1FVHA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
590
structure length
546
Chain Sequence
b'ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEC1
publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 183
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvhA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvhA03
1MQSA 2XHEA 1FVFA 5BUZA 4CCAA 4JC8A 4JEUA 3PUKA 1EPUA 3C98A 4BX8A 1Y9JA 5BV0A 5BV1A 4JEHA 1FVHA 4BX9A 3PUJA 4KMOA
chains in the Genus database with same CATH superfamily
1UBCA 3RWMB 3DONA 3UJ6A 2V7UA 3JS5A 1KYZA 2LUHA 2HGZA 4EUFA 2OQ2A 2XKKA 1PW7A 1FQJA 3EUWA 4FSDA 5AOBA 5CPFA 5C8ZA 4I9EA 3KOOA 1DHTA 2GLXA 2IY8A 3B1YA 3IV7A 3SMQA 1WDWB 2IF0A 2OZPA 3HJUA 1ZIOA 1QO7A 3G68A 5FUQA 3CRZA 3DEHA 3QVGB 1DBIA 1DUIA 2PUWA 4R84A 1VIDA 5J4KA 1ICEA 3SJAA 4CI0B 1GUZA 4MV4A 3AZQA 2WIJA 3W6PA 3JQBA 4R1QA 1VSVA 3DV0A 2XGOA 1NNUA 1Y8MA 1RCUA 1UPCA 3WMWA 4MLPA 2EQAA 1C30B 1IZ7A 4UWLA 1E7SA 4NYJR 3ZXIA 4OY3A 5A4KA 3BRWA 3NEJA 2CL5A 4JCOA 1K7SN 1I6LA 4P9NA 4LC1A 4R8LA 1Y42X 4A15A 1MIOB 5LQAA 2OB2A 4I66A 5FB3A 2EJBA 4UWKA 4LJKA 1ZU5A 1VMDA 3KXKA 4YJ2F 1RM5A 1QVVA 2AI2A 5EYLA 1NTOA 3OA0A 3R9XA 5LCWC 1WXEA 3IB3A 2FQWA 1RQXA 3E5HA 3ZWKA 4EG6A 3OEEA 4C6TB 2GEBA 4TT8A 3A9VA 4FDUA 2I4NA 3WFIA 4A4DA 1SZDA 4A2PA 2BEJA 3ENQA 2VXOA 4NEHB 4W99A 2G77B 3SIXA 4EWLA 1IQRA 4LY6A 2HXGA 3WKEA 3H5IA 4J8YA 1ADBA 1UEJA 1TYDE 2X1MA 4ML3A 3LDGA 4GTSA 1F06A 3EIXA 4WBNB 3JQAA 4B82A 2FEXA 4KAJA 5LC1A 2IH5A 1N2HA 3NBUA 1EUCB 1FRFS 4MW0A 2I99A 3L7BA 2D5AA 3B9PA 3L43A 4G5RA 1J0EA 3EW9A 3EU5A 3FSGA 3EUFA 2O3JA 2XA2A 1X87A 2OMEA 1AHIA 3WAJA 1B89A 5HHTA 4LNGA 5DT9A 4K03A 3OKFA 4ZV4A 3GA5A 4NOMA 4NZNA 1NM5C 1LC3A 2RH8A 2PU7A 4RBNA 3PJEA 1XSEA 4HAUA 2FMFA 3G0HA 1LK7A 3VSDA 2R8RA 4DCUA 1DAMA 3ZY4A 1J49A 3DO6A 3H9CA 5H5JA 4G5XA 3H2GA 4XD2A 1FYDA 2KS6A 4FJ0A 2CG3A 3D9MA 3HDYA 2R2GA 4DI4A 1XMPA 4JLKA 2NZJA 4N5MA 3ZEIA 3OIVA 1J06A 4IICA 1GCGA 1KJNA 2PR7A 5KNHD 4EI7A 4UCXA 2H5IA 1CF4A 2H8GA 3U40A 2G3YA 3O1HB 4LDPA 4BV9A 1SQ5A 3L17A 2PSJA 4OXQA 2KCVA 1LU9A 1QCZA 4UNNA 1TQ8A 3L0BA 1YR6A 3DF9A 4G85A 1IG3A 2H0QA 5CCDA 4WK0B 2JANA 4ZDWA 1TYZA 5AQ7A 2YHBA 5CAEA 1GR1A 3ANTA 1BWQA 1NYTA 1OXSC 5LLSA 2XA1A 5IYZF 4CTNA 2JFVA 3LGAA 1SKYB 2IYVA 3GEDA 3PX7A 3UA3A 3U49A 3LX6A 4QT4A 1ZVMA 2JJ8A 4FZ5A 4MV3A 1W9MA 1WTAA 1PR5A 2O06A 2ZUFA 5E8RA 2CVQA 3BKWA 3THWB 1BOOA 1AC5A 1AGYA 3EQZA 1UODA 3N0XA 4O2BB 4E2XA 3QE4A 1O97D 2AEJA 3PDIB 2LDXA 3CQCB 3HBNA 2DFPA 1P91A 3MMPA 5IZ4A 5HIIA 3M6IA 5DM0A 4N0DA 3VR5H 2BKGA 3A6DA 1INZA 3IJEB 1IBSA 3GI1A 5M7EA 3DAYA 1D9ZA 3LK6A 1CUWA 4FLMA 4TV8B 3F3MA 4IDCA 1JIJA 5LP1A 3RO7A 3UWMA 1KOFA 1R88A 4TUYA 3DMRA 2B5VA 4ZZ2A 2QMHA 1KJJA 2HWWA 3GQBB 3WL7A 1R7RA 2WZDA 3C8ZA 2UZ4A 4XKJA 1I13A 4GEGA 4BWFB 2IJGX 1H3NA 4GX0A 5TJHA 3WYGA 2A9RA 4ITUA 2VAPA 4Z3OA 2I0FA 2OAEA 4IQGA 1FFBA 1V8OA 4UHEA 3U3JA 4P92A 4YUAA 2EZ9A 4MW9A 3JVIA 2O7SA 3MJCA 2NSDA 3WGJA 3GEGA 4P3KA 1RYYA 1SG9A 2C7BA 2RC5A 2OV2A 4CRWB 3BIWA 5KAPA 3WS7A 4XE5A 2FWRA 3E5RA 3MX3A 3I6ZA 5AH0A 1BDBA 1N8NA 5LOVB 3RBAA 4OL9A 3GRVA 1XNHA 1UBJS 2Q7XA 4K2AA 1UIRA 3GCDA 4Q21A 4Z1MD 2XZDG 4JOCA 1P4JA 2DLDA 3LDUA 4KZCA 2C84A 5F7OA 3QY0A 4XFDA 1D7AA 2I55A 3SZOA 1VKRA 1YDHA 5KJEA 1UFVA 3EGDB 3T3EA 2KCLA 3GJ3A 5BMVB 3E58A 3R3YA 2XKJE 3NWBA 4D25A 1KWKA 2VL7A 1E2UA 1UK9A 1ZU4A 3LQQA 3I0NA 1U0GA 2PA3A 2NT3A 1NATA 3HLKA 1FNCA 3ROFA 2RAVA 4TMTA 2H54A 3RUDA 1C80A 5F2NA 2G9NA 2I66A 5GM1A 2A78A 4L73A 5KBAA 4MJ7A 1SBZA 1T2VA 2F6RA 5H70A 1UBKS 1GAJA 1U9YA 4QICA 3GJSA 1E79A 2CWDA 3A10A 1VBNA 1EHIA 1NYQA 3T4XA 1Z3XA 5ALHA 1ZK0A 1KYQA 4RJIA 4G2VA 3ETNA 4H7PA 4W9NA 4M7RA 5ECDA 3GJ6A 3GMSA 1ES9A 3H65A 5CFLA 4F5DA 1JDTA 1M1YE 4EATA 1DKOA 1GARA 3BMNB 4ER7A 4EX7A 5E6UB 1ZEJA 2XCIA 4IVNA 4D46A 4A8JC 1MAVA 3KOMA 4YQFA 1HYHA 2QM8A 3H3FA 2HSDA 4ARBA 4QQFA 2VHYA 1Y6FA 1JV2B 3MTJA 3P5BA 1EFTA 1IHPA 5IRCD 4ALKA 4KZKA 2EJWA 4PC7A 2XMCA 3NOVA 3LKUA 1CUZA 2ZANA 2AR0A 1J70A 3NZUA 5KDOA 1GL7A 3CLKA 3OQIA 1EQ2A 2HZBA 2KM4A 1H4QA 1ZM3A 4D9IA 3MYVA 1CWUA 3AF6A 4Z4EA 1TCUA 1I6WA 3VM6A 3BIFA 1NQTA 2HHJA 3AILA 4CEMA 4KVOA 4L5AA 1MGPA 1SXJB 4FU3A 1E9CA 5FOWA 3GW4A 4S1OA 1Y37A 2VSFA 1E59A 5DX0A 4JC0A 2I4LA 3Q49B 5EKUA 1EA5A 4KH0A 3TEFA 1ISPA 3LX8A 2V7EA 5CNMA 2DP4E 2EP5A 1XK7A 2FDRA 2XQJA 4E6PA 3ZI4A 1J8YF 4PAGA 2B4RO 4QPZA 4A1FA 3BBPA 4IKOA 2WM9B 4HQ6A 4X1YA 5AFSA 4UBJA 2V59A 2FSPA 5I7VA 1FX1A 2HADA 3PEFA 3DOOA 2HHAA 3GYGA 4JVLA 3TLJA 3S27A 3N0RA 4DSTA 1UINA 4D4MA 4E7PA 4MW1A 3KR1A 1SKBA 2HU2A 3LAWA 3QVWA 2XCUA 1W5BA 3ILXA 2FQYA 2CMHA 1OWOA 1XU9A 4MVCA 1JLLB 1QE3A 5JROA 5LOZA 3BZWA 2WHPA 3C7AA 2ZXUA 1E7VA 1FP4B 4Z49A 2XMQA 2AUMA 4HB4A 3E9ZA 3UM9A 3I6BA 1JYSA 1P74A 2AVPA 3S7ZA 4B93B 2WD8A 1GZSA 2RIPA 2VLIA 1PJ3A 2XUDA 1BFUA 3MXOA 3II6X 2DBYA 3OZWA 1SKUA 3INYA 3CN9A 3QOXA 1XRSB 4ALIA 4GSKA 2TS1A 1CNMA 1JG7A 3W04A 1GOTA 4WLOA 4HQOA 1SCKA 1U0TA 2MU1A 4OA8A 4LMAA 3ZTTA 2CL6X 3AFIA 4DNXA 4C4SA 4UWHA 2ZUDA 5E4YA 1VM6A 3KVVA 3RRZA 1GTZA 1KJQA 3HY3A 4J6FA 4UATA 1LTXA 2NAFA 4WGGA 1OFIA 4GMHA 5LWQA 4WZ6A 3CBGA 5AK0A 2Y4TA 1DIHA 1N3IA 