 3QTLA 1X8XA 2I87A 5M29A 1Y3BE 3LCUA 3DDHA 1AV7A 2BFPA 3AUSA 3IBCA 2ZIWB 1LDEA 4R1SA 2HJVA 2SCUA 5TQ2A 2CMFA 2JDIA 1QHGA 3EASA 1B74A 3OD5A 3WYCA 4GTMA 2H0RA 4Q7KA 5E95A 3ZGQA 3IR5A 4M88A 2OV6A 3QWIA 2ZWMA 1YB1A 4G65A 4N5NA 3TB6A 5C1PA 1N2GA 3IB6A 1XVTA 1JLRA 2GRPB 1LEHA 1USKA 3FNIA 1N52A 3OQIA 1NI1A 4ABNA 2ZBQA 4L4YA 5D00A 4Q9NA 1B93A 2V4ZA 2XVYA 1I24A 1W2GA 5DI3A 3VAAA 3ZX5A 4JJEA 2IPAB 3FKJA 4HR7A 1KK3A 2A84A 4WK0B 3SGLA 2P9YA 5KWDA 3CPHA 4Z5XA 3S7ZA 1F14A 3EE6A 3SSAA 2WF5A 4L8YA 2AWIA 1I6KA 5EMLA 5F2KA 3KSRA 1EX6A 3LLUA 1KI9A 4I4IA 3LNTA 4G36A 3VDXA 1XPRA 2FRDC 4OFBA 4RVGA 1SXJE 4HAZA 1XAIA 2X9LA 5FBKA 3Q3GE 3RJZA 4ACAA 3QVSA 4HDRB 1GZ4A 3UANA 1U0LA 3G9TA 3H11A 3HWX1 3WYAA 1O54A 2CFZA 4IBOA 3LEWA 3HJUA 2ZR0A 1H1DA 5E8JA 1CT9A 3TXAA 3HE3A 1B0ZA 3ANLA 4C2AA 5IWCA 3U37A 3M5CA 1PZFA 4QFMA 1P5JA 3O75A 3PEFA 4P4UA 4ETIA 2EFJA 3ASGA 4OATA 3FDHA 1PQPA 4J49A 2PS0A 3H5VA 1BCRA 3D8BA 5D5QA 1LXCA 2QQFA 5K3BA 3WGOA 1XK6A 4HI8A 3L3BA 4MX8A 4NFSA 3P4YA 2DTEA 2OD2A 3D6NB 2PZJA 5CJPA 4H4EA 1GZ5A 4U7TB 1KAMA 1U0HC 4F5DA 4MYTA 5KEIA 2IPMA 5FBVB 1BHSA 3AY7A 1VP3A 4A6XA 2PANA 2C7BA 2CJPA 5ALMA 3ZDRA 1NASA 4K0RA 1VYTA 3GJ5A 4TMFA 4Y7CA 1C2YA 2M63A 1GUAA 1KFBB 2XMBA 3AM4A 3DFFA 1JWGA 5EIBE 1UPXA 4AZWA 1VCIA 4ARAA 5FDFA 3ZLUA 5FT9A 4WOPA 3UCEA 4TV9F 1C81A 3GP3A 3V1KA 4J75A 2HK9A 1Y4SA 2CLOB 4EP1A 3ETDA 2FX3A 2DUJA 2ZB4A 3EAFA 1C0PA 3LCAA 3NFYA 1YC2A 4G8DA 4KQWA 1FTWA 2EIME 1Z9BA 3C6XA 1KK0A 3P9IA 5CH5A 3RR2A 4U9UA 3HUDA 2X6TA 1Z15A 3RTBA 4D26A 4H3VA 4TYWA 3H1BA 1PR6A 3K6JA 3JTEA 3RYFB 4RPLA 5MN5A 2HBZA 1QFYA 1U2QA 4AVXA 5IASA 3AIMA 4M55A 3D7NA 4E6EA 3D59A 2AG6A 4ZO7A 1QKIA 1MKYA 1UPBA 1CRWG 3LBYA 1GYQA 4GI5A 4PRLA 4AF6A 3GAFA 2O2GA 4EQZA 1EVYA 4JA9A 4KR2A 2C2WA 2CJXA 2QN6A 2DC1A 4WLVA 5F4ZA 3X1MA 5CVTA 3A26A 5LQRA 1YA0A 1YS9A 3W3ZB 2B1QA 1IG0A 3VI3B 2EFEB 4DDTA 2VP0A 4Z9BA 1ISFA 1N2CE 2FW1A 2PUHA 3EYWA 4M0UA 5JZBA 1SUDA 1M1YA 2JFWA 1SGWA 2OAQ1 1XF9A 1U2VG 1HXIA 1B00A 4I19A 4YIKA 4XVCA 5B64A 1A2QA 2WPVA 1I4LD 2LIPA 3B13A 3DV0A 3T4PA 3WMRA 3ZGLA 4DR4B 2OM6A 1ECFA 4U3JB 1O9BA 1QQ5A 1RHKA 4QBFA 2HRDA 4KQXA 3RI3A 1UFQA 1D8AA 1QMGA 2POCA 2VP4A 3S2YA 4EM6A 1CETA 4XIGS 2C99A 1YBFA 4OV6B 4KK3A 1LF8A 5ESXA 1U9CA 4K05A 4NYMR 2JJYA 3AEKB 2AFIE 2I3DA 3ZZNA 5BORA 1K6JA 5BUCA 1JVNA 2O1EA 2BR3A 1CVIA 2YYSA 1IVYA 2ZB3A 3C3CA 3QVLA 2CG3A 2PPLA 4RHCA 1XJCA 2GEDA 3I6ZA 2X9VA 1UBMS 5CHYA 1HDXA 4R3WA 1VBKA 1E3SA 2BGJA 3CWCA 3MHPA 4W1RA 2VF8A 2OXEA 3F9IA 4KVZA 5J1SB 1PFQA 2F48A 3FN4A 1TXGA 4FGKA 1J70A 1KOFA 3ZV3A 2Y99A 4RU1A 1N4SA 3LU1A 3TWOA 2B3DA 3K8QA 2IH2A 1U2ZA 2PM7A 2NT4A 3QU9A 1K8YB 5IBCA 1N2IA 2ZCVA 3OD1A 2VNAA 4XQCA 4B81A 4LXUA 4CTJA 4MDEA 4NQRA 3EXAA 4MUYA 3ML9A 1JWLA 4NCXA 1KQGA 4MV4A 