1FVHA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
590
structure length
546
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SEC1
total genus 183
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvhA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvhA03
1FVFA 3C98A 4JEUA 4JEHA 4BX9A 1Y9JA 5BV1A 3PUKA 5BUZA 1FVHA 3PUJA 4KMOA 4JC8A 4BX8A 5BV0A 1MQSA 2XHEA 4CCAA 1EPUA
chains in the Genus database with same CATH superfamily
2ZE7A 3SX2A 2ZSJA 1QJ4A 1RQNA 2BFCA 3ANSA 3ZDQA 3DBSA 4LDAA 1TXGA 3RVOA 1WXWA 2GW1A 2WVGA 4Y30A 1ESNA 2JAHA 3RRFA 4FC8A 2AKYA 3PX7A 1OLXB 4LNUA 3KTDA 1Z5NA 2NUPA 2XHEA 2A6PA 1XLUA 3FI9A 2QVBA 3RVPA 2BMFA 4FDVA 1NBWB 3KQYA 4FU0A 1DC8A 4AUMA 4E5KA 2FFAA 5IJAA 1FS4A 4MXDA 1ZJJA 3BCRA 121PA 3HHEA 1JEJA 4BLPA 3BORA 1EP9A 5HSGA 1C3VA 5CCEA 1OWOA 4EL0A 3CQ9A 3OQIA 4Y1EA 4HWSA 1N94A 4O6VA 3MLBA 3B95A 2H0AA 2AC7A 4C6TA 2HDNB 1JHVA 1UBMS 4XQ9A 5MGBA 3DV0B 2QUIA 3I64A 3JVUA 5KYXA 2YS6A 4YJ2A 3IV7A 5T41A 3RH0A 4BLOA 2X4LA 3TPFA 3KKNA 2B6CA 2W6CX 3DP9A 2YS7A 3EFHA 4RHUA 1IAVA 2LNIA 4DJAA 1GRRA 1RXYA 3L8GA 4F9GA 5IM4F 2Q1WA 5LCXA 4BMXA 3PZ3A 2Q7XA 2WMOB 3TSWA 5EX3A 5CB8A 4HDAA 1G0NA 2XITA 3IVCA 2F1KA 1XALA 5JMWA 4ZRMA 3UGTA 1OJ7A 1KT0A 1CVRA 3C3PA 5FPPA 3G0OA 4MRMB 4Q9NA 3ZXIA 4EVSA 3L7JA 4W7SA 2WJJA 5ICSA 3BE4A 3MZLB 5DM1A 3CW8X 3L7KA 3X43A 1JG4A 3UM3A 5ALJA 3S2ZA 1V8PA 3OX1A 4DLSA 1TUBA 5AFSA 1KI4A 3RWBA 2QL9A 3ER6A 1TIKA 3ISTA 5JYDA 4TZ0A 1NL3A 4DYVA 4LY3A 2R8XA 1PJCA 3BUSA 2C94A 3JX9A 4HX5A 1NLFA 1P9NA 4XVRA 1M34B 3LXXA 7GPBA 1Q0QA 2OBXA 3H17A 4G36A 3WGVA 4YT2A 5FWYA 1MCZA 4WQMA 3A2LA 1XEFA 4Q6BA 1TZKA 1V71A 2EFDB 2F3TA 2DWPA 1QHFA 2FP3A 3ZX5A 3QIVA 2A1UB 2RB4A 5BR4A 1DL5A 2GAAA 4GTMA 1C41A 3ZWMA 1QOZA 3LT5A 4PHGA 4EB3A 3MTIA 4GR5A 3V33A 3FTZA 3G0BA 2VSOE 2MIIA 3DW3X 4ZT2A 4QLOA 3HZRA 3QU7A 1Q0UA 3HBMA 4CW7A 4QG3A 2HPHA 3RM3A 4NQ0A 4MUMA 1YU6A 2VAVA 2RBEA 5AKIA 5J1TB 3W1WA 4BQPA 5HKKA 4WNIA 3WDKA 1ISFA 4TXHA 3E2MA 2Z2IA 5GY7A 2NSLA 4HQDA 3DPUA 3SZLA 1OR8A 1N2GA 2WZCA 4ZMRA 4MPRA 4RU1A 1J2EA 3P5BA 1N6HA 2P9QA 2ZYWX 2BR4A 3HCBA 4RTLA 5MDHA 4R9VA 4I1MA 1G5FA 3BICA 4GKAA 3SC2A 2BZGA 3UCFA 2RC6A 4WUVA 5JT1A 3I5UA 2XZOA 3RO3A 1V35A 3U7EB 1O9HA 1WXGA 4RLYA 3JVEA 2P5YA 4OY3A 1FU8A 4GPAA 4UJ3A 1NXOA 1WPQA 2IBTA 8GPBA 1EWVA 1UPFA 4BP8A 2Y1WA 3TI7A 1F48A 1UR5A 4JJKA 1JJAA 2GA8A 3C45A 3KEOA 5K3SA 1DQSA 2REXB 5C9ZA 3URZA 4HWGA 2FH5B 1GPNA 4AJIA 2B1RA 3DMGA 4AURA 3SD5A 4IIVA 2CBXA 3RT7A 3UJHA 1TVMA 3AH8A 3EZYA 3L0YA 3OICA 3D7LA 4J75A 1JSZA 4BZZA 4D8VA 4ZOQI 1Y3CE 2HK9A 3IPAA 4RGBA 4Y2RA 5CXUA 2PZMA 4QT0A 2V7XA 1QE3A 3ET4A 4F3RA 1WZUA 2NO4A 3BC1A 4PXSA 3NBYC 4R1SA 5EPOA 5CK4A 5EJAA 2P41A 5DBOA 3IV0A 5G55A 2DSTA 3T5TA 2FMTA 1DTEA 1XA3A 3THYB 4C2BA 1WMAA 4CEJA 4OX9B 3ENWA 4QGAA 1AB6A 1Z5PA 2HA4A 3ORSA 1A88A 4LKOA 5JJ6A 5BRAA 2B9VA 1KEPA 4M0FA 3I5YA 3UPDA 2WW8A 5I48A 2B21A 3K0AB 3G2TA 1TL7C 4FYYA 5I7WA 4EWLA 3ZK8A 1PFVA 3PXBA 2D7DA 2XOEA 1VXOA 3HMKA 4CMEC 1HG2A 1KHHA 4EHAA 2P6NA 4ER3A 3EUAA 5D2MC 4U07A 2Y0CA 3O4RA 4O2AF 3QPBA 3RU0A 3CLSC 4QUJA 1Q0TA 2KI5A 4UHHA 1UJKA 2F1IA 3A6ZA 3M6MD 4FMCF 1GG9A 1YAJA 5L40A 4DLUA 1VE6A 3VDMA 2YHIB 1PHPA 5C5IA 2EZTA 3FP3A 1E96A 3Q75A 1QV6A 5FIOA 1GTL1 2DPHA 2RGAA 3EC1A 3GJSA 4K9KA 1DWUA 5A1JA 2ZANA 1LX7A 1QJCA 1UXJA 2V7PA 4XB2A 3HIZA 5CHEE 5BT8A 2PQ2A 2NW6A 3QE2A 4BB6A 3G5AA 1QHEA 3B1ZA 2NVWA 4JFAA 3OMLA 2OOKA 4BNHA 4TVOA 1HWYA 4XCVA 1G4HA 2BGGA 4E88A 4LVOA 3A06A 3NAQA 4M0UA 4M76B 3TDKA 1SBTA 1N1MA 3HFRA 4PIVA 1TM2A 4ABNA 1OU4A 3ZZ0A 2YCBA 3CRZA 1JLLA 5F98A 2NYRA 5DYTA 4FE4A 3HGTA 5EUMA 3W2HA 2I3AA 3PA6A 3WWDA 2D6FA 5K0LA 1WZCA 3OZFA 4DLRA 1T3ZA 1VXRA 5C5CA 3EW9A 4AUEA 4MH0R 5CEFA 1QGYA 4IXDA 4WZBE 3QIAA 1BI8B 4O8ZA 3Q15C 1C7QA 3TWSA 4YMUA 1PNOA 2WUWE 2FPMA 1CERA 4EKNB 2QNBA 3UUEA 3EU5A 1ESEA 2IVZA 2WUVA 3N2EA 1JIJA 2JS7A 3H2JA 5ENZA 1T1RA 1NKTA 5DH9A 2AYZA 2KCVA 3FPSA 2G9ZA 1KJIA 3QXHA 3SQDA 5AW0A 3N74A 5CYPA 3I9OA 1B23P 4OGGA 3HDGA 3NHFA 1A9SA 4Q3EA 4DCOA 2AG1A 3OPYA 4MKGA 1A7JA 4N0QA 4DFDA 1K66A 3Q11A 3Q49B 1E8MA 1ISIA 4Z9XA 5HMLA 1VDYA 1K4KA 4DR6B 3QELB 1JVBA 1SXJB 4YYZA 4PQEA 6REQB 3P0JA 2PGLA 2XNDD 4NSNA 5KHAA 4ICIA 5SYNA 4U39A 1RRGA 4CFZA 2WM9A 2VJ8A 3DMTA 5HCNA 4LV8B 2QM0A 3KSDO 1SOWA 2VSFA 3HKBA 1TO1E 1K98A 2EX0A 3DE6X 1KNXA 1MX9A 1T5IA 1Z22A 3A4TA 1W6UA 1JAIA 1PQYA 4WACA 4N5CA 2VSQA 1FVHA 3DV0A 3EIQC 2WJYA 4WZAA 4E09A 4P35A 2EKDA 1CUGA 4LPKA 3IR7A 3HVUA 4M55A 3WISA 4B3BA 4ENPA 5JJCA 1JVSA 3FUCA 1PIWA 4G5YA 3T7EA 3TGLA 1OUVA 3FNQA 1NYLA 5ICFA 4IULA 4HQFA 3TJRA 3AFMA 3O73A 2FETA 3JQQA 1TUEA 1W9HA 4KYTA 1OCRE 3MUNA 4X1YB 1YOVA 2VUIB 1DAEA 1G1AA 2JVIA 2B1JA 2XUQA 2I1VB 3CHPA 3K0SA 2AR9A 3IPRA 4I9GA 3LHIA 1T8PA 2X2OA 3FFBA 3TOXA 1OI7A 2H1HA 2GPAA 3ZWKA 5JZ9A 4CTJA 3UJ7A 2JLWA 1VYHA 1L5YA 2P2CA 2PKQO 2WSBA 4R41A 2I8CA 3ANXA 1I0LA 2HF9A 4XYBA 5D7BA 1HQDA 1UM9A 2JD0A 2P5SA 3OE7A 4IJQA 3AINA 3AEQB 2DBAA 1RJEA 1YDEA 2PGIA 4RD4A 3ROGA 4L23A 3CW9A 3EEFA 4HDRA 2IYPA 4QDXA 2PN1A 4RMHA 4LXUA 3EXHB 1I9GA 1MV5A 2CE7A 3KT3A 3L1KA 3JQ8B 4R8SA 1OASA 3NUZA 2VGXA 1RHKA 