4E03A 4TXQA 3B78A 1ENZA 2KBFA 3AINA 1CRPA 1WXGA 4JWTA 2IU0A 1N6IA 1TU3A 1CERA 2XZLA 5HCNA 4RNCA 1SXQA 3VA7A 3IP6A 2GXAA 2DEUA 4BFCA 3NHSA 2P9PG 3TNLA 3JQGA 5EPUA 4NU5A 3FTYA 3JAKA 2V7GA 3V1KA 4NSNA 3PHHA 1WXQA 4Q18A 1IN8A 1O54A 3IOYA 4B8CB 1UWKA 3QVSA 4O63O 4ZCRA 2NYJA 3UENA 1A69A 3IPCA 2L82A 2W2OA 2P9EA 1KDTA 5MFZA 5AHOA 3V5NA 5IM4F 4ALJA 2A1IA 2HCFA 4UFPA 4E1VA 2C98A 4DR6B 2YUIA 4PV7A 2A5GA 1LNSA 3NDIA 3OM0A 2IXFA 2JD2A 4F7DA 1L4NA 2YCBA 1I7SB 1Q0UA 4RIHA 4EW3A 4ENWA 3CCFA 3AR8A 3E9DA 2P30A 4XQGA 2ZJZA 5C9ZA 1N5KA 4GKJB 1VHTA 1YRWA 3AIOA 4QYIB 4GX5A 1DQNA 3AUTA 3HA7A 2O8EB 3AU8A 3TZKA 2OQIA 4N7BA 1P9NA 3PC2A 2A3NA 3CEAA 4Q4AA 1RAIA 3E8SA 5TDHA 5JAUA 5A4MS 3A9RA 5KTSA 4TVBA 3RC3A 3K0SA 3B1XA 3KZCA 4L7VA 1ZIPA 5HM8A 1BA2A 4YDYA 5G0VA 1QC5A 3N8DA 3CLSD 2J07A 1EQAA 5AP9A 3DUFA 3SI7A 3WO0A 4Z86A 2V7WA 2PL9A 1JQLB 1H5UA 2RGBA 4IFEA 5IMSA 4E5SA 3AVVA 4CGVA 4DEXA 1Z5GA 3FH7A 2Q6VA 4E11A 4PFSA 4S0ZA 1Y6GA 3GJQA 4GLLA 4CUZA 5JG7A 2FN9A 2P8JA 4FU0A 3P2BA 1NU8A 3ET5A 2OCKA 4JXTA 3WLIA 1YOVA 3IHWA 3WA7A 4XWAA 1G18A 2QPLA 2GKSA 4CL2A 3K5PA 2ZSEA 3CG4A 1GD1O 4O33A 2A9FA 2P6OA 4DILA 1B3RA 1WB9A 1K8RA 3JYNA 3RYTC 4YROA 1FUIA 2YHAA 5AI4A 4D3SA 4B4UA 1PEDA 2WF6A 4ZVTA 4CYMD 4XH9B 5D7BA 3EGOA 4LEUA 3LY7A 1Z82A 3FYCA 3AFOA 1DUVG 2ASEA 3IGFA 4PVDA 2GSWA 3SXUA 1YFLA 1N0WA 5EE9A 2CXXA 4B81A 4UMVA 5KSYA 1KMCA 3F71A 1PKEA 3TGOA 1NVVQ 3GFFA 5ALMA 3EIEA 1LZLA 3SKXA 3LGSA 4CF7A 5FADA 1RBMA 3ND9A 1CDZA 1HWYA 4OAUC 1FDTA 4C3ZA 3EPKA 3UOWA 3ESLA 3W6NA 1ELOA 5JHAA 3QFSA 1S70B 3RWBA 1P44A 4B3FX 3LD9A 3OWHA 2ZATA 4OFWA 3H0KA 3LQRA 2NUPB 2GFHA 2AJDA 3LYLA 1I1HA 1ORVA 2WG2A 2XYVA 4LZOA 3EB9A 5CBKA 4UOZA 1NBOA 2ZIXB 2DFNA 5J4VA 2QXUA 4RF3A 2W48A 3LX4A 5BQXA 1ENOA 4AP5A 1XAGA 2V74B 4DLNA 2Q5EA 3AEXA 1OVGA 1AMNA 1YB7A 3D3NA 3PKJA 2IY9A 4Y1RB 1XTBA 3L0ZA 5K3SA 2ZRQA 3GDHA 4JVSB 3S0JA 2P7IA 1A9XA 4LSZE 4HZIA 1L4HA 3V4LA 5K0LA 1ADGA 2E37A 1HT3A 2FZWA 2QLJA 4IY1A 1R50A 4IXDA 1J8QA 1OBFO 3EHQA 1OYVA 3RYHA 4FBMA 3HFGA 1FVXA 1XZNA 3NDPA 1O03A 2ZP1A 3MLEA 4Q7KA 2P9JA 2I4IA 2JVJA 4D9EA 1G8YA 5C51B 1NVMB 2QRKA 5D3QA 4R40A 2WKRA 2G1PA 1GNPA 4UHBA 1WETA 2Q27A 2I3BA 4YCMA 5EJ5A 4UQOA 2HPHA 4JJZA 2A0XA 3YASA 3ILSA 5IEBA 2A0FA 2QW0X 1YCDA 4RDHA 3UGJA 2HMAA 4EPZA 2XB9A 5CMWA 5EMKA 1ZD4A 4A9AA 2WJIA 1EQUA 1SELA 2QT9A 1ND6A 3KKPA 5KTTA 1RPNA 3NQ41 4FFMA 3U81A 5CCXA 1QK3A 1UJMA 3C3WA 2A94A 1Z17A 2W2VA 2A1UA 2PLWA 3Q8KA 4AXHA 4PS3A 3TNJA 2WG0A 5TGTA 4KTTE 3D8HA 2WJWA 3JATA 2FSFA 3HNRA 4UEWA 3AETB 3TIFA 1YK1A 1LK5A 3FYSA 1D1QA 2CFIA 5JSZB 3UIEA 3WHKA 1S3SA 3VYUB 3NKLA 5F33A 3RYIA 3FLBA 3UM0A 3R0ZA 2I03A 1P6XA 2BGJA 2GAFA 3DGFC 4DL9A 4BVEA 3AKDA 5BSRA 4DLUA 1L7BA 1RFGE 5IAEA 4V3IA 1PUXA 4TTAA 3DOCA 3DBRB 4NH4A 4QFVA 3MERA 4BN5A 1SEVA 2Z8ZA 2XMSA 2MDTA 4RYLA 3IBCA 5LKRA 4HDKB 3VYWA 1UZNA 1G8FA 2QQ0A 4K3VA 3FNBA 5JPCA 1TCAA 1YC2A 4DQUA 5EPEA 3GRCA 1CD5A 4MR7A 1SUDA 4KIGA 4ITVA 3KT0A 4P4GA 3CLHA 3SMVA 3I5AA 3CO0S 3L22A 2A5DA 3DMYA 3FLAA 1O4VA 4QIHA 4RZHA 1WKVA 1GVHA 3ESXA 5KYUA 1ILWA 3Q7PA 1ORDA 3KQSA 3CIFA 3EPPA 2QNBA 2FWIA 5JZVA 1VKOA 2EBWA 3TE6A 3ML1A 4M9SA 1PGNA 4UCQA 4UVEA 1YYHA 4C76A 2JLRA 2C2BA 1MPTA 4JXXA 3N2ZB 2WT8A 1I01A 3CVVA 4IWNA 3ZWCA 1BSVA 1E92A 5P21A 3PEVA 3VC2A 3GF4A 3SJUA 4M36A 2CVOA 3ECAA 1UAAA 1LPAB 5D86A 3L41A 4LKOA 2QM3A 2HB6A 2PLNA 1FFXA 3QU2A 3AI7A 3N2NA 4PWYA 4F3TA 1ZI8A 4K05A 1E0SA 3FHLA 5DWVA 3WLRA 5JMOA 3PGA1 3TN7A 1P5QA 4H0CA 3MEQA 1T8SA 2QN7A 3UT6A 4DMHA 5JEEA 5K7SA 3WVNA 1HDYA 1VLLA 2JK1A 3C24A 4NK4A 2VTDA 2XT6A 3ZNPA 3MB8A 4WN3A 3U7QB 4GOOD 1RYHA 2JF0A 2PX3A 4IG9A 4PX9A 3L8GA 2A9KA 3PJDA 4RV5A 5IC6A 1K5DA 1LK0A 5A7FA 1SU7A 3KB8A 1P60A 3WRVA 2IHKA 3AR2A 4X63A 3RAFC 1FFDA 4BMYA 4LTMA 3UXYA 2B4AA 2EKBA 4PLHA 1DZIA 5B3AA 1U28C 4ER6A 2VIIA 2ZS9A 3OX2A 4UEKA 3L6UA 2P27A 1XRMA 1W5SA 1YDMA 4TXRA 2O7QA 4RMJA 2P6PA 1ZVKA 3OM8A 1XTSA 4CDNA 4GA0A 2C3PA 3PH0C 4IMIB 1ID1A 1ULZA 3GEIA 1U8ZA 2ZXFA 4EG0A 4ENRA 1JQKA 4RACA 5A5EA 1V16A 3SP1A 4CDGA 1D04A 5CB6A 2J8SD 3N1UA 3TMKA 1PGJA 2NSZA 4DHEA 4LQ4A 2C9DA 4NICA 2AN9A 1NUTA 1C3XA 3HUUA 2IEGA 1ORHA 3IQZA 1HLFA 1ZAYA 2GNOA 2WFLA 4HQFA 3TLEA 3H6KA 2G9RA 4PG5A 2IXBA 5AI5A 2G07A 4UU7A 1W6RA 4HFNA 3QBTA 3L16A 1H5QA 2DPMA 3NH6A 1R9NA 3TAUA 4DR4B 3LLUA 1QQ7A 3MGBA 4G0NA 2ROQA 4AF8A 2TMDA 4FT4A 1T1GA 3Q2OA 5J2UF 2G1UA 1CR4A 2PMBA 3O47A 1QLWA 1KDOA 4G8DA 2I6SA 1QPBA 1OI3A 3LUAA 1N5DA 1LPOA 2R1VB 3PZDA 2B3DA 5EZYA 3STVA 4V39A 4MR9B 5KYYA 4C4OA 2JEKA 4NONA 1JXAA 1P4SA 3FN4A 2AJBA 4BAGA 5AW8A 1QK4A 4ACAA 1Q3TA 4O2AA 3Q3CA 3UK7A 1KH1A 4BLQA 1UMDB 1S2OA 2WF8A 3L8ZA 3KKNA 2A9VA 3V46A 5BUSA 1ISSA 4GL4A 3K2EA 1MHQA 4WWHA 4DR3B 1DTEA 3SCZA 5I51A 4NCKA 2ABWA 3KPYA 4H1VA 5A0VA 1AZLA 4CIYA 2JFPA 4W5WA 2D1RA 3MAJA 4HX2A 3E3NA 4YJGA 2CVHA 4EHIA 2Z8XA 1NV9A 2CJFA 4ZVQA 1QFYA 3F6EX 2RGEA 4HRNA 4FP7A 5BUQA 2HBZA 3OM1A 4CLRB 5DYWA 1WXFA 3FGNA 4NATA 2IYNA 3F3KA 1MDFA 4A27A 3FOZA 4JV5B 1DMSA 1Z8HA 5BR7A 3IURA 2Q5LA 1TNZA 3NP9A 3HVHA 2OC4A 1Z62A 2FWMX 2R7MA 5K0ZA 3EVBA 3KKMA 4HPXB 4MUGA 1UK8A 4FOSA 4HVBA 3BZUA 4BC0A 2WJVA 4CQMB 2DBAA 