2FEXA 3AERA 2QBYB 2QNBA 3GFQA 1FW8A 4R05A 2NZ8A 3W1WA 3JWHA 2PFSA 4KFRA 4WAUA 3IKVA 2ODWA 1U5AA 3GIDA 5IHPA 4E22A 5IJWA 2O3UA 3BWCA 3E23A 3FLAA 4DT1A 3QIVA 2FRDA 5GGXA 4LCBA 1YFLA 2EHJA 5ES3A 2V5VA 3OIYA 4RVBA 3AHFA 3QBTA 2PSJA 4P81A 4Z51A 3KAKA 4OHFA 2WKWA 3D8SA 1EKXA 1LW6E 3D02A 4BMXA 2H1OA 3JSXA 4IIJF 1F8YA 3OZEA 1LNSA 4R2HA 5BY2A 5HNKA 4KWIA 5FL3A 3B9PA 4RKQA 4B84A 1SG9A 2ID7A 4TRRA 4BJ3A 2BMAA 1A7KA 1JG3A 2OAGA 5CNKA 3H0KA 3GLTA 1NN0A 4GPZA 4NESA 2QGNA 2QN7A 1P6XA 4M1SA 3K70D 2G5TA 3EODA 3THXA 2PL1A 4X8OA 3CVVA 4ASUA 4E5NA 5BN4A 3ASOE 3K2EA 1CUCA 4ZIRB 3NIGB 2WVAA 1GTZA 1TYBE 3KSZO 3M9WA 3M6MD 1KQFA 1Z5OA 4PTZA 3A2NA 2HADA 1ZD4A 3TI9A 1EWTA 1F2TA 2XVAA 3B60A 1OT3A 4B9EA 1W94A 3OT4A 1U8XX 1JH9A 1RE0A 3DWGA 2WDPA 5T3YA 1W7AA 1U3DA 4IIDA 1LPPA 4WCFC 3UCXA 3CVOA 2PJZA 1THZA 2RGNC 4MV1A 4XPIA 1OLSB 2XF2A 3SR0A 3CKYA 3TQOA 2GJSA 3RASA 3TK1A 3VJRA 2RGYA 4N01A 3VYRB 2EDAA 2NO7A 2B98A 3WLIA 5E7JA 1QHXA 1T0HB 3WK8A 1P4JA 3UC5A 3DG9A 3K72B 2WIFA 4RPCA 4OVVA 1PE0A 1VRVA 4UBIA 3L5OA 2WE7A 3BD7A 5JDCC 1U3VA 3D2BA 2Q50A 3K73O 2HL6A 2YZMA 5DHUA 2O07A 2OR3A 4REOA 4C0QC 3FTWA 4BS9A 1S3IA 2XE6A 4YP0A 4EKYA 1K1BA 5ELXA 4BVGA 1AKUA 4F06A 2H16A 1ZIPA 5JI2E 1VOTA 2GLXA 4S3MA 1U8YA 2ERXA 1U28C 4AX8A 5CB8A 2JG3A 2Y0DA 1I14A 4BGDA 1FBNA 3GMTA 4ZVRA 4P35A 1N4QA 4OLFA 1FFEA 2ZBGA 5CIYA 2RMKA 3SC3A 3HNRA 1ZK1A 2ZBVA 1NYRA 1TF5A 3KT6A 1SD1A 3CM0A 2Y0BA 3H05A 4BLQA 3PXXA 5CPBA 4ND4A 1EWQA 1PR3A 4ZJZA 1Z36A 2AOTB 2WSLA 1GUBA 3ZRHA 1Y3FE 2FG7C 3VNSA 5B2EA 4PSKA 3L02A 3M2TA 1G4UR 4PPYA 5LXTF 1ONBA 3NAQA 3FU6A 2G28A 2CF6A 5C7YA 3LCMA 4P92A 4OGWA 4ARIA 2ZI5A 3DMTA 1VL2A 1WBJB 3UKUG 1OYWA 3VAZA 3H84A 4HN2A 1I1QB 4TLEA 3NNDA 2G6TA 4LMAA 2IU1A 2JD0A 2AXUA 2Q62A 2WU8A 4EVIA 3ANXA 3OIGA 2XSZD 1D2RA 1HZZA 4GX1A 4PYNA 5G05C 5D2MC 4ZT7A 4B1FA 4KQKA 4TXRA 1XHEA 1RXVA 2G06A 3PZ4A 3BGWA 3CURA 1ZK4A 3QKSB 2XYVA 3NBFA 1PV2A 2H2FA 3LY5A 4BJ6A 3GEDA 3TGLA 3KIPA 4LWOA 4WKBA 2DPXA 5HIAA 4OQPA 3OTOB 3P1JA 4BRZA 1P45A 4IAOA 2CZCA 1T0PA 2FEMA 4MKHA 1R12A 3EXHB 1B8VA 1BN6A 5B1BE 1KTIA 5CLHA 1DIHA 5DHRA 4MP6A 5IN5A 3NJRA 1JFLA 1XZAA 3DUFB 4Q1DA 1NE7A 4REQA 3E33A 1GWNA 4JB8P 4PG4A 1R6TA 2P8SA 5FI0B 1X7WA 3BCHA 4IJKA 4TXJA 2IONA 3DDSA 3GJRA 3HSSA 1GPWB 3WLSA 4G0VA 5CYGA 1WWKA 2VAVA 5AKIA 4J29A 3LF1A 1WIWA 1FPPA 4U04A 2AI3A 2IOSA 2R9VA 3GHHA 1IU9A 3SIXA 5JO0A 2WG0A 3MINA 4CCYB 5HIKA 1HT3A 3KE9A 4FOOA 3QJGA 4N7BA 1CUIA 1Q91A 2FUG1 3JQ9C 5FV7A 1X8JA 4BKPA 1EX9A 1X86B 2MYUA 2G40A 4DJ5X 2VRCA 2YQ8A 1K89A 2G9QA 3CCBA 3H5NA 4PRYA 3KUDA 3WK5A 5G53C 4A92A 1JHOA 1RI5A 4PO3X 5FP0A 4WZAE 4NURA 3TDMA 3WB9A 1A9QA 2YC4C 4CTOA 1ZW1A 2FE4A 4F84A 5BR7A 1MD9A 1W9MA 2WIGA 2IGTA 4I1MA 4E32A 1A04A 3WNDA 3MJ4A 2KWIA 4XYMA 1DKOA 