2AOXA 2KQUA 4ZWNA 4E5SA 4G0ZA 5JD4A 1HFEL 2FLKA 1T8UA 3KSQA 3PICA 4HDQB 4JBXA 4EGJA 2YVKA 2VZEA 3G9XA 1KY3A 1YJBA 3BQNB 3D0QA 3ZLTA 3W9SA 1TQHA 5LM3A 2XOKD 4YY3B 3ZI0A 8ADHA 4DV0B 1G1MA 4AS2A 2Y6VA 2I7DA 1QVAA 3G5MA 4UDNA 1OTYA 2OA0A 5G1PA 1U8FO 1G3MA 4JHRA 1UMBA 4YVQC 2DFTA 4ARAA 3WKDA 4C01A 4AX8A 4G9GA 4HKTA 3D3MA 4BYGA 4PSDA 4RHFA 3DSUA 5JG7A 3F9IA 3V9PA 1DNPA 1HO8A 3URKA 1QPBA 1KJ8A 1D2CA 3AZQA 5EHGA 3R7WB 2DBRA 2ODQA 4JVNA 1N7GA 3E82A 4L3VA 3FDXA 4RCZA 3KT8A 3FXAA 3GOHA 1MVOA 1QYVA 3MT0A 1NYQA 1RD4A 2JGMA 3CLUD 4S24A 1P2VA 4G0XA 1L5GB 1E8XA 1XF9A 1QV9A 3UWPA 1ORVA 4D02A 3IKVA 4KFSA 4DPLA 4QIHA 1JSLA 4ZICA 1UQRA 3AY0A 4GI2A 3T7RA 3WBJA 3GEHA 1CUUA 3GMIA 2PS3A 2RGEA 3JZAA 4HXFB 4LJ7A 3ULKA 4I1IA 1T5BA 2WQ7A 1ZA1A 1A9RA 2YZ2A 1QKKA 3HN2A 4UAUA 3CUTA 1L0BA 2JHGA 3DCIA 1SXJE 2WK1A 3OJLA 5A4JA 2VJKA 5CXQA 2KZTB 2UAGA 2XQFA 4UHJA 2H5EA 4A91A 2JH9A 1CY0A 2VKTA 1KAGA 1DOAA 3WHPA 2QIOA 2BD0A 3ZTWA 4KO8A 2XUOA 4E6HA 3LPCA 3W5IA 2ZISA 5D84A 3SFVA 3T1NA 5EDSA 1JDUA 1KKMA 1VLMA 2HFKA 1UWLA 2YR0A 2VSXA 3CEMA 3EHDA 3FNBA 4NL4H 1V43A 4GTQA 4U2CA 4C3ZA 3ET5A 4ENVA 1I0IA 1IY2A 4BBAA 3NHJA 1I51A 3MXOA 4JLSA 1TF7A 4HYYA 9ATCA 2F8MA 2YVLA 5ALHA 1O0CA 3AG5A 3KP1A 3FDHA 1T2NA 2EARA 4F8EA 4KIWA 4BQNA 4WXRA 4DIMA 4BWRA 1JXOA 2WQZA 3JD1A 1TTQB 2FK7A 5HZMA 4CXMA 1NLZA 4HYEA 1SH7A 1QM5A 3B78A 4KQMA 5GZ1A 2F8YA 5DNDA 4DLWA 5H7PA 4HQOA 5JS8A 5ALNA 5K8IA 3VC1A 4JJEA 1E3SA 5IBRA 2EDCA 3GFVA 1JI3A 4BBPA 3ZE6A 2J0UA 4DK5A 1RYHA 2FEWB 4FJZA 1CV2A 5AOCA 3DWLG 1BROA 2VHQA 4J0QA 1EU1A 5FTWA 1BGXT 1VCIA 2UXBB 1FFSA 3N8IA 1K0FA 5GVRA 3OZCA 5KKAA 2YV5A 1NRWA 4FEAA 1JLRA 4F60A 6ABPA 3OQPA 2SKEA 5G4LA 5CERB 1GLVA 2Q3DA 5F9HA 1TFUA 1E4OA 3G8AA 3K1ZA 3ZPJA 2NUTA 3RABA 2VDKB 4UEQA 1JZQA 3ZYCA 4G1EB 4MKIA 2CHFA 3DSSA 4B84A 4X65B 3RRMB 2XXBA 3LLUA 1XVIA 1ZK1A 4D26A 5ELLA 3CK7A 3OSUA 3W5DA 5D6OA 3CIAA 4I99A 5F51A 2O4CA 1EVJA 2VC2B 3GG2A 4J4BA 4AS3A 4DHWA 5KOIA 4ZZIA 1YS9A 1B8VA 3X2QE 2V97A 3GZ4A 2R6GA 4ZDIA 2VAWA 3A6EA 1DC3A 5ARCA 1A96A 1ZQ9A 4J16C 3UAVA 4BQFA 2I65A 1TTTA 1IEWA 1EGHA 3W34A 2C82A 3AR9A 1CVLA 2FQ1A 1E77A 3CNEA 2HWWA 3BD6A 1Y1QA 3WMWA 1Q1BA 3WIVA 2JFBA 2ZVDA 5FQ7A 2GBLC 5CNMA 5EJGA 2A5FA 2W6JA 2PUAA 4O4LF 3U3OA 1UZNA 5KJCA 4RWEA 2ZREA 3JQCA 3S2EA 3SXJA 2FVYA 2RBGA 4LGVA 2HDWA 1CDZA 4EW2A 4E6EA 2R65A 3EXIA 3MAJA 3E05A 3JQ9A 2ECPA 1HBJA 1U1FA 2FO1E 4A9AA 4G8BA 4MW7A 3ACDA 4DSOA 1SWWA 5B6PA 4PLCA 3EBOA 4US0R 3PJDA 4E46A 3DJYA 2VSOA 4JVOA 2Z4RA 1D8AA 2XMBA 3X2EA 4AXHA 3TSOA 1DEKA 2ZI4A 4B89A 3O94A 5CB6A 5CGZA 1E8NA 2OAQ1 1SC4A 2JAOA 2XSZA 3BF7A 3VRHA 1XZGA 2GN0A 1NVUQ 3IIIA 3KVVA 4XCXA 4YAEA 3LD9A 1YKGA 1BZYA 3KCQA 3RGGA 5JR3A 1GU1A 1T9KA 2BONA 3IUYA 1WP9A 3LA8A 4UREA 3GZ2A 3UXMA 5L6MB 1CNEA 2C5GA 3I12A 2X19A 1JG6A 3OOWA 4RDCA 2F8SA 1NHWA 1E8ZA 5GINE 5DIZA 1EEHA 4TTVA 3W6UA 1SHKA 3HO6A 4FULA 1B2RA 2OZLA 1PL7A 3QY9A 4FEEA 3K9NA 1V8FA 4PC6A 3U4GA 3VYVA 3AIIA 4QA9A 3X1XA 4PPYA 4B6OA 4LIPD 1XNQB 4DLPA 2P77A 4NFYA 4E22A 3R3HA 2PL9A 1PX2A 4IZIA 1ZXLA 4CM4B 3L7YA 1R7RA 4L3WA 3UXYA 3ZUPA 1EXVA 2G0AA 5JADA 1ZUIA 3D4PA 4RHXA 5BP7A 5SYAA 1ZICA 2J6CA 4DM3A 1ODSA 3PEVA 2B83A 1GVHA 1P1KA 3SC2B 5T5QA 3T4XA 2K5UA 2FSSA 4LXHA 2RIRA 2OLEA 2JEKA 4XEIG 2BKKB 1CVIA 3BFVA 4GPKA 2P2SA 5BW5A 3TQIA 3WTCA 4QX6A 4YIKA 2IS2A 2VGXB 1XZMA 2EINE 2JFZA 2QT1A 2PMBA 1Y6QA 2ZW9A 3FGPA 3OLWA 4LQDA 5AUQA 4C76A 2I2OA 3I0ZA 421PA 1NNEA 1DRVA 4QUHA 3OZVA 4L1KA 1ELOA 1SRRA 4GFDA 2HV9A 2QZ9A 4ZPJA 4DRXB 2Z6QA 1LTKA 2QMOA 3J5QB 3ETHA 4H7HA 4HH1A 2R00A 4JJFA 2PE5A 1PEAA 1PV1A 1Y9DA 1ZW6A 5JQGB 2WWXA 2Z5GA 4ZPXA 1JIIA 4QM7A 3C3AA 4HWOA 3OURA 4HQ0A 4C07A 3T7SA 1YO6A 2JC3A 2L82A 2XE8A 2D8MA 3BKWA 2D1QA 4Q05A 4DMMA 3PTAA 3QVSA 1IC6A 3WG7E 1JH8A 2IW1A 1L8AA 2W48A 3DF9A 3G6KA 1ZGHA 1RT9A 2GAJA 2Z8XA 2OSVA 1RPJA 3GHYA 2WJ6A 3R3SA 4U4AA 4TMWA 2Q7OE 4UDYX 3VHXB 2HX1A 3OM8A 4HZUB 4BO5A 3B36A 2QJOA 2F4NA 2W43A 1YBMA 4PSAA 3IXQA 4QSMA 3BHJA 1PFYA 3NCHA 4PR0A 2OXFA 3B9PA 4PHHA 4RYDA 1NVWQ 2ETXA 4ZQGA 5EP2A 1Y8CA 4F2GA 4EJSA 4Y9TA 3LLVA 5ALXA 5E4JA 1O1SA 1XVTA 4WN9A 1TR4A 4PCUA 5IHXA 3K1JA 5JARA 5EX0A 1AKVA 3I1FA 5AJLA 3LXRA 3IMKA 3C6MA 3EAGA 3TD9A 1QGDA 1QR6A 4JSTA 1IH8A 4OA5A 3U9SA 1M2NA 3HVEB 1OA0A 3IQFA 4LQLA 3REQB 1P2UA 1OD6A 3T9FA 4JYBA 1KZ1A 2OAP1 1COWD 4HLUC 4JJ6A 3UMBA 5LOVA 1E96B 4U2BA 1WAO1 5FYDA 3UT5A 3JYOA 2XCLA 1EVKA 2RGXA 5FQ8A 2KMLA 3MKQA 2P6PA 4QU9A 4TTIA 2AEJA 3C0KA 1XYGA 3GARA 1ND5A 1Y6IA 4R1LA 3ANMA 4ZOCA 1LF0A 3W8NA 4LEIA 4C06A 3LJ3A 2EQBA 2IS4A 2CLHB 1H1DA 2RGYA 2ID8A 1OLUB 2XA2A 2QP3A 3K1YA 1AGPA 4OI2A 3JRWA 4V39A 1B41A 2I03A 3CMCO 1V7CA 1JR3E 3EYWA 5BWMA 1YF3A 2ETBA 1IPHA 4RJTA 1XVAA 1NAIA 1M8KA 2XYGA 2XCUA 3I01A 2FG7C 5CEDB 4NR0A 4HPXB 2MDTA 1UDWA 3T5VA 4DMCA 5CDTA 2IXGA 2R2LA 1O5TA 1XJWA 2NV0A 3O5AA 3NTQA 3WJAA 4EGCB 4Z3KA 4DR1B 3QK7A 1CY2A 3KUUA 4Q93A 2JFNA 3RBXA 4YB8A 4F4HA 5LCWJ 4KRGA 1GV1A 3HZZA 4L8YA 1S64A 1IXKA 2CHZA 1FA9A 2RI6A 1OFGA 3VH2A 3CT4A 1DKUA 2O3TA 4IS3A 5ALIA 5AO9A 3UAZA 3KWMA 2P9JA 3RKRA 3HXFA 2AOTA 4US1R 2A0YA 3HNRA 1KVQA 4ZO9A 2QKYA 1U2TA 4G9BA 