4YPOA 3NM4A 3MMNA 1SMKA 3ZV6A 3MTAA 1ZMTA 1PGQA 3SFYA 1ZICA 2MOKA 3SIPA 1UL1X 3BL5A 2YNMD 2I1KA 2Q8PA 1O4WA 4HJRA 2FFHA 3Q3GE 4U39A 2HW8A 5B7NA 5CFOA 4FEYA 5K4GA 4N7JA 4WOPA 3TB6A 5FTPA 1E69A 4CTOA 1JB1A 2Y99A 2UKDA 3OOWA 5KNBH 3MKQB 4RQAA 3DEZA 1MIHA 1ZWLA 3T94A 1O8CA 3QUBA 3O82A 2XIJA 2X2EA 1U31A 2XT9A 4Q4CA 3U56A 1RJ9B 4OHYA 4S05A 3ELDA 3RK4A 1IVNA 2P11A 3RRJA 2F1HA 1D2RA 3IKTA 3AF0A 4LDJA 2NO4A 4HWRA 3UGTA 1HEIA 1TD9A 4BGIA 5D87A 2CZQA 3JAWB 2TYSB 3S7DA 4EA6A 3HO6A 5IKOA 1RCFA 3DL4A 4M7OA 3S29A 2R48A 5EMNA 1GV0A 3EVGA 3WB2A 3RIYA 3F6SA 4XM2A 1M34A 4QJ5A 4D3YA 4JJ6A 1HG5A 3CVYA 4BMXA 4PIVA 2V6BA 3UMRA 3ZDFA 4GMDA 4K9LA 3E22A 4CT4A 5KPJA 1U11A 5DM4A 1KI9A 1OIXA 2AZ4A 1JCSA 3QEJA 5FYQA 2XB2A 4UD6A 4YFVA 1ZG3A 1A2OA 3TRHA 4L75A 4RV9A 1JEDA 3L8YA 3TOZA 3HXKA 4WPGA 3E23A 3EVEA 3KSRA 4B32A 1SVKA 1E1QA 1X7WA 4HT3B 1QIGA 1U7UA 2BMAA 2OXEA 2DFDA 4BGVA 1G5IA 2VDOB 5DYYA 4RM3A 1Y5LA 3IDAA 5JWOA 2RHMA 2W6JD 3TK1A 1UZMA 1K97A 1BAPA 4EHAA 5FCDA 3AJIA 4S3MA 4BATA 4D4KA 1TC2A 3OLVA 1XD2B 4Q00A 1S2IA 1XTRA 1RHKA 2H4WA 4LC9A 4PLCA 1PKXA 3GIWA 1QRTA 3BAZA 3T1QA 3GEMA 4OK6A 1VIVA 3TKLA 3FYUB 2ILTA 3CNNA 4CETA 2NZWA 1GAEO 2PO5A 2M98A 1DELA 4QDZA 1XL0A 4MA4A 3JWJA 5I48A 1VYUA 1AZTA 3IE2A 1WF3A 3H9EO 4L2IA 3ZGXA 4FI3F 4R2KA 4CEJB 1RI2A 2ET6A 1VDZA 3DE3X 5F7ZA 2YHIA 1XWIA 3F47A 1U1CA 3ORQA 2WSMA 1ZD5A 2FX5A 1O0CA 2Q4OA 4O2BF 1W4AA 1G3QA 2YYYA 1OHHA 1XU4A 4Q39A 1JHYA 4QNMA 4KXMA 3PYLA 1P9RA 1K7XB 2JDID 2C2HA 5G0WA 1VPEA 1F0PA 3WADA 3E61A 1SA0A 4CGYA 2GBCA 2FW9A 3R9XB 5AJTA 2YYSA 3K9GA 5DTQA 1AD2A 3DZKA 1JKJA 4YV0A 1A0OA 1RMQA 3I09A 3LS8A 4JHJA 3FNGA 4YP1A 3IEPA 5DE3A 2QUIA 1NWCA 1OC2A 3UXHA 3JPWA 3AEKA 2X2FA 3FI9A 4LCTA 2X7XA 5K03A 3PNTB 1A9OA 1NXOA 4X9XA 3DMGA 4UDOA 4C3UA 3ZDEA 1QHHB 3BXHA 2LWIA 4ZYUA 1TKBA 1Z6PA 2NZ8A 3OE5A 4RY9A 3STUA 3WQHA 3MELA 1MKYA 1Z4OA 4YMUA 3L8DA 1D6SA 2QAJA 3K9IA 4ZAZA 3EGXA 3CG0A 2I4TA 1IL0A 1P2UA 4Q3OA 2DHCA 1P7WA 3IV0A 3N8IA 4KGVA 1MR3F 4D41A 4HDOB 4BEJA 5JI3E 3STXA 3ZNGA 1ZL2A 4XD7D 2ZVDA 1I1NA 4F8JA 1DJOA 3FPHA 1T8TA 1MN6A 3NOXA 3ER6A 1N0QA 4GW3A 2Q5HA 3U26A 4JEMA 2W2KB 1IRXA 1GDHA 1H8ED 3CZCA 5JISA 3GLHA 1NVKA 3SYTA 1XRQA 1U7DA 5BMVF 4HYYA 3FZQA 5CB4B 4EO4A 5EXSA 4L6AA 1TNDA 4TX1A 3CURA 5FUWA 4FB5A 1D6MA 1VSQA 1GTSA 2ZJ1A 3V42A 2X22A 4I1VA 4KOAA 1GSHA 4ZO9A 3GOHA 3U3XA 1TQ4A 1FVFA 3APFA 4GR9A 3I4GA 5AKHA 5JQGA 3E0XA 3ZU2A 1Z88A 3EWNA 2NXPA 3BXOA 1F6WA 1BNCA 2FFRA 3CH7A 5FOXA 5AQEA 1UBFA 1WM5A 3M4JA 4BEPA 2RGNA 1TJFA 4KE6A 3G5TA 2XRYA 4FLEA 3EQ8A 3IT1A 4XM1A 4FYXA 2VJMA 4G0VA 4IXWA 3PHJA 2DT8A 1C81A 1U81A 5BQ5A 3QNWA 3T3MB 3KDSE 3RFXA 1ZMOA 1JQEA 1QBGA 2J0UB 5KIAA 1X81A 4FFVA 3EODA 2M6SA 2XY4A 2XQKA 3TCXB 4P7BA 3L7JA 2SHKA 4I50A 3IESA 2Z8YM 3F6CA 4XCQA 2GN6A 4Y7CA 6ABPA 4LFBB 4GFDA 2AW5A 1SBIA 4LCJA 4L50A 2P58C 2YIDA 1QCYA 4DB4A 4CF5A 1JDBB 3ZZNA 1KZHA 1XCPA 2B69A 1FDRA 4WK6A 1ORIA 3ZK9A 1X1RA 4FQ5A 3D9HA 5AT1A 2DQ4A 4PAOA 2IOLA 1JNXX 1VLVA 2PQ6A 2WP8J 4TRRA 1YNOA 2H63A 3DMNA 1YVEI 3OQ1A 1KYIA 4X1IA 5L6LB 2CLIB 2V8OA 2AW6A 3K2IA 1WUIS 4MULA 2L69A 2VKQA 3LT5A 4RU1A 3WKBA 4LHVA 3ZCVA 1IEQA 4FFPA 5IVKA 3KR2A 4ZPXA 4HVTA 3AI2A 1KRWA 2BSAA 2A58A 2PBZA 3X1XA 3O3MB 1KZ6A 1U8AA 2E7ZA 3C6BA 3C5VA 3MJWA 3B7PA 4LJAA 4ERNA 4NDAA 5BNFA 3AR9A 4AG6A 5CXXA 1XK6A 4LWQA 4DUIA 4MRPA 1CQIB 2OG2A 3NDRA 4R8KA 1T15A 5BRJA 2ZU6A 2X77A 4TWZA 2YWEA 3EFEA 2RB4A 5GOTA 3B82A 4CCAA 4EB3A 1OA1A 5GIOE 3F78A 4LV5B 1MA0A 3HCAA 1CRZA 3PA8A 4EGJA 1UXKA 4ZAFA 1GN9A 3S8YA 3ZX4A 1SVXA 4GYOA 3K9NA 5ALQA 1JEAA 4Y6LA 2CLOB 3ISMC 1JU3A 2ZT6A 4IDOA 3QSGA 1N2JA 3OPYB 4FNAA 2C3UA 5CDTA 1YDFA 1WY7A 2RH9B 3AR5A 3TG5A 4IJMA 1MB4A 1TK3A 1ZVVA 5AVUA 3GJ4A 1P4GA 5AXBA 3D9LA 3WG7E 1GGMA 2VYVA 1IEXA 2IY7A 1SQ0A 3GROA 1WMEA 3UMJA 3THYB 3BCSA 4ILHB 1H05A 4UQZA 4YIHA 2I1LA 1VB3A 3JQ9A 4MVJA 5C52B 1ULUA 4YQEA 4BVLA 4DNFA 3LS2A 4QARA 1KEUA 2A9OA 4AS3A 2NPOA 1ZGJA 1T5TA 2V7QD 4ZU1X 4DS3A 1BEZA 1J2RA 4GSYA 4JA0A 4QBGB 4Z4FA 5IDYA 2X9VA 4AUEA 4AJEA 4TMKA 4ZQGA 4RENA 2LNDA 3ZLVA 3RGWS 1JEYB 2OGZA 3QIAA 5EWMB 1JLHA 3A37A 1XQ1A 2MMGA 4DZZA 3BH6A 5F12A 1TGVA 5H0IA 1XG5A 1KAEA 2ZOSA 1U1IA 1JHPA 3K6SA 4FS8A 2F43B 5DHQA 4ZWNA 2JLWA 4BESA 3IDOA 2I3DA 1MTOA 4OXNA 6YASA 4KDEA 4H35A 4B6RA 3ZH9B 4K0KB 3WQSB 4DCPA 3D64A 2HK7A 1O0SA 1CW2B 1G41A 4PHCA 3K9HA 2QTBA 2PTGA 1FNDA 1E2KA 1JIVA 3JUEA 4NXMB 1YUNA 1O94C 5I4IA 3O2NA 4U7GA 4Q69A 2P9SG 3BGIA 1AGRA 4G0UA 2I2CA 2ZVJA 2W8ZA 5H7PA 5IXYA 2C96A 4BP9A 4XEIG 4UZSA 2BHRA 4TMVA 3HB5X 2W6PA 1NNEA 2PG3A 4YV1A 3D4PA 3FDZA 1MXFA 1ONSA 4DA9A 3SICE 3GNSA 2VYCA 3RS3A 4JP5A 4KXXA 4L16A 1N9AA 1T3TA 2QC9A 3M4NA 2IK8A 3OM9A 1N92A 4WFQA 3O8CA 4FDLA 2XBLA 2W8BB 3DAPA 3SQOA 4G97A 4YRBA 1MENA 4YRSA 2UUPA 3O4ZA 4RXUA 3MYRA 2EF1A 1M2KA 1QNLA 2FA9A 1IUPA 4UJ5A 3FDHA 3P4XA 3ZWMA 4DA7A 2IU1A 1VP9A 5JBIA 5AOVA 3FVRA 3E5NA 2CZCA 4LQLA 1C1HA 2ZYGA 1ELRA 2MSDB 3HSKA 2VYFA 1E7WA 1T0IA 1ZXXA 4P35A 4RVUA 4EMUA 2GLTA 2RGWA 5JSKA 2CHGA 4Q6WA 2PMFA 1K2WA 4AY5A 3PHLA 2EWWA 1ZL0A 3LWZA 3HPRA 5JH7B 4NJEB 2OBXA 1AOXA 3HYTA 1U2DA 5JA4D 3PRHA 1VI2A 4PAQA 5E2IA 