1DO2A 1O58A 3C7DB 3RKRA 3IDOA 2NZUG 2I4MA 4NXNB 5GY7A 1DWOA 3BRWA 3HU1A 4YHBA 2Q1XA 1L5RA 3BXOA 3UW3A 1L3CA 5KDOA 2RH5A 3HUEA 3PQEA 4KOAA 4ZVOA 1NYTA 5KYGA 2WAAA 3MS7A 4Z2AA 1ONSA 3W5BA 3QBVA 2WICA 1NVVR 5ITZA 5JJTA 1JIVA 4GEKA 4UZSA 2K7FA 3A1TA 4XWAA 4JN6B 3FAKA 4PTYA 2Q3BA 3F1KA 3JY6A 1JVBA 2VXOA 1X7WB 2BRUA 4N7JA 4CVNA 1NMXA 3ILVA 4UHDA 2SCUB 2GEBA 3EQZA 1F20A 2EZ8A 5AENA 3ZK9A 1H2TC 3EMBA 3CF6R 1NATA 1U6IA 3FJ1A 1G19A 1KZ4A 4EYQA 2WXHA 1OFTA 4C7XA 3L8FA 3A1VA 5LUBA 1GQOA 4YRSA 3Q47B 3ZHEA 3A2MA 2IBSA 2LCIA 4BYMA 4UVHA 3EZGA 4MCJA 4DVJA 2C8VA 2PY6A 3A2KA 1NZFA 3OIDA 3RYHB 4TXPA 2I1KA 3ZBQA 2Y1DA 2ZWPA 3H9EO 1TRHA 2P9QA 3D2CA 4JCCA 4CXMA 3U3MA 2WJVA 3OEHD 1QH8B 3EVEA 2J9QA 4MQ6A 2FFAA 2WUWE 3VNVA 4CM4B 2ZPAA 4JNKA 2OCBA 3E18A 3BEOA 3NC1C 3JQAA 4WZAA 5KREA 3K8YA 4Q7JB 3SBOA 4F7WA 4AW9A 3MS2A 3P32A 1JMYA 4U8VD 2WIKA 4I1IA 4E15A 3TWWA 4Q7EA 4EW1A 2FK7A 4PWYA 4R3UC 4AY6A 2CBGA 2KYRA 3QYFA 2UVQA 1ZX1A 4UQPA 1M8KA 1Y82A 3DAFA 3JYQA 3PZ3A 3QBJA 1O0SA 4O6VA 4YCJA 3I5YA 4KNYA 2PFGA 4HY3A 4PXYA 3T15A 4LWQA 1ZSVA 2JLQA 5FR1A 1P1KA 4ESEA 4UXIA 3Q73A 4XKCA 3K09A 3GZ4A 3KL4A 1G5TA 5EWLB 4YV7A 3KUCA 1V3UA 2YS7A 5BOVA 1JXAA 3WQRA 2P30A 3KXDA 3I62A 4J0HA 5JAIA 1E2FA 4J1SA 1SU6A 2P5SA 3EVCA 5KVCA 1E58A 3EIUA 1DT3A 1LSSA 1H19A 3K0FB 5COQA 4DDHA 4EL0A 3VZRA 2V7PA 1C3OB 2B92A 1T2NA 4HNRA 4ILKA 4NICA 1ZD5A 4I1OA 2H1LA 3STVA 1KEEA 1EZ4A 4EFDA 5DWQA 5HJ2A 5AVWA 4M9RA 4LY0A 5BPFA 3HJGA 3FUDA 4U3JA 3GBSA 4F0JA 2X3MA 3S7JA 1I30A 3NBKA 4YWHA 1KHTA 1J7KA 4EF6A 1G21B 2C9CA 4PO9A 1E6KA 4WEQA 3PHHA 4BFVA 5H81A 1E60A 2KMLA 2NADA 1L4EA 4N3BA 1B41A 1TK9A 3OETA 4NZOA 4CKCB 3H11B 1XMQB 3LBAA 2B0CA 4M1TA 3NOQA 1KJZA 4HLDA 1SQ0A 5EP4A 2NO5A 4XGQA 4QDJA 4B9AA 4OHCA 2XCOA 4EAQA 2R44A 1SG0A 4L3OA 5KOHA 3ROTA 1DBRA 2OC9A 2BJWA 3P2EA 4UI9K 5H02A 4U63A 4LQCA 3R0JA 3A9VA 1SXGA 4N3AA 1BCRB 3FCSB 1VSUA 5EJ2A 4ZOCA 2PUGA 3G2WA 3AFGA 1TRKA 4FEGA 3U7HB 2NSHA 4PO8A 2O6LA 1E4VA 3HBLA 4FLHA 3LM8A 5JSZB 5LQNA 3U6BA 2QRVA 1YQWA 1P60A 2QN2A 3V2OA 3P9YA 4G4GA 3PCRB 3C4QA 1I0ZA 3USES 3ZQ4A 4D9KA 1Z06A 4WIAA 5FQOA 4CTMA 3UYLA 2ZVDA 2H6GA 3HKBB 1I2ZA 1QIDA 2PDAA 4Y9RA 1JZSA 3FGOA 5ITZF 3L92A 5F7OA 1ZZEA 2OOSA 1TQ6A 3ZZ0A 5JO9A 1G8SA 4BO2A 2DX7A 5A6CA 1ZM4A 4UHKA 4DLZA 1P7PA 5F7XA 3FPFA 3GLKA 1RBMA 4KMMA 3JVUA 3LY7A 2DF8A 3PRJA 4UUBA 5T4HA 5CFLA 3L7KA 1T3HA 4PX9A 3RKVA 5FCDA 5A3JA 2GCEA 8GPBA 3R0IA 4MI3A 4BV9A 2IHNA 1R0CA 1YIOA 4LZLA 1I7DA 1NLUA 2HA5A 4ABYA 4F56A 3THSA 2XCTB 2JAOA 2P9EA 2UU9B 3GZTB 2IHJA 1MOSA 4QBGB 5HE8A 5TS2A 2OE2A 1DJPA 4F04A 4YUAA 1KLXA 3WZLA 4IULA 3CW8X 4I9HA 4AJ1A 1A1VA 5D2CA 4XOUA 2MCFA 3E4CA 2C5HA 4F1KA 3PUYA 2ON6A 3SBTB 3QWVA 5EPUA 2ZRIA 1UMDA 3GFBA 4LSZA 5IM4A 3OQJA 3DTVA 4UVGA 3NM6B 1AD2A 