1E1NA 3RAUA 2QRVB 3ELWA 4HB2A 4PLHA 2VAMA 3MC1A 1C1DB 3PFHA 3GLRA 1CUZA 3ZEAA 4LQCA 2QAIA 2QTFA 5LOVF 2B8JA 2OZEA 2Q9CA 4PZ0A 4UAJA 5L45A 4Z4IA 3EDOA 3A1UA 2AUMA 1YUNA 3COSA 1PF7E 2C2WA 3EMDA 4KNVA 3HCDA 4LEUA 3ZCSA 4C0XA 1T9HA 3FOWA 2QTTA 3OWOA 1CTQA 4LHZA 4ZCSA 5K5EA 1R0ZA 1QRUA 3ITKA 3IB6A 3QHQA 3U3MA 2GJ9A 3D7NA 3KOUA 4QRIA 4NK5A 3STUA 3OO1A 4C0WA 4UD6A 1FFYA 1IIRA 1NOIA 3GYZA 2C3OA 1D7AA 2GD0A 1U0LA 3JVVA 3MCWA 3Q7PA 4J07A 3WG9A 5K3OA 1DUSA 4C4PA 4M89A 4ZOLF 4WJLA 1PT7A 1R6XA 2JHAA 3QEKA 1X8KA 4HQNA 4HZGA 4JUDX 1MIOA 4PC2A 5E6SA 2NQ8A 3QPVA 5CRUA 1ZJYA 3H3JA 3ZGYA 1OT8A 3SDZA 3A6LA 1USWA 2I0FA 4LFAB 1S3GA 4A8TA 2QI9C 1BVRA 1H5UA 2WZQA 3EUWA 4PY2A 4HOSA 2AWIA 2FJ0A 2LIPA 4K9LA 1GTRA 3MUFA 3SS7X 1MB4A 1JILA 1TQ2A 2IYAA 3H9GA 3LLSA 2BKXA 1FMCA 1PR0A 2VHCA 4WNDA 3IUJA 2VYND 3HY6A 4D4LA 3QAQA 3EGDA 2PG3A 4ZHQA 5FOXA 4IDEA 2YZNA 2RGWA 4RL6A 1DB3A 4PF1A 4O60A 1LLQA 2C98A 2HFJA 4Y7DA 1ORWA 3UK2A 3UWOA 3VDXA 1V3VA 2D00A 3NBZC 4JBHA 5DB4A 3TW6A 4ZQEA 3JYQA 4A2QA 9LDBA 3IE1A 2CSXA 1N2OA 3KAPA 3A6FA 4D3DA 4H0FA 3F5QA 3FOFC 3GJYA 4RS3A 4XH9B 2COKA 2QN2A 4BNMA 4EFDA 2MYPA 4KMOA 4MYSA 4X6XA 1NW5A 3JQEA 4DMGA 1ECJA 1NBMD 1UBOS 1VKHA 2AJBA 2ILTA 3T1OA 4DIEA 5ICMA 1P7YA 2AW6A 1VM6A 2QG6A 4IG9A 4ZO6A 1U8AA 3M8KA 3KZVA 3QMWA 3RO2A 5FWAA 2DBYA 2DFDA 1HI9A 3UAXA 2Z9DA 4PZPA 3MJFA 3V00A 3ZQ4A 2ZYTX 4AZ0A 3Q9NC 3L49A 3D6NB 4GMJA 3RJ9A 1JALA 3H3XA 4A55A 4U7GA 3BZWA 1P7VA 2NQ2C 2R97A 2XQ0A 4BMZA 4LOIA 4G86A 2QYUA 1P0QA 1OTXA 2X0RA 3RKSA 4ZO7A 4BZXA 5JNUA 2Q7FA 1FTYA 3DNMA 2RH9B 2VK1A 5CA1B 1EGMB 1JGTA 1I7QB 1X87A 3PNQA 4REQA 2DERA 5AKLA 1H2HA 1L9XA 3OFNA 2EATA 5EMJA 4LWQA 1U8EA 2HSGA 3S2FA 2QG9A 3D9QX 1Z4PX 3WMEA 1GSHA 2KS6A 3HSYA 1ZOLA 3VJMA 3TMKA 1N2CB 3HUFA 1FB5A 1EAMA 1U9YA 2W2MA 3GD7A 3IJPA 3EHRA 3K5WA 3KVRA 3R3YA 4WXYB 3WNBA 4I55A 5DEIA 5AH0A 2GFIA 2WI8A 2QTVA 4I1AA 3ZHRA 2WHRA 2GK3A 4B6JA 1USIA 4TUUA 2FSIA 3DNFA 5BUZA 3ABOB 1IZZA 3EDRA 4KH0A 4NKRA 5KSOA 1T4CB 3M34A 1VPWA 1QHXA 4PGMA 5JPDA 3BH7A 1GPYA 3E30A 3GRFA 1Q0PA 1RM4A 4FONA 4BMDA 4DEVA 4P81A 4KZKA 2H9YA 3P4UA 2XYQA 4ALMA 4DCNA 4EYOA 2I22A 1P5QA 4Q7KA 1G8MA 1K92A 1PFKA 3EA5A 1VL5A 2IDKA 3GAZA 1P0PA 4BLTA 4B6FA 2BFDB 3SOPA 2B99A 3KKLA 4QOJA 1Q7EA 3KV1A 3MEQA 4XIGS 1JIVA 4FE3A 2X42A 4LDRA 5G40A 4TN5A 4DX6D 2I4OA 3N2LA 1NUSA 1UQTA 3NNNA 3R5FA 3TEFA 3VR4A 3SZGA 1YL7A 3WJ7A 2JGNA 4J6FA 1TM5E 4YWHA 1BXKA 1C30A 3D9MA 1XB2A 2RHTA 3GPDG 3OJEA 3B7UX 3FHJA 1V9SA 4OMDA 1V8ZA 4DDKA 1TEZA 2JIZD 5LIRA 1Z13A 3FSGA 3BDVA 2YH2A 4B0OA 1QXSA 1L7DA 5T4HA 1U3VA 3OIGA 1PVDA 3W5HA 4RLSA 1O5OA 3SICE 1E2PA 1OWLA 4INPA 1PWYE 2HTFA 3HDYA 4MVJI 4ND2A 5CX1B 1KMCA 1D8TA 2VR1A 2YX1A 1TT5B 2VHWA 3F3MA 2B2NA 4MAFA 2BW0A 4RGVA 1FFWA 1NMYA 2JFGA 5EUBA 2UYCA 4AI6A 1ZI9A 2AOUB 1PD0A 3PR2B 2IYXA 1DT3A 2R8RA 3VAZA 2SCUB 5DN6D 3L7OA 4QVKA 4TLAA 2IY9A 5C52B 1UXGA 3AK4A 1U8XX 3Q79A 3PITA 3V4VB 2I6TA 2AXZA 4EARA 3THXB 1NP6A 1H8HD 1RI1A 4F7DA 4RY8A 4Q7LA 4YP6A 1NQXA 4TTJA 4Z9AA 2ABWA 1C2TA 1J7JA 2QRVA 4KP7A 4MVCA 2GQ0A 4WA8A 1TADA 1GN8A 2Q2QA 2VDOB 2E1RA 4MWDA 3KBBA 3UM9A 1RSZA 3VKVA 2PJDA 1XL0A 4RSGA 3RW9A 4TSFA 4G23A 2FZLA 1CQZA 4Q7QA 1FLAA 1JT2A 1T9ZA 1ZEMA 2HMUA 3INYA 1TQ4A 3ORYA 4I5EA 1EFPA 2WAOA 4PSUA 1E7MA 2PQ0A 1Q91A 3QKSB 5KYWB 1ZISA 3RS0A 4ANXA 1QZUA 1U31A 1VSTA 1RAHA 2PU5A 2C54A 4KXFB 4MRPA 1DBVO 3IBFA 5F4ZA 4YV0A 5KTSA 1IBCA 3EXFB 4BUCA 5IVKA 2ID7A 3OE7D 5KJNA 1L6IA 2CK3D 2AN1A 4FBGA 4HADA 2PM6A 4Z99A 3FFWA 3R2JA 4TTAA 4DSUA 3ZVRA 1WMDA 2B4QA 2MINA 1EFRD 1I5EA 1ISJA 1R00A 4XJXA 2ZCVA 3ROTA 1QCCA 4G97A 1NT4A 3EN0A 3FBGA 4GEKA 4DPMA 3RNLA 2P69A 4DUPA 4C14A 4M98A 3HACA 4DG8A 3FEXA 2COUA 4M1ZA 4BGDA 1WXEA 5CU7A 4E2WA 1XDDA 4WY5A 3QWPA 1E79A 3DOOA 4TMKA 4OBEA 3S8MA 1RQLA 3F7OA 4CG2A 2BUAA 3TCXB 3VDRA 4UTVA 5A05A 1UM8A 2PYZA 3GNSA 3IAM6 1ZOSA 2WNIA 1QKIA 4JH0A 4XWGA 2NNLD 3RB8A 4RKRA 3PG5A 1XD9A 1VI2A 3EEIA 2BM9A 1ZMRA 1MN6A 2P3LA 4JB0A 3RVBA 1E9BA 3RJTA 2F9MA 4HXGA 1KIAA 3SKYA 3QJGA 1NUAA 1OXVA 1TLFA 4F93B 4MGIR 5THXA 3ZXPA 5C34B 2YN4A 3K9FC 1UMKA 3SC3A 3U3WA 1UBCA 4ENRA 4ZIRA 4FWBA 4IIDA 1U04A 4L3OA 3HU5A 4RTRA 1U0NA 5CLIA 3KOOA 1LNQA 5FPTA 4JI4B 1DUIA 2CFTA 4BNZA 5DHFA 2H4ZA 2HF2A 1NW6A 2V4MA 1MHPA 3PDCA 4Y1FA 3SKXA 3FCYA 3UMGA 3WBBA 4TLCA 5AW6A 4DOMA 4GP6A 2NN3C 2PIDA 1CQPA 1GR1A 1PJBA 3HN7A 4ILKA 3WYAA 3ZK7A 2UXDB 2P0EA 1UKEA 2P4UA 1OFUA 3CLRD 1NY6A 3OOEA 3QGMA 4RPJA 3ZWVA 1R0CA 1DELA 1J8DA 3A9SA 1CCWA 2FQWA 2ZATA 3EQ8A 4GTPA 1QFMA 2EFHB 3FB4A 3NWJA 4RJIA 4ZQFA 3CTMA 4HDMB 4CRWB 2QVZX 4B3FX 6Q21A 2A0FA 2J87A 4AL4A 4BNGA 2Q5IA 2IRWA 3NDIA 1OAOC 3QYJA 1JEYA 1NE2A 3TLGA 3K0FB 2W0MA 4V2IA 1GZ5A 2VCEA 4ENTA 3T3PB 4OQYA 2FBNA 2FN9A 4IFBA 3TSCA 2G9RA 3DAGA 1ST2A 4OLJA 4U04A 2ZTLA 4ZEWA 1DG9A 3GRUA 4FWIB 4O4IF 4P9NA 1E2FA 4B6PA 1GYRA 5CLQA 3WQHA 4F4IA 4ZTUB 5IWAB 3K1TA 2KJQA 5LP6B 5EYPF 3PNOA 1V7PC 1DX9A 2XADA 3D4NA 3FCCA 4GX5A 1II8A 3L04A 4ZVVA 2ZIGA 3DT9A 3MWDA 4E5MA 5TMPA 2JG3A 1J99A 2ZT8A 2O3RA 4EG5A 2YXEA 4PLWA 2B4RO 3EHEA 1GSAA 4UMVA 4AOFA 1LPMA 1XA0A 1VG1A 3W8EA 3TB4A 4YRMA 5JI2E 4L9PA 4P0QB 