2VQ3A 5K0GA 1FDOA 2R6CA 3DTYA 4C0WA 4B44A 2AFHE 2DBZA 4Z51A 2COUA 4EG3A 2Q6LA 2I2FA 4V3BA 1NOJA 4FE3A 5E7JA 5DVZA 2BFNA 1TT5A 1OFTA 5I4BA 4S1VA 1GG9A 3I3OA 3DG9A 4HH3C 3U7FB 3W7VA 1VKHA 3BICA 5FZQA 3EZ6A 3TOSA 2ZTHA 3UY4A 1P31A 4FULA 4MLZA 5G4LA 3Q9UA 1IIRA 2FOLA 3ZIUA 2QX4A 2PEYA 4DY4A 3UK0A 3SXJA 1VRCA 1NDQA 4XIYA 4OMFG 1W25A 1QM5A 3H4MA 4GSLA 3RSEG 4N4AA 1EJBA 3W5IA 3UMSA 1F8XA 4AO7A 3FUMA 2D5BA 3R7FA 4MQFB 1BLXB 3RC9A 2QK4A 2YWCA 5FA5A 1IAQA 1U8YA 2EBHX 5CMYA 1W88A 1R16A 1V35A 3GZSA 4BO9A 1LBTA 1PS8A 3VU9B 1QRAA 2R1ZA 4E88A 4LRZA 1Q7RA 5HXAA 4EI2A 1DARA 2Z5GA 4AZSA 1Y6JA 4PICA 5HTKA 2UZIR 4LECA 4R4JA 5EERA 1KVQA 1AHHA 5M72A 3P0HA 4MI9A 2VPIA 4UNIA 2CB9A 4R1MA 3TSWA 3ZJYA 2FW0A 4DLLA 1H2HA 2C2KA 4X65B 4IF6A 1H0HA 2PUCA 3HMQA 4ZCPA 3FRIA 3R6LA 3FHCB 2C54A 2I6UA 2BI7A 1EU1A 2FEWB 3RSOA 4L3WA 3AY7A 5HKKA 1S0UA 2O2HA 3CUVA 3B3AA 1QPZA 5JNRA 2HDHA 1LX6A 1G0OA 3PVCA 3HM9A 4GMFA 3TXAA 3LJKA 3GHYA 5JCZA 1SBCA 3DSVA 2PZKA 1X80B 4DV5B 1ZW1A 5LIPA 3EVAA 2B8EA 2FPUA 4NBNA 1U63A 4B2LA 2EIKE 3OI7A 3TI7A 1E7MA 1DDOA 1TF2A 1PW5A 3LPNA 2PVSA 3H6GA 2QR3A 2VATA 3C7TA 3HSSA 1QF7A 3KV1A 3P0EA 4V0LA 4U0SA 4YXFA 4GCOA 3S2IA 1OXMA 2BFPA 1JPUA 3IT2A 2YRFA 3AONB 1VPDA 2XI4A 2FULA 1P7VA 2RGCA 5T7BA 1SUAA 3X2EA 4C6SA 1XZAA 2NUTB 4EG8A 4G24A 5KJCA 1VHDA 1X3SA 4YYZA 1VL6A 2P2CA 1TXGA 1N32B 1XZDA 4GM1A 4QUIA 3D7RA 3TWVA 4Z99A 1TT7A 4HAVA 1DC4A 1BKSB 1TUBA 3OCCA 3F49S 1WMSA 4QJ3A 3OOEA 1NUSA 2Z9BA 3I8SA 2NGRA 3SEZA 3WKCA 1JMVA 4CKYA 3UGKA 3DVAB 4ATNA 3F4LA 4NDZA 4DG8A 5FQOA 1XA3A 4R8RA 4RPGA 2Z3ZA 2VAXA 2B92A 4EDHA 3AEZA 4L08A 1KR5A 4OHUA 4EA7A 3K16A 1P77A 5BOSB 3EZ7A 4UVGA 1XXHE 5FPSA 1RXSA 4HTFB 4QJBA 2NTYC 1JRLA 3W8NA 4PS7A 2IP4A 2V9ZA 1TK9A 4HFRA 1Q2ZA 3NAWA 4CZ2A 1QF6A 3HXTA 4MV8A 5C4MA 1PVVA 4N01A 3H2IA 5ICEA 5JD4A 5E1OA 3KT6A 2HEGA 1UAGA 3HWWA 4I2WA 1AXGA 1WCIB 1CUVA 3P32A 5JBNA 3RAUA 2VDKB 3MTEA 1COWA 4CL3A 1CYDA 3JWGA 4RF2A 4QTXA 4CQMD 2XLBA 2JBAA 1R18A 1T1RA 2C9BA 3PCTA 4EZBA 1ST3A 5SZIA 1J20A 4XXHA 3VLDA 5EXTA 3U4TA 2F62A 4G67A 2OLJA 2X4LA 1PHPA 4F53A 4GMKA 4ROSA 2CNBA 1Y8QB 1QMGA 2QRLA 3TVDA 3AVXA 3RG2A 3GGJA 1WDTA 5E4FA 4U1RA 3K6RA 4DA8A 4ZAGA 1QVAA 1UKVY 1T9GS 1RTTA 2JLBA 1C8KA 2A1TS 3G8AA 1ORRA 2G67A 4H31A 4LZJA 1U04A 1UOHA 1EM8A 5JU6A 1V7QA 3PUYA 1XVIA 3BH7A 3P2JA 2VHVA 3IUMA 4MWZA 4RX1A 4R9SA 4C0EA 4ARVA 4FEGA 4ETWA 5EXPA 5ALNA 2I9PA 1PJ8A 1UT5A 1EGMB 1RI1A 3E2IA 4UE3S 1B6GA 4RGYA 3K73O 2IPNA 3OAAD 4OQDA 1OPRA 1JEJA 3NTLA 2X0DA 5G2NA 2ZVQX 2L0XA 4N7RA 4DX7D 3L8HA 4KQFA 3OKPA 3PUHA 2EJTA 2G76A 3FM9A 3G1WA 4EY5A 4GUDA 4Q24A 1E18A 2PH3A 4L6IA 5KSZA 1T1EA 4BCCA 3GEPA 3I9V6 4QEDA 1JQBA 4Y2XA 1VLJA 3DR3A 4XR9A 2X9NA 4HUTA 2CY0A 3CLRD 4GYWA 1W0CA 4QXAA 5IJ9A 4EW6A 4J0DA 2NU8B 4EYEA 2C2MA 2HM8A 1NM5A 3B1KA 4GCNA 4FNGA 4F2HA 1OBOA 2XWSA 4F60A 2HRRA 2JFBA 1I51A 2JVIA 2C4NA 5JXGA 2OAQ1 2ZAYA 3TWXA 2IU6A 5BQPA 1EUDA 2WIAA 5J59A 3IODA 5TS2A 5C7LO 2EJVA 4FD2A 3W5SA 3HYRA 5GONA 1D0IA 4LERA 2X0EA 1DIBA 2GQ0A 3L7AA 3LTEA 2FZLA 3HZRA 2PN1A 5LU9A 2YY7A 3QP9A 3B3FA 1Z7YA 1WUHS 4JB3A 1LSJA 4B89A 3WYNA 2HH9A 2ONJA 3TD6A 1XQVA 5KINB 1M1YA 3N8KA 4JROA 2C42A 3EVCA 2O2EA 3WGZA 4KPYA 3AVWA 4ZEOA 4MYUA 3T3DA 5ALFA 3QPBA 1CETA 4CVNA 1TO6A 2B1QA 1NIPA 2VF5X 1X7ZB 2HFKA 1MD9A 4ZEMA 2GEDA 5LQDA 1OZHA 4TXMA 1QGDA 5U4QA 1NVXQ 2B6HA 2GRPB 1P5HA 4RABA 3ZV5A 2LXMA 1Q1ZA 1K7FB 5C5CA 3B2EA 1FFXB 3BE5A 1T6BY 3KX2A 4PYIA 3Q3IA 3HVJA 3SLRA 1NBAA 3BRWD 2Y6VA 4ZQCB 3V1MA 4ZZ1A 4A73A 1HQCA 3QELA 3G0BA 3CSSA 1PFYA 3QPDA 4I5FA 3K30A 4UEQA 4CMAA 3MCAA 4EJSB 4JL8A 2ZIFA 2WHXA 3CH6A 3FWHA 1JLMA 1MO4A 3FCEA 3UWDA 4QBFA 2IX9A 3OX3A 4KYIB 6LDHA 2R1UA 3Q8MA 1YFKA 3WG9A 4CQLB 1JHVA 2XDAA 3I3NA 2P0EA 3OEED 1I33A 1GXSB 1KZ9A 4IKEA 4RVOA 1RRMA 3SR0A 1IDOA 3NC4A 5IH7A 1PZMA 1L7XA 2V0CA 2OHHA 1Z38A 3DSTA 4DUPA 3JQAD 3PNLA 2OHXA 4M0DA 5CNKA 1J21A 2E4XA 5ED0A 3I9KA 4QTYA 5AW5A 2NLOA 2K7FA 1G21E 5K9ZA 2C2YA 1FU4A 3C16C 4QLOA 4JYCA 1O95C 4JJ4A 2WYUA 2H1FA 3NS7A 2ZIRA 1QTNA 4HMQA 4O4IA 2OV3A 1VKNA 2DUWA 1Z8FA 2FPIA 4KREA 4CLOA 3C1AA 2FMUA 1S2MA 3HB9A 4WV3A 1SAYA 1YB5A 3SEQA 4RETA 3WMFA 4C0JA 5KHLB 1U3WA 1V3QE 1L5RA 2IOSA 3PUJA 3OVMA 2ANBA 2G1AA 3WGYA 3Q5GA 4TTSA 2HF7A 3LFUA 4IJKA 3OHPA 5JCXA 1NN3A 1L1EA 4U8GA 3FUJA 2ID7A 1K6EA 2QG6A 4B74A 1NXVA 2NZ2A 4FN5A 4LF6B 4YRZA 1X1CA 4ILKA 5B4VA 2W90A 2ZE5A 1BVRA 1HRKA 4RLHA 3TLGB 1JR3E 4BMPB 1CUFA 2EGHA 1SC1A 2JHFA 2J48A 1MB3A 4RD3A 4YV2A 5KNBD 3R75A 3R9KA 3NORA 4JLPA 2IOQA 2WJ6A 4IYJA 2QN2A 2XWQA 1W46A 3GDFA 4FCVA 4E5VA 4JHRA 1A9PA 2A5FA 3OLCX 4F7AA 4IAOA 1YC5A 4TYNA 3O83A 3HCBA 4M7WA 3MSXA 2W4QA 1QU2A 3GW8A 4JS0A 4E6EA 5I5GA 3MN1A 2GPWA 3CZ5A 3WZLA 4B6SA 1I36A 1CY2A 1MABA 4K5BA 3NO4A 3WP1B 1VMEA 5DXAA 4CM7A 3JXIA 4YALA 1Z2PX 3E8MA 2A67A 2AYYA 2QJOA 5TPWB 4B31A 4H3HB 1PLKA 1FOEB 5D85A 3AO0B 4M9CA 1L5YA 3NWEA 4WUTA 4LX8A 3VTAA 3VSAA 1MO3A 4FDTA 3O2SB 3IV9A 2VDPB 3WV4A 2VPWA 1QAOA 2FW8A 2QAGB 3Q15C 1F4PA 1GILA 3PD7A 1T3HA 3ZWXA 1VPVA 2P6MA 3JW8A 5E1DA 1DL5A 1RQGA 3L8CA 4JH0A 1Z68A 1T5IA 1NQ5A 5SYMA 2BYTA 3HZHA 4GI7A 4UBKA 1IJBA 3QWIA 4TUUA 