1JBKA 4WSOA 4NACA 1QP7A 3RK1A 3KQUA 1GD1O 1RYBA 3DE1X 1RJDA 3ZN3A 2HNBA 3ASZA 2YZ2A 4Y1EA 3N6RA 2R59A 1KKMA 4CTKA 4M8NE 3AVUA 4IS3A 2I3GA 4Q7LA 1PVOA 2V9CA 2QPAA 3P7MA 1S01A 1CUZA 2ZSDA 1BXRA 2OCGA 4HNSA 3VZDA 1W4CA 4B4DA 4DA8A 2VPIA 3NHWA 5A03A 1IWPB 1I2MA 1T1IA 2BISA 2VJCA 3O1LA 4I8DA 1W29A 2CKDA 1JCQA 2MINB 1GARA 1T9DA 1G8GA 1JPNA 4OH7A 1U8TA 3G88A 3W5JA 1OCZE 2P6RA 3Q98A 2V7GA 1DAPA 3BTOA 2C9DA 2GHQA 3CNNA 3LC0A 4PHHA 1F8FA 4CN9A 1TZMA 4CI0B 3BUAA 2ZM5A 2JRCA 5I3ZA 1BWSA 3TMYA 1N2EA 4TVKA 4YREA 1D2CA 2V8OA 4YFVA 1IY9A 4L73A 2QAGA 2V9PA 4E5VA 2JH9A 3FPKA 2A0WA 2JRLA 3DONA 3VI4B 4ZTBA 4C22A 3G82C 5DN6D 1PBTA 1S2MA 3ON5A 4LMBA 4WKGA 3LQQA 1YRAA 2LTAA 2DTXA 3VU3A 2W2LD 2GD1O 4EA7A 1ZEMA 4WESA 2VBCA 5JS1A 3M0EA 2WAMA 2XYRA 1CUAA 2XIQA 4YWJA 4FNOA 1YZFA 2UZ1A 2F3PA 4MGIR 1G1AA 1FDWA 3K9BA 4NMWA 4YCMA 2AZDA 1SAYA 2GAJA 1IBKB 3AUYA 1Q21A 3K5PA 4H0FA 5CM9C 3E1SA 2PGXA 3T95A 3O31A 1N5JA 2ECFA 3QQPA 2YWRA 4HJRA 1EK1A 4OHKA 3VSBA 3GRFA 3O82A 4RKRA 5AKXA 1UKEA 2A5JA 3N2ZB 1RBZA 4YR7A 2EJWA 1S4MA 2H59A 1A8UA 1N9GA 4ZGWA 5BURA 3U56A 1NR1A 3A6EA 3V8RA 2KBFA 3VQTA 4EYGA 1I9GA 4IH1A 2ZGDA 3CE6A 1PCXA 3FCYA 5B1EA 5DX0A 4KODA 2HE0A 2C2ZA 2GERA 4PUCA 4KR3A 1T25A 4X97A 1QGUA 2NZJA 5K0NA 3W90A 4KQ2A 4L5CA 5CU7A 4M98A 5DCYA 4LJ9A 4CQLB 4KQ9A 1L7NA 1ZH6A 4HAWA 2CHWA 4QO7A 4RMHA 3U4QA 4ANVA 5GONB 2H92A 2ZQYA 4DADA 4DLTA 3GRPA 2G5CA 4Q3CA 4RA9B 2IF2A 5ADUS 4WJZA 3RSQA 1BROA 2CXXA 4ZO6A 1D1PA 2OLEA 3UOGA 1T1JA 4LDPA 1IY1A 2JHAA 2WABA 1QB8A 1R9NA 4LC9A 5E76A 1HORA 2EQ5A 4MARA 4PINA 3VTXA 4TTVA 5AXDA 1WU7A 3FM9A 1U3TA 2OP0A 3KFXA 1JQ5A 2JKZA 4X9XA 3P9KA 5DH9A 3FW1A 3AW9A 1U7UA 4ZCSA 1IEWA 1Z6GA 3PREA 3VH3A 3W7BA 3D3JA 3O3CA 2DUUA 4HXFB 3UUWA 1JV2B 4HB0A 4WZ6A 3T5CA 1OH7A 2FEPA 3PNMA 5ALWA 1DBSA 2WYIA 4ZOLB 1Q19A 4N8EA 4EABA 2A4MA 1Y3IA 3KQLA 2M6LA 2PX4A 3TLBA 3RQSA 1PFYA 3IDQA 5CP8A 3TXNA 4OQZA 1GCIA 1XU9A 5DNDA 2VPTA 3QGMA 2EZUA 4DAOA 5J4HA 2JI7A 2QJFA 5G2NA 2FK8A 3WJAA 1PW5A 4DUYB 2OT3B 3DBHB 3KCNA 3I9OA 1LBIA 2V3CC 5KTMA 1GT91 5CHEE 1MAWA 2B1GA 2V1XA 2VDOB 4ZAGA 3W8DA 1QKJA 1KI7A 3KQVA 4F5EA 2WSBA 4K9KA 5EWLA 5JSZA 2J09A 3C39A 1KO5A 3DFIA 1Z22A 3O8QA 2A5EA 2CL6X 1SVOA 3VSCA 3ETNA 4EHDA 2DYRE 2E2EA 2QR5A 4J8PA 3V8MA 2RAFA 4B82A 2XEXA 4FOPA 5CVVA 2BZ1A 3PENA 2C58A 3BDIA 4QIHA 5GONA 3IDAA 1LFAA 4C06A 4Q4JA 1YCSB 2QAJA 3NATA 4NPAA 4CR6A 4EUSA 2DFLA 3B7RL 2P2ZA 2I2DA 2Q8QA 4NFLA 3I5PA 3LUPA 1GADO 3EUFA 3LKZA 1E6MA 2OBFA 3DBRB 3FKSA 1PC2A 3F7OA 3G13A 2ZRGA 4JR2A 3BHJA 4RVCA 4Z99A 3CLVA 1M75A 3J80A 1SVMA 2D5LA 1G6OA 4U5XA 4OAVB 1GAXA 3ROPA 3MJEA 2C3MA 2UDPA 1NM5C 2NXPA 4MCIA 5JISA 3U7GA 4G56A 1HRDA 5M7EA 3AQIA 2X8LA 3OLCX 1P6UA 3E9RA 3WJ7A 3WSWA 3PH0C 1DBIA 5ALUA 3C3KA 2BM1A 2PSHA 