3CKKA 3K31A 1S3FA 4BATA 2W37A 5HDQA 4DV1B 3AETB 4EGSA 4V24A 2QTRA 1IN5A 2XRZA 1FTSA 1ZONA 2JJ2A 4IDPA 5EZYF 1A1VA 3EA4A 2CXTA 4KGDA 4N5LA 2WYOA 1SCDA 3DWIA 4BECA 5ENVA 2ZUBA 3A3NA 5ISMA 2XYVA 5BURA 3NWEA 2LKDA 4CKCB 2MWMA 2PL1A 3BWMA 2F1OA 2VTKA 2O50A 2X9GA 2DYSE 1SU6A 1CRQA 2GBGA 5BSFA 4BBJA 1SKMA 1T15A 4QPCA 1NGSA 1UH5A 2P9FA 3RSLA 2FR0A 4MQ5A 3VO9A 3ZY4A 1K7CA 1B4DA 2HSEA 1EWQA 4RVHA 4KKVA 2E4YA 3UENA 4AY4A 2Q41A 2FPOA 1RPTA 1U28C 3FUJA 1OLUA 3LVQE 3DAFA 3MTAA 1GCAA 4OHUA 1N95A 5DWDA 5EJ2A 2WXRA 2AOUA 1CJMA 2C3MA 3ETDA 1F9AA 1XYYA 5JJKA 1C1XB 2A5GA 3NAMA 2I78A 4UU0A 8LDHA 2WJZB 1DC2A 3N8HA 4YS6A 1DWPA 1F5SA 2PFKA 5JZVA 1YC5A 4MHSA 3DXKG 4C0HA 1KAHA 1MO5A 1RR6A 2GN9A 3QW2A 4LA4A 5EYPA 4B7XA 4UVEA 2LSUA 1LRKA 3QELA 1RWPA 1TNYA 3UJNA 3GU3A 1PT9A 4TL9A 5HTKA 5HNKA 1Z16A 1CZHA 3CG0A 3L5OA 4TWBA 5GM2A 2VT7A 3PC6A 3UUWA 3VR3A 2FPPA 4P5PA 4AFNA 3ZQUA 4RPCA 3B7SA 1JDVA 3CO5A 5FNVF 4BKQA 1HU3A 4ILIA 1P5JA 4HNQA 4ZVOA 3ZRHA 3RUFA 4DR3B 5LJLA 4AMYA 1RBYA 3BU8A 1UK6A 3DPIA 2V5QC 1X5BA 1T43A 3AP2A 1GNVA 4NULA 2PL2A 3B7BA 1OB5A 4JMLA 5E2IA 2BYTA 1Y1PA 1ZJ6A 3Q7FA 5AVZA 2X6HA 2QEQA 2BFPA 4J0KA 5FZSA 4L22A 4PG5A 5AM1A 3VKUA 4B71A 1BE1A 4JLNA 3B6MA 5DK4A 1EFKA 1ST3A 1WCXA 1Y5RA 4FMCB 4OK3A 4R3UC 4Y9SA 4CNBA 4NMHA 2X86A 3GRPA 2IOFK 5TVGA 5E76A 1V1MB 3G59A 4C2UA 5CHYA 2PK3A 4NATA 4WBSA 4B7CA 2IDZA 3C8DA 3R9IA 3L79A 1EXNA 3EMKA 3Q10A 5B5SA 1T24A 3T3EA 1XMQB 2JNWA 1FCJA 2YQ4A 2ZT6A 3PUYA 6LDHA 4YK7A 2A5EA 1W0KD 4EW1A 5C37A 1ZB1A 1GZ3A 4U7JA 3W9YA 4F21A 4CIYA 4IKPA 1Y0BA 4ZVRA 3HBNA 3GCGA 1DAFA 1V3QE 1VL6A 3DKPA 3EFEA 3WP0A 3MBIA 2NZ2A 4IFTA 3K5IA 4RPGA 5F21A 4K1XA 3WGLA 1ZZGA 4QD3A 4KFCA 4E5NA 5DM70 3ICWA 3JWGA 2R8PA 1WMFA 4W9MC 5NLLA 4GXNA 4FK8A 2EEZA 4RM3A 5K0NA 3KPUA 5FNVA 5C31A 4L5IA 1GKIA 3AHDA 4ID3A 4TQAA 4EHLA 5FWXB 3QWIA 2H4FA 1QO0A 4J8DA 2IPOA 3SDSA 1TJ4A 1KOFA 1KTVA 2BM1A 3SKVA 3JYLA 5JD5A 1GZ6A 3EFOA 4QTUB 3G3EA 3UM1A 1T2FA 1QCDA 1V39A 1V5WA 3IEUA 4GCNA 2ACWA 4GRIA 3QRWA 5H68A 3LSTA 2VDWB 4NEHB 1N33B 4E5PA 3Q88A 3K16A 2V3VA 4HDRB 3FMVA 4JBYA 4KX5A 3RRNA 2UU9B 3CK9A 1OFHA 3JQ8A 1OI3A 4TXPA 3DVSX 3C3JA 3OJXA 4OYLA 4ARZB 5AVTA 3PSAA 4DANA 2FOIA 1KPIA 2VYNA 4ZOEA 1QIMA 4I5DA 2YINA 1YHZA 4MDHA 3SJZA 1KK0A 1YNOA 2XT6A 1VG9B 3HCEA 4FE7A 5AJVB 4C4ZA 1JAZA 2I99A 4KPUA 1VSQA 1XZHA 1NUTA 1EWKA 5LNK1 2GBIA 4WL0A 3QFTA 2H8KA 1W4BA 3ABZA 4YP5A 2X1LA 2ARKA 1NVKA 3HU1A 3FFLA 1JV2B 1LV8A 3EG5A 4PR3A 4PANA 1P7ZA 2X8WA 1V45E 2EFJA 2GPNA 3EK2A 4XQGA 1IY1A 2O23A 1WB6A 1YB1A 4BLVA 4U5QA 3ZDZB 4CLXA 2AXVA 2V7QD 4OFBA 2C7QA 1KAEA 4Y67A 4YRIA 1XEAA 2J85A 4I2NA 4C88A 2HV8A 1PSZA 2KE5A 2I1LA 2YTZA 4DCVA 3PC8C 2ZSIA 2GPJA 3SFYA 1T4CA 1ZM2A 1ZN2A 2Q4RA 3Q8WA 4LF4B 4LDPA 5GV8A 1SVXA 3VYSB 4YRDA 3PQFA 5IJZA 5KQRA 2EL7A 1ULAA 1R12A 1Z37A 2VTVA 1C9KA 1EVYA 4KQJA 3LRXA 2GWRA 4OJTA 2CYBA 5E8RA 5IK2A 4US2R 1BWPA 1I4TD 2K87A 1W30A 3B5JA 1YZKA 1L5VA 2I5PO 3NTUA 1U28A 2DHCA 1EZZA 2XECA 3NWOA 3OIFA 4BJ5A 1RZRA 3IAEA 1I2ZA 4LOLA 2B92A 1P5ZB 1SCBA 2WXOA 4EA9A 4H4DA 3R6LA 4TVBA 5TT1A 1VCOA 2NYUA 3L1HA 3VR6H 3PJRA 1GHTA 2P9GA 4ENSA 4NX2A 2OGWA 1Z2CA 4OHRA 2L9BA 1GZ7A 2CDRA 3K9WA 1T4BA 3N8GA 1L7EA 2E89A 2BAGA 3FEYA 2P4HX 3TWWA 1AS0A 3BXOA 5JIBA 3WKCA 5H9WA 4R9RA 2OMKA 1RYYA 3KEAA 4QQRA 1MOQA 4R1OA 4YCNA 5BOSA 4M22A 1K7SN 3WVNA 1ELRA 5G3YA 5IABA 2RGGA 3BYZA 2P58C 1GY8A 3CG4A 4QRHA 721PA 4Q5IA 3M6WA 1SZPA 3KR2A 3VZRA 1VJDA 3I6MA 3ZIAD 1UJ6A 1Q0LA 4EPRA 2WXKA 3BH6A 4PNPA 3EPLA 3ROXA 3OCJA 4DSTA 4PQYA 4B87A 1AZLA 1GGKA 3SZOA 2AK2A 1JYEA 4ZVKA 3ZLJA 3OTWA 4YXWA 3LDAA 2A67A 1I01A 5C3UA 3M6UA 5EINA 4RJLA 2HMTA 5F78A 4KIFA 3T0IA 2Q2OA 1RXEA 3ZJYA 5A4DA 4GI1A 1JDTA 5ALKA 3CT6A 4OIMA 1BQEA 2WOOA 4WZBA 3ZW7A 3WRYA 3ED1A 3EDMA 3J5PA 1J09A 2CKDA 5JBIA 1GL6A 1IOLA 1GAEO 3BD7A 1EUYA 1XNHA 2QDKA 3O48A 1HH4A 2VN8A 1OLOA 1OBCA 2VTDA 3AJAA 1G291 4GM4A 4YRQA 3U1VA 4EFMA 2BJHA 2BGWA 1UP7A 5JDIC 3U44A 1WXFA 2Q5CA 2RC5A 1KH3A 2VYFA 2R59A 3RRXA 1CUDA 1LPAB 4AG5A 3IPLA 3GLHB 3JZFA 4PG8A 4OP1A 3TLZA 1B8NA 4U6QA 4RVBA 1T10A 4PQGA 5DLYA 3ZDXB 3O0TA 3OZRA 1BTOA 4YONB 2BUGA 1R6DA 1XHEA 8ATCA 2VFAA 2GH1A 3O8LA 4X8MA 1AZSC 4NYJQ 5L3RA 2DPMA 2NWQA 3KZOA 4N6GA 2GB4A 1TTPB 3OWHA 2R751 3P27A 4AZTA 1S9DA 3KLBA 4FNMA 2IXDA 2MRIA 1GTVA 1MRSA 2H63A 2QGFA 5LWHA 3LY7A 2FSFA 4F5EA 2IF0A 2P68A 1H8EA 1G17A 4C4TA 3U60B 1NF3A 1ORIA 4ILGA 1HT2E 2OCDA 3PNBA 4XDYA 4F4CA 3MRXA 3BJRA 1HC7A 1K8ZB 1KO4A 1PO7A 4HP8A 2XDYA 4JLBA 4PFKA 4DSAA 4UTXA 4IQ0A 1R27A 2OHXA 2H2DA 3E3MA 2GARA 5IYZA 4LF8B 2O54A 4D9KA 3WMXA 1R88A 2Y1EA 3MA5A 3GO4A 5TRTA 3TOCA 4DRZA 3QSYA 3AHGA 1EB8A 5DLQC 5JBNA 3KWJA 3EMVA 2YJGA 4BO7A 3MJHA 1ZBPA 4KAJA 4GTRA 1PE0A 2VPYA 4IIJB 1MNAA 4KK3A 3TPCA 5KPDA 5BSKA 1OZGA 4OLAA 1NFIE 4OQLA 3OF2A 2C7VA 3I3OA 2RAPA 2DH6A 1QUEA 1BD4A 1U2ZA 1GG5A 3ENNA 4RMGA 4Z0HO 2Q2VA 3GFOA 4ENWA 1ONBA 3ORHA 4UMFA 4BGIA 3APDA 4R9NA 4EKIA 4U8HA 4LG6A 3ZWXA 1YFKA 3LDHA 4UU7A 2FF4A 3JCKC 2A78A 1I5OA 3OJWA 3P9CA 1VLVA 4UBOA 5G1NA 1VHLA 5KZMB 4K0KB 4UWHA 4LSZA 2BFAA 1Q16A 2ONYA 1O9BA 2FMXA 2HXGA 4Y6PA 4YT8A 1K8QA 