1AURA 4GI3A 1F5SA 4B09A 2CNLA 4B84A 1CJMA 3KFXA 4A8JA 5CJ2A 1P7CA 4ME2A 5KX5A 1WU7A 4YY3B 2JCXA 1DVRA 1MAUA 3WDSA 3P9RA 1ZMBA 4YGXB 4Z4QA 1OI2A 3ZNOA 3IQWA 3EUEA 3KSDO 3U9SA 1IJKA 4AUMA 2GBIA 3ZE1B 3KT8A 2JGFA 3JASA 5IAOA 2OUIA 2WXIA 1P80A 3GY0A 2ZBGA 3C3DA 3F7NA 4BFXA 4EVRA 7YASA 2PAFA 4EHKA 3EZNA 3O0DA 3AR3A 3O1JC 5ERGB 1GUBA 4AO8A 2IYOA 2C5LA 3BA6A 1QLHA 3HGQA 3TLMA 2ZPTX 3QOWA 4DKJA 2YJTD 3IQHX 4ODIA 4HGPA 3TG2A 4BFTA 5B5SA 2F67A 3HWX1 4V0NA 1A27A 2X8JB 2HMTA 2VS1A 3FJOA 3L92A 2PPVA 3PD1A 2CNDA 5D2MC 1JJVA 2Q28A 5D6NA 3TH5A 5LZ4A 5B6JA 2EKQA 1E5XA 1BXKA 1KC1A 4D9JA 3EDCA 4J7CA 1D07A 3IULA 1G21A 2DQYA 4YJ3B 5JRDS 3ZHTA 5AKYA 3KYDB 1SB9A 3DOUA 1B42A 1O9BA 1HO8A 1KEPA 3P94A 4K9PA 1NULA 2AOWA 3QBDA 1NXPA 2QDXA 4OHOA 1L7NA 1WPXA 1HDGO 2R5FA 3A06A 5DCLA 4BVJA 2O0KA 1ACLA 1M2OB 4G01B 4PANA 1SPBS 1KQOA 2ISSD 4H7XA 1G60A 2VCEA 1DU4A 4D0SA 3FI0A 4DDVA 1PX0A 2BFFB 2AT1A 5EJFA 3QY9A 3H2JA 2ONCA 1U3CA 3RRMA 1DOAA 3CMCO 3AHEA 1E79D 1B74A 3RVOA 1D4FA 1JR3A 4L0DA 3RVJA 4R1TA 4BQNA 5BSVA 5B2ZA 5B12A 4AJIA 3G2WA 4UNRA 1K3UB 1G5QA 1XGWA 3TXMA 3HFRA 4NYIR 1ZH0A 5JNSA 2BKAA 4RVDA 4N54A 2WHRA 4M22A 2NO7A 3OZDA 4WACA 1BEEA 4ADSG 2FFAA 2YZ7A 3LQYA 2ZYTX 4R8MA 3F5QA 2GDZA 2MOWA 3AUFA 5SYNA 2CMDA 2XEDA 1ZEMA 1B6TA 5BVGA 1GV1A 3ZV3A 1Z16A 5CG1A 4HXYA 3REQA 1BU8A 3K31A 1SG0A 4ZVLA 5I7EA 2XZTG 2YJGA 5K8JB 1I0LA 4A0GA 4LSZA 3PD0A 3BDIA 3J81A 1ZM9A 1X7WB 1SNYA 1Q22A 4UBIA 3TDNA 2RAFA 2JGKA 4J3FA 3WGUA 4QFCA 2NAPA 5JVDF 5DN9A 3JYLA 4K6GA 3PDCA 5GVSA 1OGYA 1RRFA 1U8UA 4MGYR 2FMTA 3L8EA 3G2JA 2W2LA 3WL4A 2VHQA 3BWVA 2EKLA 5ANRB 3R0VA 3HNOA 3AERA 4URKA 2QBYA 1QCCA 2AZMA 1SXGA 5DWDA 4V1CI 3AG3E 3CKKA 3UJ8A 4J91A 5G1PA 2ZSIA 2GCNA 4OHWA 2E5FA 4POAA 2PBFA 4DRZA 3Q7QA 3EFBA 4QBIA 4EH1A 3LU1A 3DZCA 2RAUA 4P2BA 5E7QA 3Q9NC 1USWA 3DZ8A 4HB2A 5IWCA 3IAAA 5JLJA 1DWQA 2PYIA 4PC6A 2PRZA 2RH5A 1MC1A 3DCNA 2OSBA 1A98A 5AI0A 2C3MA 3ZHSA 1VRVA 4WKGA 2AQKA 5F21A 5F23A 9LDTA 2WYHA 3A31A 4C03A 1OTYA 4F9FA 1P39A 2ONZA 1HURA 5K2OA 4ESOA 2ZZNA 2QRMA 1USVA 5FLYA 4CKBA 4TLBA 1K88A 3WK8A 2O19A 4X95A 3NB2A 4ZT2A 1OREA 5DM70 3N6XA 1IOZA 4JLAA 1OCCE 1B8NA 5IAJA 3U7JA 5LYJA 5A6CA 2CDRA 4PFJA 2EW8A 1S96A 1HG1A 5EZ6B 4JJGA 1RT9A 5M34A 1CR1A 1ZONA 1H6PA 2XDWA 2NZUG 3WDLA 1XMSA 2REBA 2JGAA 3GT3A 1N6NA 1N9KA 3RGGA 3FLEA 4OSOA 3V00A 4CU5A 4L6CA 2BC9A 1YU6A 3GLGB 5CD1A 1M8GA 1JJIA 4BMVA 4PYLA 4QNRA 3F6BX 4TL6A 1NW5A 1KVSA 3FZNA 5FV4A 3JTMA 2TRSB 1KBZA 1TIPA 3PWTA 2HM7A 4WLFA 4LBWA 1W5FA 1FDVA 1XR3A 3QWFA 1WP9A 3FHTA 3T34A 4GC9A 2WZBA 3R7RA 5BR8B 4RVFA 3LC2O 4OF4A 2ORIA 1YRAA 3IQFA 5F4BA 1Z28A 1DSSG 3UA4A 2Z5LA 5IN4A 3AP3A 1CZKA 1DZ3A 4F2WA 1NJGA 1UKAA 1V1RB 2ZULA 3PSHA 3S4YA 2ZM6B 3L8MA 4MS3B 5AM4A 4QXPA 4IOKA 3KTAA 4EPRA 2JIQA 1PQPA 2OCAA 1FSZA 5CVTA 1EGAA 2OYSA 3UJDA 3RAGA 3H2ZA 3KEFA 3QXHA 5KYXA 1ZN8A 1T5OA 2C88A 1GWNA 3AY6A 3WA6A 4ZV9A 3TSZA 4LG1A 3B8EA 4CLXA 1KYVA 3T5XA 1WKCA 3FLMA 2QZJA 2ZEJA 5KOJB 4L5YA 3CF0A 1PT5A 3H2YA 4QDJA 1EVIA 1U7HA 1AHNA 4AQ7A 1IOWA 1KEVA 1Z6AA 2OZKA 3ON5A 4I5EA 4EGSA 1PFUA 3UUEA 2MRIA 4HQ0A 4BGUA 1CF9A 3EBPA 4Y1GA 5EXEA 2H3EA 2YX1A 1YJ8A 1GA4A 1SRQA 3NJ8A 3CX4A 4Q1BA 3N28A 4BP8A 5AO9A 1SUPA 3ITDA 1NP6A 2FB9A 3U3ZA 4DV3B 3L9TA 4HV4A 4J9VA 2R6ZA 2XVZA 4MLDA 4MQUA 2A35A 4PQEA 3TSOA 1X92A 2HN9A 2B2XA 2LRHA 2R7NA 3IIIA 2M1ZA 1VYVA 3V80A 1WY5A 3Q3EA 4EHFA 1CQPA 3PNVA 3URMA 3TTVA 4RADA 1H9BA 5SY4A 4Q7QA 4EZIA 4YECA 4WBNF 1TW2A 3NWJA 4OXIA 3DBHB 2PJDA 2PSDA 3TB4A 4GOXA 4IVPA 5JSQA 2I2BA 4Q7JB 3K96A 1FMCA 3ZWPA 5BN1A 5B2EA 3HR7A 1J9EA 4RTRA 3LBAA 3KV3O 3M83A 3H11B 2Q5CA 2AG5A 1B0PA 1B6RA 4JDPA 5CNIA 5ARBA 4MX8A 4F3KA 3UO8B 5KVSA 3I64A 2FXIA 4WWOA 2BTQB 1ZFNA 2YY6A 1JEQB 5BT8A 3K5WA 9ATCA 4NMMA 1FUUA 1LZKA 1U9JA 2GYUA 4E5DA 3RU0A 1SOUA 4IOLA 1EG7A 2FK7A 3GPDG 2ACVA 4YHBA 2PLRA 4PLPA 3KZVA 1CG6A 3B6IA 1HS6A 5A0TA 3COJA 1DAFA 3EF1A 1LEHA 2YYZA 4M9XA 4BQRA 2XCTB 1XAJA 4X60A 3IT0A 3ZBUA 5EP2A 1FQOA 4YRMA 2C4VA 4B3JA 4ZCQA 2EERA 3JQEA 3VZCA 3VFDA 1ZA2A 1KDVA 2KC7A 2ZRNA 1CY1A 4G5FA 3T9KA 2YWBA 4EABA 3VYSB 5JASA 3CHSA 2M32A 3HR8A 4W6QA 1JIXA 4W7HA 3HXPA 2P62A 4MQMA 1E8WA 4QDOA 1KYYA 1LLCA 1Z0AA 4KB5A 2J3IA 2R8BA 1DC8A 4X1KA 3GAFA 4Y2QA 2OLEA 2PUAA 3FWPA 3C39A 1JMYA 5BN5A 2E6KA 3FF4A 5T8IA 4R16A 2BHSA 5TQ2A 2ZR8A 4UARA 1DX4A 1RKBA 1TE2A 2HNKA 3DV0B 5AMXA 2OO5C 3KP1A 5TY0A 1LD8A 1XLVA 3EMDA 2ZT7A 4GTQA 1AQNA 3QLJA 3CM0A 3UTCA 3TX2A 3UV3A 3KUKA 5IXJA 1KAQA 4NZ9A 2V4ZA 5DW0A 3H18A 4GPD1 1HOXA 2B34A 4ZEVA 3QK7A 4C2UA 1OT5A 4HKTA 1CS0A 2ZYHA 4U9UA 2G8NA 2WIFA 1OWMA 4MPRA 5ICSA 4TV8F 3C3XA 3KZ1E 3OEHA 4F7WA 1RABA 1Z29A 4I2VA 5IULC 3AEUA 1N2GA 5BO5A 1JN0A 3DTNA 2HSGA 2XX3A 3TG8A 1NLFA 1NVTA 2PNJA 3MQFA 3ADDA 2IU4A 4MA5A 1G17A 3EWIA 2RC6A 2ODTX 3BIXA 3ROMA 1F8GA 1PQ4A 3TAXA 3JQAB 4OM7A 2VN8A 4DXHA 4JWKA 3DAHA 1FMTA 4DADA 3GZNA 1NXXA 5FNZA 1U28A 2I6HA 4HWTA 4CU2A 4TMXA 3B7UX 2H52A 1WUTA 4BFLA 1V45E 4ZVNA 2OXIA 1S1MA 2PWZA 2B37A 1J90A 5JLAA 1CJVC 1OOEA 4L4RA 1M2GA 4LY3A 4RY0A 1G5RA 2BZSA 2XUKA 2INGX 2Q1YA 5LOVF 1GPDG 3VU1A 1Z2EA 3TWQA 2FN7A 2ZJ6A 4IGAA 1DOHA 2G04A 