5A3SA 2WUGA 3E53A 4CUZA 2RKKA 4D9IA 2V98A 3NHZA 2H2DA 3WHPA 4DNPA 1D0SA 5ALYA 4ZQFA 3D0QA 4TVOA 3DSRA 3N71A 2PH7A 4JHRA 1P2GA 3WLLA 1EEHA 2G7MC 2QT1A 2AEEA 4AJIA 4F1JA 3DSVA 4OA5A 1GJRA 4C14A 4AJOA 1Y3AA 4HQDA 2B2NA 2BI7A 1E7QA 1XTVA 3WYBA 1UWLA 2BY4A 4BBJA 4LRYA 4DC0A 1TYZA 3D54D 4JYCA 3KZOA 3QTTA 1RADA 2YZ7A 1EAYA 3FZYA 2WWIA 5D84A 4DQVA 1GPUA 5CBPB 5ITZB 4P7BA 4KQJA 1KYIA 1L5HA 3ROZA 3L7YA 1Z8NA 5IAKA 4EELA 1W36B 2BBSA 2BGKA 2LP4Y 2DJIA 4MGYR 4Q3EA 5DSTA 3K96A 3FTCA 4EW2A 1DOZA 1DPGA 2OWEA 3SOZA 3IBSA 4GVXA 2H1RA 2Q5OA 1HNZB 3FLEA 2B4TO 2EHDA 3AKEA 4N48A 3WBFA 4CF4A 1A7AA 4B3JA 3SY2A 1N8SA 3V4LA 1T0BA 1XVAA 1X8LA 3U19A 4YUWA 1KERA 2ECQA 3MCWA 2BGNA 2GJ8A 1ULAA 4RDCA 5T5QA 1M6YA 1IRIA 2JFGA 2W2MA 4NRDA 4HBZA 5F12A 4Q94A 2JFFA 4JI0B 1VA4A 2W83A 4TMKA 2XADA 2E6KA 2YDYA 1RM3A 5C1IA 1BMFD 5KNDD 4FS8A 4TMXA 2GD0A 5GIOE 2CUKA 1EMDA 2EVWX 5ALKA 1YR7A 3AOEA 2HA2A 3HDVA 4A03A 1UMDB 1CUDA 4ZCRA 3AJAA 5I9BA 4IGAA 2J3EA 4MGEA 2G09A 2JJ1D 3DYVA 4C6RA 4G1FA 1NW3A 1P2FA 4M53A 3FMGA 4KPUB 3QVVA 1W34A 3EGVA 4LDQA 4X8LA 3LV8A 4N1AA 4I50F 4QU5A 3WNCA 2QTZA 3FH5A 2PU7A 2YY5A 3H2HA 1H69A 4P86A 2B8EA 1P61B 5TGTA 4F2GA 1JB9A 3HFJA 3MG9A 2VHCA 3QVXA 5JT1A 1WXXA 1GTSA 4HO1X 1X1SA 3QNWA 1WP4A 2I1LA 3C24A 3MOGA 2ZJBA 1FNSA 3JS5A 4WEOA 5E6RB 2A5GA 1E3MA 2KZTB 3UG6A 5KQSA 5C4MA 4CIWA 3B8HA 4NABA 1LTHR 3AF2A 2ZAIA 1K3UB 3V6MA 4CGVA 2YWBA 1ENYA 2VCHA 1ZN2A 1UK8A 2X2OA 2JK1A 3MYYA 3PCTA 5LQUA 4Z0HO 1FUYB 3KFVA 4FKZA 3DLIA 1GDTA 3D6AA 2PKXA 3EIEA 3TRJA 4D9CA 3LS8A 4JUFA 1DDGA 3LUDA 3QYPA 5CK5A 4O8ZA 3FSGD 1BMDA 3JQRA 1WY5A 3PUXA 5T6MA 1PT6A 5KNCA 3Q7QA 4HAIA 2A78A 2IEDA 3AB3A 4QEKA 1DELA 2NXJA 3UJ3X 5AVSA 1LA2A 2WSSA 5U4QA 5H7PA 1SPBS 3SIPA 2F1OA 2B61A 3REOA 4EJ6A 4N6GA 3MWDB 4HQNA 2PUEA 2TSYB 3V00A 3EIOA 3AR6A 2GPYA 4J03A 3U0BA 3TR0A 3SFYA 3KQSA 2E55A 3MVEA 1S0PA 2IO3C 3RVRA 4DJAA 3ENNA 3IA7A 4AMUA 2Q3FA 3DBLB 3ID6C 3PZDA 1OROA 4IXMA 2NZXA 5BSFA 5KX5B 3DGEC 2VPXA 4X64B 5JXGA 2G9ZA 3PXDA 3P0RA 4BV8A 4QSMA 1N5IA 1ZVJA 1HEYA 5AOCA 5BR4A 4O1OA 1MV5A 1O5MA 2JAPA 4KO4S 1E4YA 2FV8A 4QGBA 1Z6XA 2JLYA 1KZ7B 3HJHA 2ISQA 1CNEA 1D1QA 3GFTA 4PE5B 5BVHB 1E4EA 4EY8A 4KP7A 1IXVA 4HTFB 4Q66C 3W6PA 4IDQA 3ZV7A 3D8UA 2GHIA 3E9DA 4L9WA 1WZ2A 4IV8A 3FPLA 2CXQA 2O2DA 3T12A 3EXEA 2CXPA 1TFRA 3GDGA 1ESCA 1AZSC 2Z1DA 1JA1A 3KPYA 3ZUVB 3OE7D 4FMDF 3CSUA 3WGQA 2HHAA 4N03A 4I50A 3V8BA 5ALTA 4DIBA 3RS3A 4G63A 3FDZA 3PXCX 3PDCA 3QRWA 3TLYA 4B73A 3VM6A 3ESLA 2FWNA 3DXMG 4FW8A 2XHEA 3UB3A 3UMGA 1W85A 4Y8VA 1PFVA 2WTBA 1Z0JA 1ISGA 2R7AA 2LGJA 1NA3A 2IOQA 4FI3C 4MRUA 1OH5A 4TROA 1RP7A 1AKNA 1B3BA 4A0GA 4UCWA 2BBTA 2I7XA 4I7EA 1QM5A 2XZTA 5K9ZA 2VXYA 3I64A 2XCRB 3AP2A 3UJHA 3N8NA 5CFQA 1GL6A 3ZY2A 2PWPA 1G6KA 3PX7A 