4PRKA 3NVKI 1F51E 5BR8B 1D09A 4H7KA 1IZ9A 1RYMA 1PUXA 1WY7A 1JT9A 3ZHSA 3IP8A 1C9NA 3UJ3X 3W79A 1JA9A 1P62B 3INNA 4QUBA 1U5BB 5CT8A 3S29A 1A27A 4Z68A 3E0XA 5G0SA 2PUGA 2EX1A 2A1TS 3GYGA 1DJMA 4TM7A 4L75A 2GRUA 1A4XA 4OHMA 4WLNA 1LFDB 1Y33E 2IXAA 5FUVA 3KWLA 1M2EA 1WW8A 5ALUA 3P0IA 3D9LA 1OGJA 1VP9A 3QYFA 1U9JA 3F2VA 2CXXA 4HN2A 4A16A 2ZRLA 5JYCA 4IH9A 4G37A 3ZHXA 2HDOA 3H5VA 5FL7D 4D9IA 3TEMA 1ZD3A 4FLBA 4L2YA 4AROA 1IJFA 3WIBA 1XWIA 4N3NA 2YIMA 3PZ2A 2B8EA 3H2KA 5ALGA 2EYUA 3N2NA 3PZRA 3HXCA 2ONKA 5EPEA 3RSZA 3LVRE 1GL3A 4ZRDA 1K1BA 4ASUD 5KKNB 4MVJG 3WX0A 4DX1A 2NX2A 2D1RA 4R8MA 2YV3A 5EKSA 3CVJA 2AVNA 3R4CA 4G65A 4LK3A 4R81A 2REBA 4WESB 4MULA 2ATIA 2ZBUA 3RBVA 3C3XA 3RTGA 5LKRA 1NTOA 3MEKA 2FZ5A 5EXDA 1IYGA 2GYUA 2JI6A 3MXTA 1B8OA 2R1ZA 3Q41A 1ZXXA 2PZFA 3F6BX 4BWGA 1JB9A 1NWCA 1Z4OA 3F96A 4R2HA 1U2GC 1E59A 1HSZA 1U7DA 2PRKA 4ND3A 4DA8A 5I51A 2JDID 4AG6A 5K0BA 2FN7A 1DIRA 1DKOA 2GVDC 3FJYA 3L13A 1HS6A 4YRPA 4A92A 3MM4A 1P17A 1P77A 3OE1A 3JS5A 1P6UA 2BGMA 3PKZA 4NBTA 5LD2C 1G21B 4GZMA 5AI0A 1F06A 2AG0A 4QL3A 3DSTA 1XTZA 1LQTA 3OEEA 1XI2A 2O2SA 2E82A 1E3QA 1RVDA 2ZIXA 4MWCA 4EIWA 4A5SA 4W5QA 4UZEA 3ESLA 1H0AA 2JAXA 3D4LA 3KELA 5BO5A 4EM6A 2JGEA 5JJIA 5IW8A 1M66A 2P62A 3FF1A 3O1JC 5TS2A 2XPZA 3ESZA 3RC7A 2XZTG 1ULHA 5DHAA 4QBHA 3KQHA 3QNKA 1R16A 5FJIA 1EFDN 2ZWAA 1RXUA 1N5RA 2BGLA 2GZRA 2V65A 2IE8A 5HEKA 4X45A 3SNHA 5ICCA 3K6SA 1O8BA 3D3NA 3TIFA 1LW6E 2YMMA 1N1DA 1D6NA 2CL6X 1IAQA 4M8IA 4OYYA 5I4IA 1PJRA 1U3UA 2EX4A 1MDFA 4M21A 2QZAA 1BKSB 4F5YA 3O9VA 5I7SA 1RRPA 1T5HX 3WGIA 2I2DA 3T3NA 5FNZA 3HYNA 1RRFA 3JQRA 3CNOA 3TKLA 4AMZA 3HZOA 1HTTA 3SI5A 3L7MA 3M81A 5EJ9A 5KWVA 3HJUA 3HL4A 2ZI5A 1T4MA 3AF6A 3H5NA 4GMKA 4M9CA 2YJTD 4PC3A 5FI0B 5CBNA 1FQJA 2IYWA 2VZ8A 4Y2XA 2ERYA 5CCMA 3N71A 3D02A 2XWBF 3FUHA 2BDUA 1OZHA 3AUKA 3TZBA 4OQDA 1LTXA 2VRWA 4IQ4A 2CNLA 3OM0A 3D4IA 3SHQA 4Y6WA 1V9CA 3G1UA 1GTJ1 4LJ9A 2CD7A 2GASA 4BLRA 3KHKA 1M2JA 1P44A 3H5IA 4KQ1A 3Q9UC 1NVGA 4JL5A 2CHEA 4EPVA 5LZ5A 1GGVA 2M1XA 3PWZA 1SUCA 1RYBA 2ZTVA 1W36D 1G2PA 2JZOA 3D2LA 5FOUA 4CV2A 4YJ2B 1YRWA 2PZEA 2UYQA 4Y2PA 1DAGA 2A9VA 2CJPA 2G6TA 1MO6A 2NQTA 3H9JA 5TS3A 4IV5A 4XLTA 3WLQA 1SD5A 1PVVA 4JUAA 3D6JA 5DK6A 3TRJA 1YQUA 2OPBA 3JQDA 4E08A 5A5FA 3KXPA 3WLFA 4H7IA 1KYXA 3AR4A 4TROA 2EW2A 1NQUA 4MZDA 4RMIA 5B53A 3I3SR 5LA6F 4KSBA 5ADWA 1E9FA 1T8TA 1DKPA 1FMJA 1OXJA 5CYOA 4HNUA 5AVWA 3WNZA 1W4RA 2JD2A 4LGCA 4UOQA 1CR6A 3IT0A 5C81A 2J1LA 3OPNA 5DCLA 4GKBA 4LC9A 3DOEA 3QBEA 3H11B 1CIVA 2H48A 5IT0A 4KV7A 1DC7A 3FZGA 5BN3A 3BRCA 3GMTA 2WJIA 1QTRA 3IH5A 4Q4JB 4E15A 3DC2A 1TM4E 3M0EA 5L53A 1I0ZA 3DKVA 4UNPA 1QRTA 4J0EA 4RF3A 4BKRA 3QTBA 2B5WA 1IN1A 1O9GA 2XH8A 3U3JA 1ODLA 3OQMA 3CKYA 1KVRA 1RYZA 3I4RB 4TS3A 5K9ZA 2C2YA 3C48A 4J3FA 1IEQA 1W94A 2G72A 4PCAA 4RF2A 5FJJA 3TZCA 3CLKA 2E55A 1WY6A 4FP7A 1Q0SA 4TWAA 5GPBA 2QVLA 1J90A 1W88A 3OJFA 3BZUA 3I1IA 2B35A 4G5SA 2K2WA 1BYIA 5JNRA 4V0MA 4DS3A 1PV2A 2A5DA 5B1HA 3TAHA 2ORYA 3JYSA 1AQYA 4WXPA 5K8TA 5LZ9A 3FW1A 3PNTB 4CMJA 4DCPA 5CA1A 1B3BA 5IAAA 3GH3A 5D1NA 3JRNA 5F12A 3QI2A 4QYSA 1F9EA 4JC4A 2FPGB 4TT3D 5AHXA 4CCYA 4Q15A 4D4MA 4JP3A 5KI6A 3ZU6A 1UPUA 5FOSA 2QTNA 4GDFA 4GKJB 4GKKB 1N92A 4AZWA 1XLVA 4Q7MB 1ZIPA 4TV8B 4GQBA 4U9HS 4MMZB 2PGOA 3NETA 3UG6A 5DNCA 1X81A 5JE8A 5IDWA 5JAPA 4X41A 5K6AA 2F3SA 2W2PA 3G9UA 4F84A 5FOQA 1O1YA 1DG1G 5EIEA 4Q9DA 4MI1A 3OOHA 4H7JA 3TRKA 2NMVA 2UVQA 2I67A 2PFSA 3SVZA 3I34X 1FXUA 4CF3A 3TCNA 1PVOA 1QU3A 1JFFB 3DFKA 3L0SA 5JPCA 1E4EB 1XF1A 2NSDA 2VLBA 5AK6A 4CPDA 1N2IA 4WY2A 1PJLA 5HQ3B 1P2TA 4X1IB 2GZMA 2WF7A 3QXGA 4BX2A 5J5VA 2OG1A 2IXFA 3AR5A 5TQJA 2NZJA 3U09A 4D2IA 4BTAA 4CHTA 4DTCA 1SVOA 3TTTA 1JAHA 4OHWA 3DVQX 1QAOA 4XX1A 1KARA 1GSIA 4G1FA 3A8TA 5LFAA 2I3DA 2O2DA 2F1RA 4I4LA 1QZ2A 2Y9MB 3HKCA 3KL4A 3HUEA 3NJ4A 2D7JA 2F17A 3PUIA 4UUOA 4HEHA 3HBAA 2YINC 3X0DA 4F0JA 2CV2A 2C61A 2OKCA 3A1CA 3LBFA 3FKSA 4E11A 5KOJB 4HEA6 3ABKE 3PWTA 4YREA 4M0PA 4W7HA 5E9WA 5G02A 4UHDA 2KPOA 1S6YA 5B7GA 3THOA 4PSKA 3W90A 4A1SA 1XAGA 2GJSA 4RKYA 4K5QA 3RC9A 5JSZA 4IQ8A 3QYAA 2WLTA 3T5PA 3THYA 4UZSA 2X41A 2J9GA 4XYGA 5JS6A 3NYIA 2XCIA 1XXHB 1QPGA 4PYJA 3FMFA 3H9BA 1XROA 1NT2A 2EP8A 4WK6A 3VHLB 1R9JA 5CW1A 2DVWA 3H97A 5IAEA 1G38A 3QQPA 3DMRA 2H59A 3EGXB 1UBGA 2Q4EA 2B69A 4Q1BA 4B2PA 1A9XB 1U2DC 3CLUC 1L4HA 4HWPA 4JQSA 2H1SA 4MQ6A 1N8SA 2F3UA 4MQEA 4WVLA 3UAYA 1H19A 2JI9A 4KRYA 4N0EA 5FBWB 1N0IA 5A7GA 4B73A 4CM5A 1QRSA 1W44A 3HVJA 3LSYA 1JW9B 2DRIA 4PSCA 3R75A 2X38A 2IX9A 4KWTA 5BUCA 4V3BA 4RK6A 5LMUB 1NVVR 2XCQA 2P40A 3QUAA 4S0XA 3GHHA 1SUEA 5IDYA 3EHMA 3UJ8A 1EESA 1A7KA 3NHZA 2D2FA 1JWFA 2GRPB 1D2EA 1DLIA 1Z12A 3JWIA 4ZGGA 4FHFA 4RQIA 1QHHA 1OFUX 2PWYA 1WNFA 5G0UA 3DOHA 4TL6A 2WYUA 1Z8HA 4B76A 4QFCA 2YXPX 4WDQA 1P3DA 2ZIAA 4AJOA 4TPKA 3RD5A 3E3OA 1O54A 3JPYA 4R83A 2CVQA 3NDBB 1HNXB 1K3TA 2PMCA 2OC4A 2H57A 4HDSB 5EKTA 4CTNA 4TVSA 1R1DA 1CNFA 1W0KA 2XT0A 3K1AB 1RAGA 3PIDA 4P86A 4XDZA 1F3LA 1JUDA 2CDCA 1N4DA 3LOUA 2VRNA 3R74A 3SEQA 2PVSA 1H66A 3DBRA 4A0HA 3ESAA 4J4HA 4WBNA 3LVBA 3LLCA 2WTEA 