4QHYA 2BFAA 4NYMR 2YCLA 4H6XA 5BT9A 1T1JA 3ABZA 4DIDA 4WHMA 2QFCA 1ZCFA 1DKLA 3IAFA 3OT5A 5HRCA 1H94A 2Q46A 3SEAA 3GVCA 3S6JA 2PBLA 3NTRA 3RODA 4HEQA 1H8HA 3TL3A 4Q3CA 4EUEA 1U3VA 1ZISA 2LAIA 5B1BE 4Y2PA 4RE6A 2H1CA 4NURA 3C2QA 2Z6QA 4RW0A 1DPGA 1DCEA 2DTEA 4GF5A 4R05A 1X86B 1NJ1A 2PJRA 1RSZA 4MV1A 3K53A 1KLXA 1XP8A 4L23A 2P3SA 5CAEB 4M55A 1GZ6A 5FBHA 2FZGA 2X6TA 3EY9A 1NQAO 2GJKA 4BMCA 2J3MA 5FBWB 5CFQA 4DCVA 1C9DB 2TSYB 1RLIA 1QB8A 4RAOA 3DLAA 1OFVA 3O9ZA 3QVVA 4L5IA 3MXTA 4F1SA 3AF3A 3ETEA 2IIPA 5IKMA 4P29A 1ZINA 2NACA 2DPLA 3O8QA 3OFJA 4INZA 2OECA 4AV7A 1GPJA 1TJCA 2PXAA 4DSUA 4R98A 2XVYA 3FUKA 5DP1A 1JH9A 4ZYLA 2DWUA 4IDBA 2UUBB 2JCVA 1W4LA 4IKPA 3OQHA 2JHAA 1PHRA 1N7HA 5K51A 2WSSA 2POCA 1JF8A 1FLVA 4DC0A 4P58A 1BHQ1 1G1MA 3ROKA 3EGIA 1J97A 3VU8A 4WFIA 3QLUC 3R44A 5DRYA 1XGKA 4UVHA 2W93A 3ZGZA 1HBJA 5LWHA 5AVZA 3MS7A 2Q2QA 3OZSA 3VX4A 2IYYA 1PSDA 3J81k 1XALA 4TUYB 3WK6A 1E3MA 2ZBVA 1Z22A 6REQA 2H0AA 2IPOA 4LDRA 5TGZA 3LLVA 3FFAA 2IOHA 4JI2B 4EW1A 1ZZGA 5LQKA 1P1JA 2VPXA 1JWFA 2OY0A 3FSJX 1CHNA 4KUGA 1MX9A 3B6EA 3CSDA 1NRJB 3MW8A 1M6EX 2VYNA 1IB6A 1YB1A 3GP5A 4JA9A 2PWYA 4HWGA 4EPYA 3WYCA 1YQGA 2A5EA 1I4LD 3QQPA 3AM3A 2G6BA 3DXZA 3L93A 2J5QA 4QREA 2NP7A 1K6IA 1HG0A 4C43A 2J3QA 3GBVA 4FX5A 1LPSA 1NGSA 3U9TA 4JASB 3CRNA 3GLTA 4IIGA 2CFSA 1H93A 3UH1A 2JZCA 5KB3A 3DMPA 4OL0A 4M86A 4JJFA 2OCLA 2AKEA 2IYQA 1D6NA 1TO1E 3Q72A 4P22A 4YMGA 3QNUA 4JJEA 3T8KA 5HX7A 2NU7A 2KX7A 1S3GA 5E2BA 1N34B 4RKQA 5HQ8A 3PGXA 2IYAA 2BJHA 4MWTA 5JAOA 3BC1A 4EYSA 5IANA 1Y8AA 3G7NA 5F7JA 5IZCC 3GJXC 1R15A 4PPQA 3D4IA 3PDWA 4ZRMA 1JHXA 4MIKA 3AXSA 1Y5NA 2GM3A 2FSIA 4XWOA 1I5EA 1HFAA 4NK5A 4I9NA 3T5VA 2A86A 4MGKR 4RVCA 2IV2X 1E6KA 3D5QA 2AEMA 4JLNA 4KN6A 4A6EA 4I1AA 2HLHA 4XYGA 3LBYA 3BILA 3CN7A 4J7UA 4JP8A 3AJ9A 2G5GX 4RYDA 3CEJA 3D6HA 4E32A 2XVMA 1QHGA 3KAPA 2FO7A 3PVLA 2O2SA 4WVLA 3M3PA 2YASA 4IDDA 3HJCA 4HADA 4GI1A 1FYXA 1Q0PA 2PUJA 2YN0A 4EFNA 1W6UA 4UAVA 4DTIA 5U9CA 4YRRA 1W30A 2HREA 4KLCA 1OXTA 4BNLA 3DNMA 1T2UA 4EZLA 1ZU2A 4RZSA 1ZVJA 4BKMA 4M1KA 1U0OC 2B1IA 3IHVA 4XDHA 2OXCA 5J4LA 5L6MB 3DLIA 1B76A 1RZ3A 2NTJA 2OKGA 3OBBA 4DLKA 2ETAA 2UVPA 4ZK6A 1ZOPA 3TDKA 1Z33A 4R7LA 3AG6A 4GS5A 2X2PA 1H5NA 3O9VA 3WXXA 2JKYA 5H3CA 5LU8A 3G8CA 1QUFA 3RSZA 2GKGA 4WDRA 5E0KB 3OQIB 2NT4A 4IZ6A 4MKRA 4RIEA 3M5WA 3CHPA 5GJBA 4MKHA 1V54E 4GA2A 4WMLA 4Z9BA 1EINA 1Z7WA 4X5OA 4DKXA 2KXPC 4U2EA 3CCBA 1N3BA 1G4HA 2X41A 1UJ6A 3VSBA 2B8TA 1PBTA 4KQJA 3EUVA 1GCUA 1I3MA 3GJ8A 2JFHA 5I5EA 2WICA 2WIKA 1NN1A 1YQEA 1TZMA 2VPTA 5L45A 3KALA 3PT5A 2WHQA 3IUJA 1J1ZA 2O1SA 2PUEA 4X1YB 3VPDA 1F7VA 1C9NA 2IXTA 3ZRHA 5KNGA 4H7JA 1Q50A 4M1YA 5IJXA 3KLBA 3QVLA 721PA 2G0AA 1GCIA 2QLFA 4D4HA 3H83A 2QV0A 2QT1A 4GOND 5A71A 1U7PA 4MUYA 1EUQA 3HXLA 3AVPA 4JQSA 1C7RA 2XXAA 2OZEA 1Z26A 2CMGA 2F3TA 5BYJA 4C7KA 4LWOA 2H4ZA 4V0ME 4DIKA 4B71A 2WHPB 2A92A 1YE8A 2WWFA 3THXA 1SIOA 4OLFA 3CS3A 3OETA 4ANFA 1KY3A 5LA6A 4MV5A 1PUJA 2JH8A 4NC9A 3ZDXB 4KI7A 3RBZA 2XZOA 4J1SA 4F9GA 1N5MA 2EZ8A 4B4OA 1XVTA 4K9SA 4A0HA 4H17A 2VOJA 2AZDA 3N75A 1VJDA 1T8WA 1K1AA 3VZSA 2CUZA 4DC1A 1CNFA 3DAGA 3IAUA 3IMFA 4WNFA 1E5LA 4AKSA 1F4LA 3A27A 3VDMA 1U2RA 4GZDA 1LRLA 3IAXA 4RK1A 1NFFA 2O48X 2Z5FA 2W5UA 5FT9A 2XGMA 2BMDA 1W52X 3O73A 1U4SA 4X92A 1LLFA 2WWGA 1IOLA 4BBPA 4P1ZA 2V7PA 3C3KA 1RWKA 2WWHA 4AULA 1CUAA 4JOBA 1TKCA 4QUHA 5EKTA 1A3CA 4Y2UA 4Y2SA 2Z1NA 3R3UA 4KPEC 1K6XA 3I01M 1PD0A 2H1HA 5AICA 4HQNA 1Y6IA 1L5LA 3SYMA 2FETA 4YS6A 3WJ2A 1E1QD 3OJCA 2EIJE 3RU7A 4J0JA 5DMXA 4LBVA 4UM7A 2E2EA 3JQGB 4BLVA 4TRNA 4D79A 2QJWA 5M29A 4BC1A 3JAKB 4Z4CA 4NBUA 2RK4A 3NCTA 4E2WA 4IPTA 3DH0A 4JLUA 4BZPA 1RYEA 2RHBA 2VHCA 1C50A 5BNWA 3M1LA 3VI4B 5CHEE 1GM5A 1Z5UA 3AW8A 3V6MA 1DFGA 3BJRA 2EFEB 3B1VA 2AR7A 4P86A 4C0AC 1Q12A 2Q8QA 2GNPA 3SS9X 3RLFA 4B4DA 1KJ9A 2HA3A 3PRZA 4F4IA 1KZ7B 1NW8A 3CVQA 3F74A 4LHYA 2BGLA 5F76A 1R3DA 4MPDA 3TWOA 1ZBQA 3TLBA 4A91A 1CDOA 1XAIA 1EGHA 4MGHA 4HNSA 1OLXA 1SUBA 2Z0MA 4QO8A 2R25B 1QCDA 3B20A 1NIJA 3GJYA 4MMYB 1U7XA 4Q4AB 1A8QA 1PZEA 3ICCA 2NUAA 2YICA 3K3PA 1TA0A 4YMTA 5DI3A 3U4HA 1WIWA 3B60A 1ESMA 2Y76A 5FUVA 3ESCA 1KPGA 4KR3A 5BYAA 2FPGA 3I4CA 1RHQA 4NWIA 4JYPA 4AVXA 1F2VA 2WDZA 1CU1A 3GGGA 5C7OO 1QC5B 4MWGA 3H5WA 4QGBA 3VTKA 3Q7AA 2QTMA 1B14A 3DUFB 5AVXA 4WWPA 3E6AA 3WWCA 3GD7A 2GK4A 5KZMB 4QQIA 3OECA 1ZS9A 2QXTA 2WYWA 1HFEL 1ZCZA 3PF8A 3LQFA 2FPRA 4N12A 3G8BA 1Q20A 2YVUA 2MSCB 1JHRA 1NL4A 2GF2A 5B7QA 2AJCA 3PUZA 3ZQKA 1YOVB 3JQ7A 1OZAA 4BVAA 1N5RA 3SHFA 4TTVA 3U9LA 2QMOA 3KEAA 1TFRA 5AVRA 3V9PA 4DCMA 4FSXA 3BQMB 1JQJC 4OBBA 1GN8A 3D6VA 1OTHA 1HE3A 4GGPA 3AK4A 3FMIA 2JAUA 2WOJA 3TRJA 3SXUB 5FQ7A 3T9EA 3JALA 4RC9A 4JEIA 4KV9A 1C9JA 2I9KA 3ZU7B 1N9ZA 4JYZA 2O6LA 3P8ZA 4ZQEA 4O0MA 4YJ3F 2RHDA 1IBRA 4DX2A 4QT0A 4ABYA 1JG4A 3QWWA 2R2LA 5AARA 3Q10A 4RG6A 2B2NA 4QRHA 4L9PA 1QPGA 3A9UA 4MUFA 3OLZA 2P69A 2P9GA 4C4XA 3IP5A 5GADl 3OZAA 4UUBA 5BSGA 2GRNB 1TM4E 4AX4A 4H3VA 1O2DA 2CDBA 5DULA 4L4UA 2AFHA 1KYWA 2DZDA 3TL6A 1C29B 1I5RA 4U7EB 3JWHA 2CF6A 1VE6A 4XIGS 1AV6A 3L1JA 4C4RA 4F4JA 1S7GA 5DF1A 