2O14A 4I43A 5L3VA 1T3TA 2Q7XA 4U1RA 1TAUA 4O1HA 1GTVA 1Z7EA 2ONYA 2XITA 2P58C 1Z5NA 4CKZA 3DEJA 5AJYA 3UWMA 5CW1A 1YZQA 4YCLA 2H6FA 3NGXA 1VYHA 1Z4QA 2WF9A 4X61A 2WD7A 2IPOA 3BH0A 3R0ZA 5AIAA 3O9MA 2IODA 4BZXA 3FULA 5HJ7A 5CXSA 1P39A 1HI9A 1A0OA 2GPJA 2GCIA 3O3NB 3GFFA 4W82A 4WNIA 3V8NA 1YDEA 1ZCZA 3MTGA 4JLJA 4CQMD 5EINA 4WXHA 3MELA 1C30B 2A5FA 2EGGA 3SBDA 5A3RA 1TAHA 1UBRS 3TZEA 2DQKA 3NGLA 2P9IG 4AG5A 4EY4A 4IDEA 3U31A 4DGQA 3SF8A 3LQ2A 4G5QA 2VSOA 2AOXA 5K8JB 4DCJA 2DWOA 4AI6A 3W7VA 2CXRA 2GBPA 3L46A 4G81A 2H1HA 5AJZA 2CEKA 5A2GA 1HDEA 1IL0A 3W5AA 1P7WA 5BV8A 4Y6PA 3TSWA 2AD1A 1VSBA 2GJAA 2UKDA 2Q6VA 2YRFA 3GFOA 3V42A 3FDFA 4XCQA 3UT0A 3MSXA 4FOSA 5AM1A 5BN4B 1L4KA 4EMSA 5BN1A 1EWRA 1JWBB 1W30A 3KJIA 2JBWA 2FFBA 4JNCA 2Q46A 1T6NA 2WMNA 2OO3A 1OIWA 1B14A 3HDYA 2G1UA 4LJSA 4KXNA 3K9WA 4MQMA 4M9ZA 4TSFD 4U5QA 4XDYA 1NL3A 2QK4A 4KYUA 4XIIA 5F21A 1EUZA 2ORWA 3SZUA 2CVZA 2I67A 2H52A 3GCXA 4MS1B 1UJ4A 4J6EA 3GRVA 2LXNA 5BMVB 2DFDA 1R66A 5FOUA 2FZCA 1U3UA 3EG9B 2P35A 4FULA 2DKOA 5E3HA 4MQFB 3H1GA 3T7RA 5LCWC 4HG2A 3INGA 3HUUA 4ROTA 1IY2A 1ADFA 1KGDA 3R5XA 3VXKA 1SH7A 1WD5A 4FLFA 1E8WA 3GDHA 5E7IA 3B13B 3IQDB 3MLAA 1C3EA 4OXXA 1S8NA 2WEKA 3N07A 4YAEA 1CRLA 1MCZA 5TEWA 2J67A 1ORDA 1SUIA 3FOFC 1M1YE 3EGWA 1AOXA 1M1UA 4RK6A 4G07A 3SM9A 3CZCA 2XYHA 5L8VA 3TF5A 1NY6A 4NBSA 3QU4A 1BPOA 4BT8A 1CRQA 2H06A 3KJEA 3RUDA 4HTAA 3EA4A 3ZN2A 3ZIMA 1E2BA 1YE3A 2X6RA 3ZEFA 4F9FA 2I4LA 2OZEA 1M74A 1SUWA 3BIJA 5CLQA 1WXHA 2C4VA 2V6MA 1RYMA 4IM7A 4N3GA 1O5TA 4HRNA 1ONNA 5HQ3B 3E84A 3V97A 4WLEA 4JB0A 1L1QA 4GBMA 4JKIA 4BO0A 2WHYA 2XUJA 5AUPB 4WERA 2XPZA 1CF2O 3LK6A 4FWIB 3SFVA 5J4KA 1PNVA 1NI4A 3ND6A 3KAQA 2QUZA 2O8NA 4QYWA 4FHCA 4J0IA 5C52B 3LUAA 1STOA 1ANKA 2O8BB 3L82B 3Q15A 3TKLA 4CIDA 3UJ6A 3WZMA 3GGPA 1A9ZA 3P9SA 4M8KA 4A2WA 4YV1A 4YX9A 3IUBA 2HQSA 4S1OA 3UXMA 4A5SA 5BQ3A 5LMCA 3TD2A 3WG9A 3U3WA 4QUBA 2CV1A 2PMBA 3K5IA 4G8CA 1AN0A 2XDYA 2OGUA 1Y34E 1HYQA 1PV4A 1A95A 3NALA 2H7VA 3LVRE 1ZKDA 1D2NA 1P7VA 1QMPA 4IG4A 1USGA 5D8DA 2ACWA 4P98A 1KARA 5CEEA 1LDGA 1TIKA 2A67A 3ZGXA 3G6KA 1G7TA 2WVHA 3F78A 2NW6A 1IM2A 5TJ9A 4IYPA 4E11A 4OHZA 1GP2A 3MERA 1OILA 3TVYA 2GCGA 1XEXA 2H4WA 2I80A 2YWJA 4GD3Q 4L75A 4EZBA 2IYNA 1FMLA 3QEJA 1ZH8A 2IYWA 3CKKA 3NZEA 5FOQA 1U31A 4KAFA 1MW9X 1DAHA 1K4KA 2NU9B 1JP7A 4V0QA 3FTYA 3WICA 4R8MA 1E7SA 3LX8A 4NCHA 4Y7DA 2NQTA 3HWWA 3LVBA 3NYQA 4DNOA 4JUDX 1B0PA 3T3EA 3ZWNA 3DDWA 5CLLA 2Z8XA 5BN5A 3D0OA 1VIDA 2QSZA 2QJTA 3A8TA 2WW8A 4BTBA 3TLJA 1K08A 1FMCA 4TX1A 5DYWA 2XA2A 3MUNA 4JAVC 3BJMA 4YP1A 5DTEA 5L3ZA 1AZWA 2XMPA 2CNWA 2ZJ6A 1OLSA 2E5LB 2Y3IA 5C32A 1Z4PX 1WRBA 2WU0A 3WGUA 3L1VA 2Z57A 3C8ZA 4L8WB 3O8LA 1PLKA 3RLIA 4TT3A 5KYWB 1YVPA 1T9HA 1IG3A 3EF3A 