4GX0A 3S2SA 5A62A 1EDUA 1TEXA 1KEZA 4TUMA 2GZ2A 4NFLA 3I5PA 3EODA 4BNTA 2IEAA 4EUHA 3GZTB 1U63A 1GUDA 4TV9B 3OWXA 1FTGA 5H4GA 2XTJA 1T0UA 3KUCA 2WXNA 1NPTO 3SDBA 1WHSA 4JT8A 1F12A 1RLMA 1ZM3A 3FPBA 3T61A 3L7BA 3MZ0A 4GLBA 5CNIA 3ZCXA 5AQ1A 2J3JA 4Q01A 2VP0A 3LC0A 1E7SA 4LW8A 2I4LA 3SJCA 2AJ8A 5BRJA 1CE8A 4LNGA 4FS3A 4TS4A 4ZZ2A 3VZDA 4KVGA 1YUMA 1BCSB 2PKEA 4EF4A 4KTVE 3PHBE 2E1PA 5AWFC 1COZA 3HS3A 3NPAA 4X1YA 4ER0A 5I7HA 1A5BB 1G55A 3IX7A 3NDJA 4RSYA 2CLLB 3BMOB 1NRXA 2GZDA 2QM7A 3CU5A 2LDBA 3G9ZA 1P45A 3G2PA 3PR1A 4KMRA 5E4FA 3RU2A 1PG5A 3DZIA 1T5LA 3ROZA 2ZQZA 4XVUA 2FXVA 3D6MA 4U0SA 3KIPA 1Z3YA 1E98A 2MHKA 2Y4UA 3GOQA 1AT1A 5JHAA 1DXOA 1RM0A 2VXCA 4IDBA 5HQJA 1KDVA 3D3EA 1IM8A 4G0QA 1RC1A 3PRKE 2UYGA 4CM8A 3KLPX 3SZRA 4JVMA 4W1PA 3BXGA 3R9MA 2JK1A 4OG2A 4X90A 1F5NA 1VL2A 3TL3A 3V2GA 2R0QC 4HDNA 2A7QA 3CHMA 4HRMB 3SYLA 3WWPA 1SUFA 1J1IA 2TECE 4GOLD 3E22B 2DKOA 3VQTA 4C43A 3EGDB 2W8BB 4D46A 1QRDA 2F9FA 1C9MA 2FFQA 2OV1A 2IE0A 3FFAA 3PHCA 4ND8B 4OV6B 3HUDA 4DJFC 1VPLA 3E5HA 1DT5A 5CXXA 2F6RA 4M87A 4KPEC 4D43A 4LYFA 3LG2A 4G0PA 1UJMA 2IPAB 1R0BA 1XEWX 3VTZA 3BTUA 2AG5A 3GNTA 2ZTUA 1MTZA 2Y69E 2BM8A 4A3TA 2VDVE 3G2JA 3QUTA 4OTZA 1W88B 2J0SA 5EGNA 2QFCA 1GA4A 2AB0A 4CM6A 4E2ZA 5AXDA 1JJVA 4EH1A 1YZUA 2I6FA 2CMFA 4O4LB 4DLYA 4L16A 3W2IA 2IHUA 3ND7A 4M1OA 2JL1A 2QTGA 1BD8A 2OESA 3LQ4A 4KXYA 2JJ2D 7REQA 4B93B 4Q1CA 5CYGA 3BZBA 2QRLA 4FIZA 3R5KA 3V4SA 1Q2UA 5DBEX 4CQJA 1SKUA 1GARA 2X8JA 1KYYA 1DOZA 1FNSA 3GLFA 3QOXA 1N0WA 5FTMA 2HA7A 2PH7A 4L5YA 1YCHA 4BGVA 2JKVA 4E1VA 2OXIA 4NPHA 3IDSA 3EVTA 3D6HA 5AICA 3CUWA 1QP7A 1TCUA 4X1OA 4Z4CA 2BGIA 3BL5A 2XZTA 3LMKA 1N25A 1R4NA 2Q21A 1CRPA 4PC7A 2FEZA 5EIBE 1DMRA 1FYEA 1X0XA 3Q5GA 4YNBA 4DAOA 3FTXA 4CLEA 5BXQC 3EG9A 5IPFA 3T3OA 5LC1A 4B8AA 2B5OA 4TRRA 3V48A 5CG2A 4PC1A 1I7PA 4HZUA 1UPCA 1EVQA 1NKVA 1VL1A 2G77B 1D03A 2N47A 5TEVA 1JDNA 3T7IA 2C4HA 2AQIA 4EZJA 4L0QA 3WLSA 2GJAA 4QKQA 5J47A 4ZQBA 2PSSA 4ZOAA 3V2UA 1Y8RA 5EI5A 2V1XA 3RUEA 3M33A 3JYPA 3BA1A 1IBLB 5DMXA 1CZRA 4PICA 1P4AA 4M2LA 3V80A 4ZV7A 3TWUA 5H82A 1NBHA 2VCHA 4P92A 5DKFA 4HBGA 3RHSA 3WMGA 1ESCA 3ZQJA 2PO7A 4N9QA 1ADJA 3UMCA 3WL8A 1U1EA 2YZMA 4LVCA 3SHVA 1EMDA 1O6GA 3QITA 4IYJA 4RM2A 4F9FA 1PQPA 3ND8A 5C51B 5I7UA 1AUXA 1Z3XA 1ZJZA 2GBPA 3AWDA 3KB8A 3TFWA 4D96A 5KIAA 2NUBA 1IE3A 3A3PA 1KE1A 4FA6A 5ALLA 4DLKA 3RF7A 1JU9A 5BT1A 4QXOA 1ISSA 4CCWA 5G3ZA 3DSRA 4RFLA 3OTIA 4Y2TA 2KLBA 1WDWB 3C14C 3G5UA 2JGLA 3N6XA 3ZV3A 2RAUA 3ZDCA 4WZBB 1IVSA 5LQSA 4K6CA 4Q9AA 2P9YA 3TAXA 4AV7A 1AKWA 1N9GA 1PR1A 1T9BA 1AE1A 2HMYB 2QX6A 3I4CA 3A28A 1C30B 1NJ5A 3DOUA 3I9LA 4IF6A 4L6IA 4QPZA 3S1AA 4CGYA 4BKUA 1P7WA 3RQIA 2H29A 3VJKA 5AI8A 1WDLA 1YHYA 2C04A 4FJ0A 3LWZA 1YZNA 3DZGA 2CNNA 4GSLA 3L6DA 4IZHA 3RS9A 4B80A 2A2ZA 2HL6A 4R51A 2OPHA 4ZVSA 1IXRC 5FWDA 3KLNA 2OGZA 3V2XA 1WHTA 3IB3A 1I6LA 2PVPA 1GGFA 2C4VA 4GPD1 5DCYA 3I2KA 4RD2A 1P8JA 3THXA 3BHIA 3M9WA 1AH2A 5B3JA 1A9XA 1CJCA 5IRCD 4C7OA 1JMKC 4BT8A 3PD7A 3Q8MA 5C1DA 1YMQA 2BOVA 1UN9A 3VTYA 3FLBA 3L77A 3R5TA 3S1AB 3NT2A 4BFUA 3BG5A 1YJ8A 2O06A 4JW1A 2VQ6A 3GEGA 4TSRA 5H70A 4JY7A 1ZD1A 4K9SA 2QLJA 4MWEA 1QB7A 1JHOA 1D7OA 1N1EA 2VTBB 1U0OC 3EWNA 1G9TA 1NUUA 2JCXA 3K05A 2HJSA 1U0RA 4BYMA 1QNFA 1J23A 4X97A 1XZAA 2YICA 1FDVA 1G3QA 5DSXA 5I9MA 1YT5A 2PH5A 1XSEA 3JUEA 4OH1A 3CR8A 4F2HA 5LR6A 3RYTC 4YDWA 4PQRA 1L4NA 1PKEA 2UYOA 2ZYDA 4J90A 2DFPA 4M9UA 4QWWA 4AQYB 3H8WA 1ZI6A 1JTVA 4V1CA 1VHJA 1YFZA 1DCQA 1MF7A 1SCUA 5DN9A 4BXOA 1F1JA 1TNZA 4PZAA 5ADVA 4N6OA 3PGXA 5KOHA 1WBJB 3RFVA 2WQHA 1K8YB 3FY4A 2F67A 4IUDS 3OHMA 2F43A 3ZD6A 2VQ2A 1WAMA 2PRZA 2PNFA 3HKEA 1D0SA 3OLCX 5CDFE 3O31A 1VMKA 1C7EA 2ZOSA 2G5TA 3MT7A 3UW1A 1PRYA 4BVFA 1ELWA 1QGOA 3WS7A 1KKLA 2ZYHA 4W99A 3TXXA 5L4SA 3Q8KA 1YI8A 4Y2JA 4GYWA 5ER9A 5GWXA 2I4MA 2C9ZA 2HHAA 3LP8A 4MW4A 5ES4B 4MS1B 1L4BA 1PSWA 4LRUA 2VHZA 1IHXA 2VL7A 3CVNA 1OIXA 2O4UX 2O8NA 4I4IA 4MRMA 2V8OA 2X0EA 1CK4A 2RGBA 1XO1A 3DKRA 5HJ7A 3PGKA 4MW1A 1W4LA 2NIPA 3VOBA 2XAUA 4J7AA 1TX4B 2OGSA 4ZCTA 1ZR2A 1LC0A 2FW8A 4ZAZA 1EX9A 1L2TA 2H06A 1N7HA 1E9VA 3KZKA 4XARA 3WQRA 1VCMA 2C8VA 3HH8A 3RJMA 1PR2A 3VVLA 4F97A 4FGZA 1YZVA 3AUSA 1I14A 3EA0A 1T8YA 2AMJA 1GKYA 1M6WA 4WCFC 2ZXUA 1WXHA 4G4SO 2DMRA 3GLUA 2HZ7A 4LJRA 4OJNA 3OTQA 4PPQA 3P26A 1BD3A 3WIUA 2AI2A 3VO1A 4DV3B 4PE5B 3N8KA 3DEYX 4DUYB 1KY2A 4IRUA 4N9WA 1LV7A 1PG0A 1HM5A 4DV5B 1A98A 1ULUA 3OSZA 3GDGA 1WPXA 1XEXA 2HNBA 1D1TA 3AKDA 3DZJA 4J1NA 5AJUA 3V8MA 3A6JA 3KSZO 1E5DA 2XUKA 5EE5B 2PUJA 4UASA 4I4TF 3BE6A 1XQXA 4L85A 5LZ8A 5C1IA 5K8VA 5KU1A 1XRSB 3HZHA 2GXAA 1FLNA 4UNSA 1QBKC 2QJWA 1G6HA 4N7MA 1SA0A 1OH6A 5JEDA 1PS0A 5F33A 3UKDA 2QTHA 3UIEA 3W5JA 4AC9A 2ZS9A 1NW7A 1ZNZA 2VNAA 2IYLD 3N86A 1AGNA 2C99A 2E4ZA 5JSKA 5TPZD 3IODA 2HF8A 1U81A 2O5EA 4UUBA 2VT2A 4C4SA 1E7RA 2J30A 2VJPA 2Z8YM 3LHDA 3W6ZA 5K0GA 2ZUSA 3ENQA 1RWWA 5DE3A 3G2NA 5JSHA 1X7WA 4QOIA 1MX4A 1NPDA 2AFIE 2FUNB 2QMUA 4LRYA 5IDVA 2Z4TA 3NIGB 3V8NA 3GLGB 1J9GA 5C8XA 3TUIC 2ZUVA 3TOSA 3K70B 4CKEA 3C6KA 3LK7A 3QF4B 4MLZA 5DGTA 2H1WA 3BE8A 4HGZA 5BSGA 