1Q0SA 2QY7A 5JXIA 1V11A 4OGWA 4FGJA 3PDHA 2AWNA 3KAEA 1A9XB 3BG0B 4GMXA 4X3CA 3LDAA 5DX1A 3HQ4O 3C97A 5KTMA 2OXTA 3RYHB 2WQHA 2JAXA 3SSMA 4EZEA 4DGQA 3CUYA 1S2GA 4L9SA 3HZZA 1WV1A 1ZH8A 1KZOA 5I7RA 3R0QA 2Y68A 4FHZA 5DBOA 3BSWA 4U8VD 1BD8A 3PNPA 4AN1A 1LVGA 5CHEA 4KTVE 2FGKA 3L7MA 1QIFA 2GPJA 3RKSA 2EV9A 2SNIE 3UBMA 2GH1A 4INAA 2VUTA 3FOCA 4Q19A 1G9TA 2JLZA 4U95D 2JLCA 3GPIA 2Q3EA 2ATIA 4EI8A 4CMEC 3KQYA 4B6JA 3DULA 1RXUA 4EJ0A 3PITA 5EUQB 4DOMA 2II6A 1QO0D 2BEUA 5ALWA 2A1UB 3B2QA 3BF8A 3I37X 1IXSB 4HDRA 3ZZ1A 4D4GA 2O4UX 1B0UA 3OUZA 2YHCA 2RBEA 1J99A 2FI1A 5LDDC 3JATB 3WO1A 1GYQA 5ESWA 1T26A 2HF9A 1CPYA 5CLGA 5IW8A 1Y34E 1K06A 3TD2A 3LT2A 3GMIA 2QG9A 3P0RA 3RYIB 1D09A 2G36A 2VHUA 1O94A 2VJKA 1NT2A 3L9WA 4ZV7A 4J76A 4YLYA 1CVRA 2GILA 1TGYA 3PCXA 1U80A 4GLOA 2QTZA 2GTIA 4FJYA 1J2JA 4K6HA 1FTNA 1KI7A 3RYCA 1UP7A 1Z0SA 4NG5A 1KSFX 4O1HA 1JWBB 4AJNA 4YQZA 4W63A 5EE0A 3SM3A 2R00C 4RD1A 4EPTA 1JZSA 1B16A 4XLLA 2SKCA 2X1HA 2Z43A 3LY5A 3NVMB 2CBZA 2B4YA 4MR7B 4PUCA 2HF8A 2B25A 1FFHA 4BO4A 4QSMA 3CJTA 1FZTA 4MR8A 4IBOA 1F17A 2FKNA 4ZKDA 2YFKA 4P38A 5L4LA 3NIWA 2IXGA 4JXJA 3MWYW 5B58C 2OBFA 1JVNA 4PSDA 4BFUA 5DBEX 1KNQA 4L5JA 3AR6A 5TR9A 2DTDA 1CUJA 3L40A 4G8JA 4EW2A 1NR5A 3HRAA 1D4AA 3OESA 2PL2A 1ARZA 2I2AA 1TEHA 4I3HA 5KYUB 2VYVD 3DBIA 1XV5A 1AUVA 2J49A 1SZ9A 1VP3A 3NBNB 2WB2A 4X90A 4MVJD 1SY7A 1ESDA 5T4BA 4R7GA 2OD9A 2WQ6A 1Q7BA 4MYRA 1AKTA 3KPJA 4BKQA 4NBWA 5BVHA 3AXTA 3X1YA 2BE7A 3PEVB 2NYUA 5L40A 4BNTA 1XXHA 1UMCA 4BX8A 4MVYA 5F2EA 3RO2A 2ZS7A 2GHRA 5CEFA 4YVFA 3ZWYA 2H1OA 1RC0A 5TMBA 3P2IA 2YXEA 4KFUA 4Q1FA 3GK3A 1ZJ4A 4X8LA 4QTZA 4LZNA 3ZPJA 1RWWA 1G7TA 3ESKA 2IDZA 2C97A 4X44A 1RHMA 1N4SA 3VH3A 1D2GA 3A6HA 1JQ5A 3L54A 4W6ZA 4HLNA 4D98A 1L4YA 1X42A 1NA0A 2PRSA 3T54A 1A9TA 1Q91A 1N77A 1J5PA 3ZVVA 2ZCJA 3PXCX 3ZQ6A 1OLSA 4FYIA 2PLFA 4PS0A 5L53A 2IYTA 1BWRA 2GCGA 3TZEA 2KMLA 4QULA 4DQ0A 5GY7A 4B83A 1GGNA 4F04A 2XCCA 3BK2A 4JVNA 2AG6A 5T6BA 1I2AA 3FU0A 3ZGYA 4LX0A 2DCPA 5KJ1A 2PJZA 1YXMA 2JNWA 5FIOA 4BU0A 4I1YA 2YL2A 2DY0A 3TLAA 4D9GA 3N7AA 1MLDA 2QL7A 3M89A 4B75A 3IQEA 2J3KA 3TWWA 4C89A 1C1XA 2ISCA 1ZR4A 1V5IA 3FSGD 4H1UA 5JATA 3W1VA 1XZLA 3D0OA 3W2FA 1BPOA 4N0EA 1Z4MA 4ISCA 2X6JA 1I4TD 1K5GA 1EFDN 1YS6A 3GUUA 1V16B 3VZDA 3W8FA 4ICIA 3TLCA 4ACLA 4MQEA 3RRFA 4INJA 3UJBA 2ZUCA 1N0UA 4GBMA 1XPJA 5JWHA 3TSCA 3H5AA 1L1FA 3CVPA 4UTPA 3F5MA 1K5HA 2A3RA 2WFLB 5DHSA 2AN3A 3NVAA 4CEIA 2CXTA 2LSVA 3AS5A 2OBLA 4WOCA 4BL5A 2Q3MA 5REQA 4HH0A 4XW2A 3UCXA 3FDJA 1H4VB 2DUJA 4ESHA 1U0NA 1UXIA 4BGDA 1AIPA 3Q6NA 3RU9A 2D0IA 3VZPA 1P1RA 3VMMA 1Q1EA 1WG0A 5EJ8A 1JG1A 3A04A 2Q3LA 4CJXA 2NQ2C 4LXUA 3FTNA 3PGJA 3DSWA 3WYFA 1I10A 5JS2A 3ZWWA 2X5JO 3ZKAA 4B3CA 4CKWA 1U8XX 5C81A 4X00A 1F9EA 4B4KA 2O20A 4LVUA 2ADFA 3KKZA 4BZQA 1R0ZA 3B1FA 2PUFA 2WKSA 4R2IA 4RH3A 4Y6QA 5EMHA 5EZYB 4DX6D 1PK9A 5KYYB 3U4QA 2H4XA 5EHQA 1DQYA 4YRJA 1YRBA 4KRXA 2I2XB 2SECE 4K6CA 4RTNA 3T95A 1ZN7A 5G04C 3M9XA 3PNMA 4FQ8A 4O2AB 2D2EA 5BPHA 2QW8A 3F4KA 4JZKA 4YXWA 5JY6A 3T06B 2H7XA 3N2KA 4IILA 1R27A 3GLVA 3OWOA 3T7IA 3E1SA 3UYKA 1YBHA 4AZ3A 3IPAA 4IS3A 2X5NA 1NRXA 2SKDA 4DPKA 4JXKA 4DLSA 4HGRA 4YJGB 4QZVA 1KXZA 3C7DB 1ZI9A 3ZHQA 3DT8A 4DG5A 2V58A 2R87A 4YT2A 1TM7E 4IW3B 2ZJBA 2ACWA 4XIIA 3U7HB 1SRRA 5G2OA 1W0JA 2RGRA 4WT7A 5JW6A 3QA9A 2IHBA 2NNWB 4LQDA 5JARA 1NBME 4DCOA 2BJWA 4FOLA 3BJMA 2CDAA 3LUDA 3PQ2A 1F5NA 4AUNA 2HWYA 4LUNU 2R751 3UHOA 4KQCA 2OXRA 5AI8A 3WIDA 1N36B 1D0VA 3CRRA 1PV2A 3UTMA 5DO9A 1JKIA 2JEZA 4GICA 5JNTA 3IQGX 2FEPA 4BNGA 3CW2A 1FSSA 5LB2A 5JECA 4ZREA 1FY2A 4HRVA 3DXMG 1VKZA 1HYBA 1BS9A 1OX5A 3WXMA 3LCAA 3INRA 2GYYA 2IU3A 1CQZA 5G41A 3NIGB 1RXIA 1IHGA 4TQ9A 4J6EA 3W7BA 3HVUA 4F2PA 4EPWA 3KJXA 4YNBA 3BORA 1FLAA 2J6BA 4RMHA 3BF7A 3MGGA 3OZFA 4P33A 3LVQE 2Y1WA 3NVDA 1VE5A 1Q0ZA 4F56A 3PC6A 4JMLA 3WB1A 2H4YA 2AEEA 4K1LA 3LY9A 5JRJA 1ZQ9A 4B79A 4JGBA 1SH7A 3ML8A 3L7CA 2EHDA 3EQ2A 1J22A 2ZETA 1IPHA 2HU5A 7ABPA 2VWGA 4QXMA 2I67A 2BKXA 2LAHA 2FPKA 3DW3X 5JYDA 4O4JA 3O4IA 4E13A 4BB5A 2IS6A 2WWVD 5AVQA 5K3EA 3SFXA 3MS4A 1M34B 2W11A 2V54A 1X1TA 1K92A 3VO1A 3VKFA 3D0KA 3I1FA 4J0KA 3V1LA 5FLKA 4JQYA 1UKZA 3CB4A 2QGFA 4A0QA 5BPPA 3MMZA 3ORHA 4PYQA 3E22B 4XSHA 4CT4B 4ECAA 1QRUA 3HKBA 3GP3A 4RXMA 3H1GA 3W90A 3HUDA 3P19A 1N2CE 5HOQA 4QA9A 5A4DA 4PO1A 3R5TA 3KWMA 1OU0A 2XJ9A 5CB4F 4J0EA 3BXGA 3CLTC 3R77A 3R74A 3C6QA 5ILOA 1I3NA 4GXRA 2QP3A 4AS2A 4KGZA 3QKSA 3FKQA 1IRIA 1B23P 3DZGA 4II2A 2EP8A 3AF4A 3BL8A 3DZHA 4BAZA 4CZ2D 3NPMA 3OF5A 1QGED 3QG5A 5DHUA 5G05C 4QPDA 3T5BA 1TL7C 1N25A 2EJUA 2RONA 3L5KA 3HYNA 4W1QA 3NANA 5TQVA 1YFJA 2NU6A 3S2AA 4L2IB 1HYEA 1F9AA 1COWD 1QGUA 1C7JA 2NADA 1M5TA 1Z2NX 1QHNA 1O96A 2YHIB 1A76A 3VVBA 1TUIA 3LQ1A 2IS2A 2ZREA 4DMKA 3W4JA 5B6IA 5AR1A 4HHEA 3JVUA 3VO2A 4M1ZA 4TKUA 1CVLA 1RJEA 1D4ZA 1GLGA 2ZIAA 2ZYWX 4EA8A 5KU7A 1H2TC 4XFJA 1WRBA 3TOVA 2AJLI 1NBMA 2DQKA 1SA0B 3R3ZA 3A1SA 1D2AA 1JUQA 4J49A 1E58A 1X7HA 2JEYA 3E84A 3DL2A 1JKJB 4OO3A 3A6PC 1P0QA 1NMXA 2RJOA 5CA0A 4C30A 2G28A 3U6BA 4YRCA 3A3PA 2X8BA 2BFOA 5GOZA 4MVJH 3ACCA 5AJHA 5LMNB 