2Y4NA 1XLWA 4W1PA 2IYAA 3R09A 5JV5A 4R16A 1JW9B 4FZVA 2FCRA 1V8FA 2I6HA 5F1YA 4IKOA 2E1PA 1XMOB 4O6FA 5F3DA 2XKKA 3NEYA 4GLJA 3NNSA 2PD4A 3UAYA 1E4EB 1GUFA 3JAKA 2WHPA 4NHOA 3KJGA 2QE6A 1WW3A 4RK1A 5BV1A 2IEGA 1DEHA 3SEQA 2XOKA 1OB2A 1RJEA 3PGA1 4LZPA 2BONA 4P7KA 3WNZA 1W4RA 3TEJA 4CLRA 1EAMA 2YICA 1S70B 3H5RA 1NDHA 4GYOA 2VNSA 4PNHA 4L57A 4EBFA 5IYZB 4ZT2A 2ZBPA 1IWOA 1NXSA 4IOJA 3WHKA 2WM9B 4Q7QA 5JPCA 3NNNA 2FPXA 5EC8A 5JSKA 2LXMA 4RHUA 4GYWA 1SRRA 2GB4A 1WBDA 4B44A 3AX6A 2DHQA 4C6HA 5C8YB 4PS0A 5F35A 4FFNA 5EMJA 5C8DA 1UFKA 3OPYI 4MO2A 5H16A 3N58A 1F12A 4LVUA 1JKFA 1XP5A 3LO8A 3S28A 3U7IA 3HCEA 3SQWA 2VK1A 3C8HA 2JGAA 9GPBA 2C2YA 2WXNA 1BVUA 1RQ2A 4H31A 5H9WA 1IDOA 1WAO1 2PJUA 3N0RA 3OP1A 3OQPA 1GZ3A 5K3DA 4I2WA 4CEHB 3EVGA 5I4BA 2LVBA 2ZRBA 4B6SA 5CA0A 1QNLA 1PG2A 2YV5A 3CF4G 4LF9B 1XDUA 4E7PA 4K6MA 3FPBA 2LZ0A 1XDBA 3A6LA 4XWKA 2RE8A 5G04C 5JVDF 4URHA 5L3SA 1Z6TA 1O8CA 1ZRSA 5F2OA 4QQ8A 2EARA 2QNIA 3K1YA 3GGGA 4EA6A 3O03A 3S3TA 1Q16A 1P1IA 3PWTA 4KSBA 2J33A 3UINC 3CNQS 2DCPA 1CY6A 3KLPX 5FV4A 3PVLA 5LB2A 4J16A 3TOVA 2I4RA 2W6ID 2J9RA 3CZRA 5CRVA 3J7TA 5D6OA 3RKUA 5B3LA 5SYAA 2ST1A 3JUEA 5CGQB 4HLCA 2DFVA 1KSFX 3B52X 1XZEA 3ECAA 3S7BA 5AVJA 4DARA 3PUKA 2V45A 1ETUA 3GARA 3L5KA 4J8DA 2UZ0A 4I1RA 3K3PA 3GEBA 2ZPTX 2GI4A 2YHUA 4N7RA 3UMFA 4XVUA 2PKWA 1ZGZA 4M99A 3R7AA 4P0PB 4BN5A 2BEWB 3I72A 2IX3A 2GK3A 3K9GA 4CV2A 1HLDA 3IXLA 3PNKA 4KR0A 3AFNA 1TK2A 1QVRA 1NW8A 1FDRA 2OCLA 4RLSA 2AQ8A 2AN3A 3TCKA 3WKDA 1DQYA 4BJHB 2IO2C 1M6WA 2IIVA 3G2UA 2X77A 1U7HA 3CR3A 2XCBA 3C2QA 1XL0A 1RZ3A 5TB5A 4B7XA 4C3VA 3I4RB 2J30A 4JV5B 2ZRPA 1N6RA 1ZWKA 2D8AA 5AYWD 1AB6A 3GGJA 4YJ3A 3ENQA 4RWEA 5TS3A 5TQJA 3LG2A 2HWWA 5JJ7A 5SICE 3ZK8A 3G5AA 5IJ9B 3HR4A 2YYZA 5ICEA 1XWWA 5GZ1A 4RVDA 1TZCA 2ZQ5A 3IIIA 4BVEA 4NCIA 4MR9A 3C8DA 2DHCA 2CVPA 3ICCA 4EEKA 3H8JA 5HJEA 5JNVA 4YT2A 3NWJA 2RHGB 1H6KA 2VXCA 1U04A 1YJXA 3K0CC 4PIPA 3TGWA 4AROA 3H8WA 3X1ZA 1BYUA 4PAGA 2C97A 2EKBA 4YCNA 1P62B 3PP8A 3BH7A 1O87A 4APFA 2HYIC 2Y1LA 1SC3A 1ZCFA 2Y1EA 3NH6A 5KNDH 2GGFA 5FTWA 3ZW9A 5CFMA 4MYUA 3DKIA 3L8MA 3WK4A 1JEAA 3DV9A 4D74A 5KWEA 5HCUA 5M72A 1GIAA 1G8JA 2X38A 3IX7A 3OZSA 3EISA 4Y1RA 2B0JA 4YONB 4LHXA 4ZVMA 2XA9A 4ZVVA 2VP6A 3WADA 4DLAA 1V41E 3K35A 4MUGA 1YR8A 1ENOA 2P3SA 3GEPA 3HPRA 1IEQA 3GPIA 3OE1A 1MO3A 3FUNA 1KJ9A 1OI7A 1OZGA 1WUIS 2ORED 4QODA 1XBTA 4TRNA 1XNHA 3BFKA 1NF3A 1J5PA 4MYCA 4D96A 3ZNGA 2FN3A 2QYTA 3QPVA 4YRQA 3WK7A 5A5DA 3CFYA 4O5AA 4YV0A 1SHUX 3PS6A 1MBZA 1XLVA 1HT1E 2H5IA 2VRNA 4GTRA 3B6KA 1YI1A 4FC8A 3E03A 3IAM6 3QXGA 3APCA 2ZSHA 3SMVA 1DCKA 2CKMA 5DBEX 3ZE2B 1DB3A 4YJFA 3TMAA 1SCJA 2FULA 5FQ4A 1VRCA 1J39A 4FHZA 1S2LA 2SKEA 1KO7A 1ZNQO 2CVQA 3QLVC 3DHWC 4FCCA 1J6UA 1PL8A 1ZAKA 