3UICA 5AVSA 1KDPA 4CN8A 5I4CA 1B2LA 4G0UA 3CNQS 1ONPA 4F4UA 1FYXA 1JP7A 4Q3DA 4GUAA 1Z0IA 2FO7A 2DBVO 4PSVA 1ENYA 3D5QA 1BA2A 2IHBA 4O8CA 1E3DA 1RBQA 4K81B 1K6XA 2EDAA 1P0CA 2FHSA 2HZBA 2ZLBA 3CPSA 4K3VA 5HYVA 2B98A 3W8RA 4B17A 5JY6A 4UUMA 4CT5A 1OTHA 4GHWA 2GNAA 4LWPA 5G41A 1G8YA 9MHTA 4I46A 3VGPA 1Y7IA 4I4TA 1SURA 1USVA 3GCZA 3I5MA 4WK4B 4DEXA 3QJ5A 1OW3B 3LS8A 1PS9A 1U0TA 4PPGA 3E0QA 3L22A 3K2BA 1FX0B 2AXNA 3D6VA 4JI3B 1ECFA 1E61A 1F6BA 3PGA1 5CVVA 4GUDA 3G68A 1F2UA 1RMYA 3DDCA 4NXMB 2ICAA 3MMSA 4A7PA 3BJMA 1WW3A 3G2IA 1E6EA 3LUHA 4BQEA 5KINB 1B0PA 4WECA 2HHJA 3T5BA 4KQIA 4JELA 1EAYA 2XVAA 1LDGA 1NRIA 2VJMB 3BDAA 4CDGA 2IXBA 1U4NA 3DMNA 3O91A 5I45A 4FYKA 5DFAA 3H19A 4DMUB 4D9BA 5JJ5A 2Z6UA 2BUCA 1FFXB 2J3EA 2OOEA 2Y93A 3E9YA 5A0FA 5LBTA 2FPXA 4DT1A 4QYIB 1JEQB 4JZYA 1QFXA 2BRUA 1G5IA 4WTOA 5DZSA 5FUXA 1RLJA 4TL7A 3QLUA 1C4KA 4BO3A 5J58A 4ZI7B 1C7JA 3VZSA 1KI1A 4S1NA 2IEDA 1VRVA 1GPAA 1Y9ZA 3HRIA 1B74A 3HVRA 2ZJ2A 3AY6A 1D4AA 1AMNA 1RI4A 1JLLB 2POCA 4OVUA 3AIOA 4CKXA 5IZ4A 2I62A 2NUTB 3OFJA 2AYXA 4PEVA 5AVKA 1CDOA 3D2BA 4R1QA 5HRAA 1EK6A 2IHJA 5I9LA 2AQHA 2FRDA 4F53A 2JCVA 2R4UA 3MTQA 3VLEA 3BSWA 1CR4A 4OEHA 1FSPA 4Q16A 2O5RA 1V47A 1DDIA 3GLFB 3FDIA 2DHRA 4QNMA 4RD0A 4UPEA 1L7NA 4F4FA 1E3WB 1T2VA 1HYHA 1L5HB 3JAMA 4LG1A 2RG7A 2DQZA 1QYIA 3BWBA 4WWOA 3HJRA 3RAGA 1CJUC 3HDTA 1NM5A 2JDIA 4CKBB 4DA7A 2YQ8A 5JPIA 3KDPA 1QQ7A 3LQRA 3HEMA 7ADHA 2ZJOA 2UXCB 1NI4B 1Q2ZA 5FQ6A 4PLTA 2R2GA 4CLRA 4CIWA 1TMGE 1G64A 1UBHS 2CZCA 2RARA 5ALDA 3U40A 1FUKA 4C4XA 3NHLA 2GRRB 2ZVJA 1WUHS 1L1RA 3CF6R 4JVSB 5DYNA 2RFAA 4GE3A 3WO1A 3G89A 4B81A 1YL6A 1J0XO 3D7MA 3DE0X 4UAGA 2EL9A 1IN4A 2BEUA 4AJHA 3OQIB 1UBKS 2WOJA 3IQWA 4PS1A 2Q29A 4KIGA 3I9NA 1MC1A 3LW7A 1G2QA 2G1AA 1BX0A 1XMIA 1M1ZA 3HXDA 3OX3A 4L4ZA 2QQ0A 3RT1A 4F1JA 3H65A 4O0MA 2A35A 3A9RA 2IOHA 1Z6ZA 1YB7A 3PTLA 1JKIA 1TVKA 3VSBA 1QG6A 3GEBA 3FCAA 1Q11A 1FPQA 1PZHA 4KHZA 1HE4A 1GAJA 1YRQA 2A5YB 2HRZA 4Q12A 4EPYA 4IV0A 4F91B 4POAA 4PLGA 2R47A 5B1IA 5BW8C 5KB3A 1R66A 4XIJA 2V4HC 4MLCA 1CS4C 1JDBB 3WYDA 2BTQB 3O03A 4L76A 3ZWPA 4A0GA 5CDSA 5F73A 1DIHA 4RLHA 2WM2A 3C8MA 2KYRA 3MMPA 3T4UA 5HQTA 1W2HA 4MRSA 3A58B 2DPYA 2UZ1A 2Q27A 2OBMA 2VJLA 2BEWB 2W6IA 4YAWA 3D9IA 2CL0X 1YMPA 3A36A 4MQLA 3MV3B 4PS8A 4RH3A 1HE8B 2N1BA 4ZKDA 1UFQA 2AMLA 1N0VC 1SA0B 3DAOA 4B46A 2H9AA 1TJPB 1RMTA 1R50A 3DO6A 3R40A 4GSKA 4YRAA 5JY1A 4LFBB 5H3HA 3NQ41 3AEYA 2CLCX 2WJPA 2BH9A 2XB2A 1ITZA 2CBZA 2WT8A 4IH1A 2H3EA 4WOJA 3HRAA 2GFHA 1L8LA 2JF0A 4OJKA 4Y2HA 2BGTA 1GZDA 5E4YA 1TD9A 1RM3A 2WXHA 1CJBA 3O47A 3TTUA 5HOQA 2DHEA 3K0FA 1L5KA 1BHO1 3OJ0A 2X23A 5KTNA 4PAMA 1CPYA 2H1FA 3GRKA 4GLLA 5BYBA 5JYBA 5M29A 2R7KA 4R7ZA 1N6NA 2WVJA 2HSZA 3I5XA 3GNQA 4KVZA 1X1DA 1YTLA 4WWNA 2DEUA 1BQ4A 4WDRA 4M1YA 3DL0A 4IJMA 5DSZA 3HCCA 1QZ3A 5DLEA 1MAVA 5FEMA 3C3EA 1E6KA 2BMAA 2YNMD 2C4KA 4ZOBA 4KW7A 3MD9A 2C4UA 1V7QA 2PEZA 3E15A 2YWCA 3FGZA 3MCUA 4A6PA 4WFQA 1PW5A 1YZFA 2QD3A 1CHDA 5IP5A 5B4TA 5K8JB 1E5TA 4NXNB 4KR2A 3N75A 3NASA 5HG0A 2XGOA 2R87A 3TZHA 2PX6A 3GUCA 3IVRA 3BIOA 2BT4A 1TPYA 4MJLA 4QUAA 1Y4ZA 3TQQA 1J07A 2FG6C 2OP1A 1XN4A 2VWQA 2ZDQA 4WOBA 2Y92A 1XPOA 4B4VA 4DQ0A 4F8YA 3G6WA 1N9KA 1JYSA 1SXJD 3D7SA 3N2KB 3ICEA 1FX0A 1BWRA 3QJYA 4HAWA 3T4PA 1S2MA 3GGSA 3C8HA 1PK8A 1HZZC 3MUEA 1TC2A 5EJEA 2PRJA 5HK9A 1MTOA 1N9GB 3DEOA 3FOBA 3HYLA 1JDPA 1FP4A 1CQXA 3PXGA 2P78A 4BB9A 2NC9A 3MWEB 1I1NA 1I24A 3Q7RA 4B8WA 2DZNA 1P1HA 2FZWA 5CX1A 3WICA 1WL8A 1YYHA 1KSJA 1Q0HA 4KGXA 5DTIA 2QAJA 4B35A 4BBZA 2C1ZA 4CKYA 4WX2B 4EVQA 3MIZA 1NR5A 2W83A 4XSHA 3HN6A 1P2BA 1J6UA 2Y8EA 2YUIA 4HN4B 2NYJA 1BJRE 2L6BA 3IAHA 4YCJA 1J33A 1I80A 1H8HA 1T1GA 1EE2A 4IRXA 2HY7A 4WSOA 3TQCA 1G7RA 3NRCA 4GI7A 3LNTA 5AVVA 4DR7B 4MW0A 5HS6A 4DMKA 1N78A 2WP0A 4IOKA 1S0PA 4HGQA 2BCEA 4DQVA 2PY6A 1I32A 2GVZC 3FVRA 4WKPA 4C89A 4BB0A 2O5VA 1O2DA 1BS2A 1P0MA 4XI9A 4O3MA 3DLHA 4TGLA 2OM2A 1VCNA 4ZQHA 3QI7A 5B1YA 2G71A 4Y2YA 3W8DA 1BVYF 4NU8X 1U0FA 2QTZA 3A6DA 1Y8MA 4PYIA 4FIDA 3E6AA 2BDEA 3DFZA 4NFHA 4P4SB 2JASA 4DMRA 3OQVA 5IF3A 4MDFA 1C81A 1LF8A 3OHSX 4J0CA 1R3DA 2ECKA 3AR3A 3WLMA 2ZSDA 3GVCA 3M9XA 2PZIA 2IXEA 5I7RA 1FP1D 2AX3A 4TT8A 2ADFA 3UF0A 1VA4A 4IEEA 5UKDA 4ZI3A 3RSEG 2A9RA 5SZIA 5GV7A 1E7VA 1OREA 4KZPA 1HE5A 2GM5A 3TOVA 1B26A 4ZAFA 3SYTA 2XZDA 3DOFA 3PQ8A 3JQGA 3R6WA 5ITVA 1ZRSA 2FFBA 4EG8A 4IX1A 4GOJA 4X54A 4O2AA 3V55A 4E51A 5SZKB 4J7WA 2OV8A 1KJYA 3UJAA 4BNUA 1C8KA 3DEJA 5GAJA 1IEXA 1P74A 3GJRA 5LNK6 3EQ2A 1NYTA 4BCDA 1EE9A 4HFGA 4LY6A 4U2GA 3EX7C 4DLVA 2QU7A 4QEDA 1XPJA 5TMBA 1NL4A 2YKGA 4BFRA 2CNOA 3T0FA 3G2LA 3TWQA 2BC9A 3BFPA 3TZ6A 4QYWA 3PK0A 5K20A 1IHDA 2H0QA 2Q6OA 1ZN8A 2REQA 5ANRB 1L5WA 3ZWCA 1ZGZA 2DLNA 3KG2A 4YGYA 1H2BA 1JG2A 3WLHA 3FU5A 5GZ3A 4NS1A 3W3AH 1E99A 3O0DA 5JYEA 4I55F 2HO1A 3E61A 1QG2A 1EVLA 1A0OA 1TEHA 4EGFA 1BXGA 2BFOA 2CMKA 1Z6QA 4H17A 3LCJA 4WLFA 2Q49A 4DUIA 4HR7A 1CEQA 4M8KA 5EZ5A 3WGTA 3HLTA 2DLCX 3I45A 2P9UG 1YJAA 4ZJYA 1YWGO 1RLTA 1ONOA 4KSYA 2W2XA 4NMWA 4Q9HA 6ADHA 1FFDA 2Y0PA 1SVNA 3K0CA 1C2YA 4M8NE 3Q8LA 1G7SA 3N76A 