3PGVA 3KZMA 1RI5A 1C0LA 2NSJA 4N6GA 3AEKB 3H5TA 4KIFA 4IRUA 3A58B 4F72A 3UM3A 3PQ4A 2PX8A 1S8NA 1Z34A 1ZJZA 1J8DA 4HBGA 4O59O 4DV1B 4PNEA 1QNFA 4KHPB 1WD5A 2ANCA 2Q2VA 1NF8A 2NV2B 2C4UA 4LVOA 4YQYA 1Z4PX 2DPGA 5C1OA 1PDVA 3RKVA 3C3OA 4AZ0A 3LDZA 421PA 3EGXB 4ZHQA 4KZPA 1O95A 3DE7X 1QANA 5CX1A 2EL7A 4M8NE 2CHQA 3ZHOA 3KD3A 2CFTA 4AJLA 3HL0A 3OCUA 1A2KC 2X38A 5TEVA 3RI3A 2XUQA 1AMOA 3ZQUA 2QVXX 5EVCA 1D8TA 5BV2P 2F90A 4MDEA 4C5BA 2CLMB 2QPTA 3IILA 3W6ZA 5FI3A 2XUPA 2XMRA 3RB8A 2IHVA 4LOLA 2Q6OA 1NPTO 4NENA 1ZH4A 3GLHB 3IELA 4M0PA 2EARA 1BG6A 2UWJG 2ID4A 5HPYB 3BD8A 3FVTA 3JRNA 1XN4A 4UNPA 4BNKA 4IIXA 3EZ9A 1QGZA 1DXHA 1X7DA 4MPJA 2RD2A 4W8HA 2C04A 1MHTA 5FL7A 1XHFA 3QTBA 1YI8A 4OI1A 4LDNA 1PR1A 3E9RA 5GMOA 5GVRA 5DYIA 1ONOA 3NHUA 3D1VA 5AJVB 5JQGB 4GZ6A 1N2CA 3EQ6A 3RUFA 2B8JA 16PKA 3V2HA 4XX1A 1NRIA 1RW4A 5I8PA 4H3KB 3NTVA 1NFIE 1CEQA 4LGCA 1AB6A 4G5SA 3EXHC 1PFWA 1QG4A 1X2BA 4OGLA 1ZM7A 1PNRA 3CCCA 2RAPA 2VJMB 3G2HA 2N9UA 1L5HA 3FGOA 4J7XA 2BCJQ 4G1FA 4W5OA 3ISJA 4E08A 2BFEA 3FVVA 2WFAA 1OZ0A 2H6HA 2CKMA 4NV3A 3WOVA 4DLXA 1OAOC 4DIUA 3BWYA 1JMKC 4EO7A 3TOXA 2TMKA 3DTTA 3TUJC 2AN5A 4I50B 4IRMA 1UM9A 5BXQC 2JH9A 4ZAYA 3CF4A 3Q15A 4P3XA 5AQBA 4QUJA 4YRLA 1S8OA 1N8KA 3RIEA 2JIBA 1PR3A 3L1IA 1ZZEA 2H6IA 2AG0A 4TRQA 2JW5A 1QOQB 5C34B 1UR5A 3BGVA 3VNBA 1YHZA 1VIAA 2XPZA 4MI1A 1OZFA 4COOA 2FF4A 4YMWA 5MHTA 2GD1O 1YV9A 2R6DA 4X1IB 1AS0A 4NFYA 4L3VA 2P90A 3NH9A 5CUQA 1A5BB 4BNFA 4F4HA 4MKGA 3O1IC 4LMRA 1PD1A 3JD2A 4IMJB 3IKMB 1NQXA 2IQIA 1KL7A 4HH4A 1OYYA 1T43A 2NQTA 6NULA 1JILA 1YONA 3RANA 3W5HA 3EIUA 2A0YA 2JRLA 3SS8A 5KC9A 3G2QA 1FNBA 1MW8X 4C5AA 3WAKA 4NF2A 4BMOB 1QVRA 2ZU6B 4BRSA 4XB2A 3U4GA 3MWJA 4M98A 2YOFA 4IXTA 4RZIA 3QNMA 1DAHA 4IEEA 5FI0B 4C78A 4BNJA 3SSOA 4XGIA 4UQYA 1ZJJA 4MVWA 1IHBA 1B93A 2EKZA 4OJNA 1BJRE 2VJOA 1ISFA 3GFPA 5HTOA 3C3AA 5B1DA 3MLAA 2XYGA 5K8VA 1KSHA 3MILA 1Q0RA 5HFNA 2WAOA 4WXYB 4L22A 4P31A 3L4BC 5SZHB 2KQUA 2OR3A 1MJGA 1LDYA 4J0UA 3WNVA 4KQ9A 1KTVA 1V6CA 2P4UA 4K9DA 2ODPA 4X62B 1DRJA 3KLMX 3FH0A 1J2YA 3P5SA 1XTQA 2XTJA 3RUCA 3E9MA 5B30A 1YR3A 3NBMA 2QENA 4M6WA 5JH7F 5AVWA 2LSUA 5AIBA 1Q0TA 5KCMA 4CFZA 2Q0XA 4QPCA 3RS8A 3CVUA 4D0NA 2J9GA 2GI4A 3OAWA 3DT6A 2JFNA 3EXIA 4ZI5A 2O0MA 1UBTS 3ASHA 1E1LA 3WKDA 1XHEA 1XQXA 3D8SA 1YBFA 1EE9A 3UF0A 4N5IX 1M10A 3PXXA 3SAJA 4UAJA 1E2JA 4EHLA 3I8XA 1BXGA 4KP7A 1FFEA 1RIIA 3DCIA 3K6SB 4Y7DA 1WNFA 3TEMA 4WERA 1LS1A 2IRWA 5DPMA 4UNSA 4QU8A 4BE7B 2HL6A 1XLTC 2YZ2A 3W8EA 2DH6A 3UUWA 4MB6A 5FOQA 4NRHB 5BR4A 1QV6A 1Y8CA 3G02A 4DG9A 3CE6A 1CUDA 2BF7A 3AKEA 4BNHA 4D56A 3CYFA 2FJ0A 1YJAA 1N2XA 2PQ2A 5D00A 3GT4A 1TJNA 2OPHA 4HI8A 4DR1B 3RSLA 3BDVA 3BXZA 3NUQA 5CT4A 3G8YA 2YXNA 3BXXA 2W2QA 4D6PA 5F35A 3ILVA 3C74A 4I5IA 4QPPA 1K89A 3DVLA 4KDFA 1FFSA 1DI0A 1WLSA 2J9FA 1VHWA 4PO9A 3FDZB 1E9FA 4M60A 4Q9HA 4PZLA 3FFWA 2K4MA 2GESA 5A05A 3H9GA 4PC1A 3DQQA 3E03A 3B9QA 3QWVA 3IYLW 2ARKA 5H8WA 3K92A 4WN9A 1QB7A 3S99A 4J8DA 2VK4A 3TYXA 1CJBA 4CKZA 1RLMA 1NI5A 3Q9NA 3MGAA 1BHJA 1WZCA 3UM2A 2VSYA 3EHMA 3TPCA 3TTYA 4DX5D 3LKBA 4TYYA 1QORA 4U8HA 2P9IG 4BMDA 3CE9A 2KATA 1N9GA 1QOZA 1X9IA 1AZSC 1DOZA 2L0TB 4P3PA 4PYMA 2CJYA 2Y3AA 3E2MA 2ZS8A 3VVMA 4U9IS 3DO8A 4S35A 3GDWA 1CT9A 4M8IA 4GO1A 4MH0R 2CLLB 2ES4A 4RVHA 4AIIA 3IJRA 4EPVA 1GAWA 3WIEA 4JBGA 3IUNA 1EDDA 2B8NA 3WLQA 2BTOA 3GRPA 3TSYA 5KQGA 3V2OA 4LHEA 4QXRA 5JFGA 4GXTA 1GZUA 2H1LA 3ZWAA 3K8QA 4IQFA 2HUPA 1T5BA 2C5AA 3BMQA 3PKZA 3ZEAA 4A1SA 4BNMA 1TQHA 4DANA 2CUTA 4C87A 2R96A 3HBJA 2VGYA 1KMNA 2YWDA 1TT5B 2Z6VA 2WINI 3QYPA 2ZWOA 1IVYA 3WK4A 5C53B 2QLNA 3PBKA 3P71T 1WM1A 1IXZA 2NSLA 4K9KA 4C0BA 5FBQB 4O4HA 3DDWA 1CDEA 4Q16A 5FBRB 3DDUA 2OAGA 1YZGA 3OIYA 3SM9A 1PL7A 3DFIA 3WSWA 1TX4B 1DTSA 3JQ8A 3LUHA 3ZDCA 4XUGB 1G3MA 2B99A 2ZB4A 2HTEA 1SOMA 2QE6A 1HRDA 1GFWA 1CUXA 5ALRA 1FF9A 3EPJA 5EGSA 3CPHA 1BX1A 2EZTA 1YCFA 2X6HA 2W2LD 3AI1A 5DMHA 1W88B 1UDWA 4KE8A 3KWFA 2JI4A 1P9WA 3C45A 1YR8A 2QVBA 3QZUA 2FOIA 2VTVA 4K81B 3NHMA 3QEAZ 1CFJA 1ZJWA 5I9BA 1JBKA 3TQHA 3G2VA 4HLLA 2QEQA 3DL7A 4QYWA 2VDMB 1NBEA 3DLCA 3CNHA 3W2GA 4V0RA 1EFAA 3F3YA 4UAUA 2WEKA 2W2NA 3ZHEA 1V47A 1DUSA 1Y4UA 1SOAA 3LBFA 2QLMA 2WFZA 4UTXA 3ZKWA 1XC7A 1EPUA 4CWAA 2E2WA 4TXHA 4U7TB 3W5CA 3OZGA 4PG4A 5D5PA 4ZCMA 1NT4A 2Q3FA 4ZFNA 1FDIA 3TTSA 1E2EA 2WF7A 3KYCA 4G8KA 3HXCA 4H7IA 1ZAKA 3T0FA 2Z4TA 2AGVA 2P2GA 2J1LA 3PWKA 3B5JA 4EF4A 4Z7QB 2VJ8A 4HGOA 5EKSA 5DBHX 1YFZA 2ZRFA 1KBOA 2BTDA 2BKKB 1ATZA 2FZKA 2NP6A 3DDHA 4LTNA 4IDFA 1KY5A 3IQDB 1Z4NA 3HRHA 1YMPA 4ZJUA 4NU6A 3GAMA 3R3HA 2OOSA 2G1JA 1AQ6A 2EWMA 4X64B 1EX9A 1WMAA 3R40A 3PGLA 1TUBB 1BE1A 5EAIA 4RCYA 1GPYA 5DM2A 1ULTA 1NF2A 5DLYA 1O0BA 5ALOA 5F73A 1BQ3A 1VZ3A 1CEYA 1T91A 1H2EA 5GGYA 5KOHA 1AS3A 1SXIA 4O8CA 4PHFA 3TRKA 4EY7A 3NBZC 2YWXA 3EE6A 2CHVA 2OORC 5KO2A 3KZOA 2MR5A 4WKCA 4REMA 4GIBA 1RRPA 2SCUA 3CW8X 4NTZA 3A6ZA 4HRLA 1P6QA 4BO1A 1ABEA 2H6GA 1JTVA 3OU6A 3EDRA 4NE2A 4AJ1A 4L3OA 1V2GA 4P3OA 3G0DA 4EY6A 1P7PA 1VCOA 4OI2A 2QRVA 4FUTA 4M0LA 2OCGA 4X24A 3AU9A 3DWIA 2ODBA 2QTRA 4FX2A 4BWRA 3IIMA 1ZGBA 3EVFA 2PQMA </