4YMWA 3ZUGA 4IDHA 1MORA 3WYFA 4AUEA 3PDIB 3FUEA 4RO0A 1HKHA 5FULA 9ABPA 1H66A 1SC1A 3Q5GA 1ZC4A 3FWVA 4B40A 4MI9A 7REQB 2QR3A 1U2DC 1U9IC 1MZPA 5AWFC 4CYMA 1F4PA 2GFQA 5JC8A 1AQNA 3MTDA 2PM6A 4JBGA 3U3DA 3KFLA 1RFGE 3QEAZ 1K0UA 3PNYA 4BDSA 4WBNF 3RG8A 3PC3A 1I8TA 2H54A 2E82A 3G5LA 3RG2A 3E05A 4DSUA 1CUHA 5BW8A 3FYUC 1MG0A 3VOSA 1NQWA 3JQAD 1YFJA 3CCCA 3UAGA 1V71A 3NV9A 5KSYA 3E61A 2CFCA 5GJWC 4PG5A 1H05A 3TOCA 3ZCRA 5ABPA 2F0YA 5AOVA 1IVNA 1PLJA 4BKRA 4YRTA 4HFRA 4ZKDA 4XLZA 4A1OA 2C82A 1E66A 2H1IA 2VDWB 3BMOB 5AKZA 4E4YA 4CIAA 1W0KD 4XJSA 1BE6A 2FFRA 2IYQA 5DBIA 2OORA 4BPBA 4L95C 5ARFA 1G3IA 1OCEA 1PI3A 2EX4A 2JVJA 1HDOA 2WIAA 4IRUB 4KNVA 3HYMB 1SZDA 2J7KA 3A70A 3DL7A 4QSHA 4EFLA 1VI2A 3Q41A 1KOJA 3L49A 3DO6A 4DRXA 3MCAA 1UXJA 3BFJA 1A5EA 3FDJA 3II6X 4RJJA 4DR2B 4CLXA 4PZUA 5AI4A 1DXOA 1G0NA 2OD7A 1LTXA 3CB4A 3OVMA 3PJDA 4WPGA 3IOEA 4I3GA 4N5QA 3KS9A 1P91A 4P4NA 3M89A 1R8YA 4QBIA 4PLGA 2I7CA 4G4SP 2RH8A 3EZLA 4HH4A 4YJGA 3MT9A 3AV0B 4L5IA 1P9NA 2IBMA 3RAUA 1JG7A 4KXQA 3EQ9A 1Y1SA 4D9FA 4QVGA 5EE5B 1A71A 1YU9A 1A8HA 3LRPA 3PNPA 4O4LF 1Y7PA 1TNOA 3ZYLA 1FU7A 2X4GA 3EFOA 4HI0E 4BWFB 1X5BA 2GDJA 2HQOA 3BIXA 3D64A 1CJCA 3LQRA 4K9QA 1TPZA 4L3WA 2WD7B 1EDUA 3T9KA 1PR1A 3FWHA 1FYWA 1HE5A 3WXXA 1FYVA 1NUQA 1MX6A 2JVIA 1QZTA 2LSUA 2OBMA 4OQFA 2VHUA 1NVEA 2GASA 4RFLA 3PD7A 1PEYA 4CU2A 5JCJA 5AVVA 1VCNA 1OU0A 2QW0X 5ADVA 4DDMA 1IXRC 2BR5A 2JC3A 4KWCA 4ZFNA 4DV1B 2JH3A 3V2IA 5HR5A 1PJ2A 1U4NA 5LPNA 3WB0A 1I80A 1UDWA 4LJAA 4NEGA 1GM5A 3ABIA 3APFA 1EFAA 2QTGA 5LZ9A 2HF8A 1Z2OX 5F73A 2AIRA 4X7PA 5HRUA 2B6CA 1GV0A 1JU4A 5DLPA 2JD1A 2QF7A 4U7JA 3DB2A 4ZC1A 4QTUB 3S2AA 1XFDA 2I8LA 2XE7A 2QPOA 2YV3A 3GLIA 1DCQA 1EP9A 1XZQA 2XMCA 1HDIA 3I8OA 2XTNA 1NE2A 1SC9A 1U0SY 1N9AA 2HCFA 2HQBA 1NPTO 1NFRA 3I0ZA 1HWYA 2XA1A 1JQBA 1SUAA 4H2DA 1X2BA 4ZGGA 4HVLA 1F60A 2WWTA 3Q9SA 1ZRHA 1FQOA 4KEAA 1HT0A 1JHRA 3F6BX 4XX0B 2XTAA 2UXDB 2VH1A 2ZSFA 1QANA 3V2UA 3TNJA 2PUCA 1PKXA 2NP6A 3LT1A 3K94A 4FYXA 2R0QC 2PRKA 5BNZA 3F5QA 3Q72A 1VZ3A 1JR2A 2BV3A 1QRTA 2HZBA 3KKOA 1PD0A 2PTHA 2ZIUB 2HLHA 3K8OE 4NYJQ 2VP3A 4R8KA 5CDFE 4XDZA 1SQGA 3LWZA 5MFZA 1E7WA 1CUGA 2P40A 3DCNA 4FYJA 4LK3A 5EJ4A 4O4HB 2J4BA 2BOVA 1OXBB 1V4BA 2OCPA 3IURA 1CW2B 1BXRB 1RKXA 4S12A 4UZFA 2BHNA 1RJWA 3HU2A 4QWWA 4BQEA 4CM8B 4GQAA 2V59A 4KIGA 1WTAA 4QOHA 1MGOA 2GQ0A 4DLRA 4BE7B 1JHQA 1XVUA 1Y9EA 2WTMA 1Y89A 4KBQA 3DBOB 4ND5A 5MN6A 1WV1A 1SCUA 3BFVA 4CLHA 4TTIA 1L4MA 1EFUA 2Q41A 4FE4A 4UATA 2GNOA 5U4XA 1FT1A 2XYPA 1KYWA 1FDOA 2VRCD 2ZR7A 5NLLA 4PAMA 2QDXA 1KBOA 3CPEA 4UU1A 4B5KA 1OI4A 3I1FA 2VZ9A 5DM70 3PQ7A 2WNSA 1OXVA 2R65A 5LBTA 3E3LA 3N2GA 4M37A 3SMQA 3PDUA 2QMHA 1FX0A 1N6HA 3A6JA 4KK4A 5TARA 3K4HA 1SBYA 4R4JA 4X24A 2WXQA