The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
183
|
sequence length |
590
|
structure length |
546
|
Chain Sequence |
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb |
source organism |
Loligo pealei
|
molecule tags |
Endocytosis/exocytosis
|
molecule keywords |
SEC1
|
total genus |
183
|
structure length |
546
|
sequence length |
590
|
ec nomenclature | |
pdb deposition date | 2000-09-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00995 | Sec1 | Sec1 family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Alpha Horseshoe | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold | ||
Alpha Beta | Alpha-Beta Complex | Syntaxin Binding Protein 1; Chain A, domain 2 | Syntaxin Binding Protein 1; Chain A, domain 2 |