1RWMA 1G7CA 3VGJA 3ZHBA 3FE2A 3HVIA 1IBKB 4EYSA 1WEHA 1JG7A 4S2UA 3GCXA 1CUCA 4MYHA 1KO8A 5ENPD 1XRQA 4IFIA 2DQSA 4KN8A 5IZCC 3E37A 4YASA 4CMEA 3A32A 1MQAA 1OGYA 1DPGA 1NFRA 4U7TB 1Z2AA 2EWVA 4AN1A 2H8GA 2HEGA 4R6XA 3SX4A 5A4MS 1J5XA 1RFLA 2ISSD 4LSMA 4HNAA 3D9KA 5HFAA 5K7SA 4KQEA 2JIPA 3LBNA 4AO6A 3LHKA 2XIQA 3M1YA 3QFCA 4F04A 2WU0A 4QODA 2B8WA 2XEVA 1EIWA 1IXVA 3ZHTA 1AO3A 3BGDA 3WBKA 1YACA 5EEGA 3K4QA 1N3BA 1PWZA 4MQBA 2C92A 2FDXA 3ZD9A 4DLAA 1HFAA 1G3UA 2C95A 1HE1C 2JIOA 2Q1UA 1KH2A 1IWPB 1XDWA 1XA4A 2QUJA 3RFFA 4YAKA 1B0ZA 3H5AA 3ISVA 2B37A 3EPRA 1R8QA 5FL7A 4H1HA 4LXTA 2GLTA 1GCUA 5CVUA 2JAWA 3KLMX 5DF1A 3VR1A 3EQ6A 4I8DA 4W4TA 1AP7A 4DDMA 3LI2A 4OFXA 1ZNYA 2X7JA 4ALKA 3WLAA 2WSLA 4AIFA 5EKUA 3GC6A 4BFTA 4EI2A 2VPZA 4F56A 1KJQA 3AX6A 2JCYA 3LDZA 1E0DA 1QWSA 1HYGA 3H1FA 3OLVA 4M7RA 2NG1A 5BSTA 2EP7A 3RG8A 3UM2A 3W05A 3DTVA 1MX2A 1B15A 1DARA 5A3SA 1OGIA 3I32A 3OPQA 2IUTA 4YPFA 2OV3A 5IVDA 3E81A 4UQYA 2CVFA 3HGMA 1U6KA 4QQ8A 2VDRB 4FDLA 2YWHA 1L4UA 4PZUA 2QRUA 3W5CA 1RKUA 2RK4A 1DAIA 5TQ2A 1W5EA 3IT2A 3OIVA 1HURA 1F17A 1JZTA 1Z8NA 2RAVA 3GEDA 3R5SA 3SPXA 2GN6A 3CF4A 3FVQA 3VR6D 3F6YA 1A9PA 3MWDB 1WB9A 3V1MA 4Q3LA 4ESHA 2ZAIA 2QVXX 3HYSA 3U80A 3JQFC 2OORA 1X1SA 3C3DA 4R84A 1K7EB 1CP2A 3U3ZA 3OTNA 3KJHA 2FE1A 4D8XA 4KDRA 2WNHA 2ZTHA 2I6HA 3P9IA 4CU5A 3AF1A 4R2MA 4UQLA 3FJ1A 1XXHA 5T4EA 3SHTA 3GGPA 1TKCA 4BVAA 1YONA 2ATXA 1O97C 2HHLA 1TU3A 3E9QA 3QTTA 5C8YA 3NOXA 3TBFA 3OLQA 1G5HA 1GU7A 1VJRA 4J76A 5BQ3A 4ZTZB 1KPHA 2ORED 4LXQA 4FR0A 4JEIA 4RKEA 2OCCE 3TUZC 1XC7A 2N0SA 3R7SA 4ZXFA 3ABIA 4Y2QA 3T3HA 3TOZA 3EF0A 1K9VF 3DLPX 3DTVD 3LUDA 3M4JA 4OP3A 5ULLA 4WGGA 1Q77A 3PPXA 3TTXA 3X44A 1J0BA 1TJ3A 2WYIA 4E2YA 3SIPA 3WRXA 3DDUA 3PHLA 1ABBA 4TKLA 1XZPA 2XNJA 3FD8A 4PZEA 4ZDWA 2OCGA 4EB8A 4EY4A 1KAQA 4L2IB 4QTYA 1KZHA 2GPSA 1RQGA 1P4GA 4ERNA 1NUHA 2OHFA 1Q92A 3G9TA 3LUKA 4YI3A 5CAEA 3V34A 1R6UA 3LO8A 3CVPA 1GWNA 3E9ZA 5T8KC 2L0TB 2OXCA 1CXZA 5HFJA 4ZMSA 1PP4A 2BGNA 2PNJA 4ZCQA 4Q1DA 4MTLA 4TTTS 1E5LA 1XRLA 2HWXA 3KSBC 1R4MB 2L19A 3MJ4A 1L6RA 2EFYA 2R68A 1LRJA 2Y05A 3N59A 5EL0A 5KHOC 1UXHA 3O8OA 3I6BA 4R1NA 4X8OA 4FGSA 1KMQA 4IILA 3DCNA 1SVIA 5K8CA 3ANLA 4INOA 5JO9A 4FOOA 3TB6A 4LYHA 1WCIB 5BV2P 1ZSVA 2VAXA 3HQ4O 4N5QA 2ZPTX 2R1VA 1PL6A 4B6GA 4EEZA 1XMJA 3R9WA 1HKHA 1HORA 3IDFA 1XL1A 1DV1A 4ZK6A 5DX1A 1UDRA 2AX4A 2IQIA 1H6DA 3B8HA 3KKMA 4JP2A 3R0QA 3ZXUB 3I0MA 3ZDBA 5CLJA 1M72A 4A0QA 3R41A 3ZDRA 1HDRA 4P80A 4Q7EA 3VPGA 5FX2A 2GD2A 2ZJ6A 3D3WB 3JQGB 3QE0A 1THMA 2FPKA 3PXXA 5K0SA 3FSJX 4CGWA 1FFCA 1HLGA 4A8HA 1Y42X 3PB3A 3JARB 4FYJA 4QU8A 4FB4A 3I8XA 3VYRB 3PT5A 4HB3A 4NRDA 1WVGA 2FN4A 1Z68A 5HS0A 1YOBA 2IODA 3IDZA 3NHKA 4OSOA 4XM1A 5CX4A 3MYRA 5BN3B 2W58A 4D9EA 3AY3A 2FW6A 3KE9A 3C74A 2PWBA 1C50A 1VJCA 1E6UA 1OROA 2J0VA 2YYAA 4QHSA 2NV6A 3E34A 1XNJA 1Y6RA 2LCIA 4RV4A 1DBSA 1G3NB 4MYRA 4C7KA 1IUOA 2CG3A 1R8YA 3CEHA 1WPGA 1RW2A 3QC1A 4QPPA 1FJXA 4B0ZA 1QK5A 2VDWA 1Q21A 3GT7A 3IUMA 3BBLA 1FFHA 2F90A 4L95C 1AQUA 3CX6A 4ONEA 1FSFA 5K01A 4R5HA 3TXNA 2WJHA 4E5VA 1RJGA 4DDUA 1WOYA 2M1ZA 5B58T 2DCPA 4KN9S 3EVDA 3STYA 4BWVA 1EJ2A 2WINI 4Z2AA 2J5BA 3KEQA 4IFEA 1IG0A 3JD3A 2JGDA 4QGHA 3SBXA 4MPTA 3NEJA 3PP8A 4ABTA 1UKVY 4J2OA 3W06A 3I2GA 3AOEC 4F11A 2JFVA 3IQZA 3D5EA 4IINA 2NTEA 1QC5B 1G8FA 1RPNA 3CX8A 4AUKA 4ANWA 4NYJR 3ADDA 4P3KA 2JBWA 1OCEA 4HD8A 5EE3A 2J9FB 3BXPA 3IA2A 2CXSA 3PDIA 2J33A 2BVNA 1RPAA 5JAMA 1UFKA 3I09A 1L4KA 3B3QA 1TLTA 1YB2A 1GKLA 4JNCA 4RQAA 3ZCVA 4EYKA 1VOTA 4JGBA 1HRDA 1I9CA 3ZVMA 3RWMB 4RQUA 3BCHA 4NYMQ 4BXOB 2VHEA 3NVMB 3D7RA 2JLXA 2UY1A 1QHIA 2BL4A 1M2OA 2CFUA 1VDMA 4HS4A 3A3YA 1KK3A 5B30A 2P75A 4ZVMA 3HJHA 3P0FA 4D3XA 5JCPA 3NBUA 3KETA 1JDBC 4IZ6A 4BV8A 3IBSA 1H2TC 3T5DA 3P2EA 3E7XA 2Q5HA 4PPNA 3P4YA 4QULA 1QAQA 3H2HA 5EKDA 3V97A 3WTBA 4D6YA 1GTZA 2AJTA 2C8JA 1OCOE 2E4AA 5JZBA 3QX9A 3NBQA 4RSMA 1Y8AA 1V1JA 3WGYA 4DVJA 2B4KA 3VU1A 5L3SB 3ID6C 4XWAA 4YDHB 3SGHA 1SC9A 2RHDA 1UXKA 1W0CA 1Z7EA 3G1TA 3PC3A 4ODIA 1Y1RA 5B1AE 4RSRA 3P97A 1Y34E 5FA6A 1KXZA 3UZUA 3C8UA 3DFFA 3O2JA 4GOKA 3PHGA 4LISA 4N49A 4TQGA 3PZ1A 4A3VA 1VCHA 2DWOA 2YFKA 3E4CA 1KNQA 1FU4A 3N6VA 4TWZA 3KVYA 4M0DA 1EFUA 4XGRA 3F1LA 1XQVA 3RC1A 1L4EA 5IU6A 4MI9A 3VKGA 2XMPA 2Q2NA 2FWRA 4H59A 4NC9A 2VJQA 2V59A 3I9V1 1FX1A 4JI6B 3H2BA 3MF4A 2B6NA 3RF6A 1JCQA 3QHAA 5ALTA 1GZHB 1RLUA 5T3UA 3TLYA 3T1TA 3ZCQA 5EHZA 1Q19A 5J4LA 3U9WA 1NSFA 1W49A 4JYPA 2P2YA 3C7TA 4N2SA 4M54A 5LUBA 4NU5A 2J8ZA 1J49A 1KQFA 3EPPA 3V4LA 1AV6A 4FX5A 5CFNA 1JSCA 1J8VA 1TK3A 1IBMB 3LKBA 2DAPA 4KBQA 1M2GA 3OEED 1ECGA 1H9BA 4X1KA 5ALWA 2FN8A 4P54A 4JHJA 3ND6A 1E9SA 2D54A 3GAAA 3LUCA 4UDOA 2JIZA 2G1UA 5EZQA 2EHDA 3HV2A 4BEPA 5FADA 2FFRA 1KZYC 1HE2A 5BQPA 1T5TA 3ZZNA 2JCGA 5IJ9A 1FDWA 1KF0A 2YASA 3SS8A 4JITA 4AJ2A 3IEPA 1I5RA 3VTKA 4CT4A 5GJVC 1N0RA 1W4CA 2AF3C 3CX3A 5EERA 4KTTE 5AW9A 3TQRA 5BY2A 1WKBA 3RIBA 1XKQA 2W93A 4K9QA 4O08A 4QUEA 2LBPA 3WFJA 3MKQB 5HBGA 3VKFA 3E9EA 3STVA 4G0VA 2R03A 1L7PA 3IDAA 1N4PA 2GOYA 3C3KA 4RIFA 2W2LD 3JSXA 3HLKA 1CQIB 4N01A 3TX6A 4CIVA 1N0QA