1FVHA

Crystal structure analysis of neuronal sec1 from the squid l. pealei
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
590
structure length
546
Chain Sequence
ALKTAVHEKIMNDVVLAVKKNAEWKVLIVDQLSMRMVSACCKMHEIMSEGITLVEDINRRREPLPLLEAVYLITPTEESVKCLMADFQNPDNPQYRGAHIFFTEACPEELFKELCKSTTARFIKTLKEINIAFLPYESQIFSLDSPDTFQVYYNPSRAQGGIPNKERCAEQIATLCATLGEYPSVRYRSDFDENASFAQLVQQKLDAYRADDPTMGEGPQKDRSQLLILDRGFDPISPLLHELTFQAMAYDLLPIENDVYKYEVLLDEKDDLWVEMRHQHIAVVSQNVTKKLKQFADEKRGIKDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKQYQQHVDKLCKVEQDLAMGTDADGEKIRDHMRNIVPILLDQKISAYDKIRIILLYIIHKGGISEENLAKLVQHAHIPAEEKWIINDMQNLGVPIIQDGGRRKIPQPYHTHNRKERQADHTYQMSRWTPYMKDIMEAAVEDKLDTRHYPFLNGGGKSGPRLIIFVVGGISYSEMRSAYEVTQTAKNNWEVILGSTHILTPEGLLRDLRKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of neuronal squid Sec1 implicate inter-domain hinge movement in the release of t-SNAREs.
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords SEC1
total genus 183
structure length 546
sequence length 590
ec nomenclature
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1fvhA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA01
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvhA02
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 1fvhA03
3PUJA 4JC8A 3C98A 5BV0A 5BUZA 4KMOA 3PUKA 2XHEA 1FVFA 4JEUA 4JEHA 1EPUA 1FVHA 4BX8A 4BX9A 5BV1A 1Y9JA 4CCAA 1MQSA
chains in the Genus database with same CATH superfamily
1C0EA 3EMKA 2YZ2A 2EJTA 1FNMA 1C5KA 1JFVA 1O9GA 3L8MA 2A8YA 4Q39A 2XV1A 3S2IA 3A58B 4P6VF 2PQ6A 3ABZA 4LXUA 3ADBA 3CVPA 2B7CA 1U2PA 4JD5A 1IXRC 3EUFA 2B98A 1JQDA 2W6JD 3E53A 4K6GA 2ZYIA 4FR5A 4DRYA 2P9FA 4RK5A 2QTWB 4NMXB 3EIWA 4K46A 4MPJA 2YHEA 5DBOA 4CKEA 4P3KA 1KP3A 4URWR 5AHRA 1NN0A 1PEYA 2H08A 5JAZA 2AR7A 1OLXA 1X1QA 3L0IB 3PICA 4Z1MD 2HDWA 1DC2A 1TMKA 2LTAA 3H9EO 1KVSA 4MQ4A 4QU8A 2DZDA 3KJEA 1GYRA 1JWAB 4AP2A 1EQ2A 4OB8A 3ZWYA 4YAGA 3O4FA 3FH8A 2NIPA 2IZ0A 1NOKA 3JQAB 1V3UA 5E7IA 1NMXA 2J87A 3EZNA 4Q7MB 4E85A 3G0BA 3QU5A 1V5FA 4YREA 1NP6A 4EG6A 4BVGA 3ZDBA 4OK5A 4S12A 4UJ3A 1ORHA 1VIMA 3LBNA 4JGIA 3EAGA 3KBOA 2IYEA 3ANMA 3OE5A 4HX2A 4GL2A 4AP5A 3IJEB 3ECSA 5ICEA 3CKYA 3CLHA 3ZJYA 2CLFB 3A4TA 1S3SA 4GGMX 1CUIA 2AD1A 2W2MA 1FW8A 1J5EB 4E2FA 2Q07A 4UEOA 1V6SA 2BP7A 1LQUA 2X9QA 5FBKA 1E63A 1ZVMA 4H0FA 1S8FA 4LXQA 4LJKA 2ZE8A 3JR7A 3UJDA 3CLVA 4GPAA 2FI1A 2A0WA 5DULA 5LYJF 4QAJA 1GR0A 1W0JD 4UI9K 1JB9A 5T57A 3D0KA 3RE1A 1P4AA 2VQ3A 4HRYA 2OMKA 5A5FA 4FDLA 4REQA 5JS2A 4P3PA 4TXPA 4D8UA 1QF9A 2CD9A 3JQ8A 2JIRA 1YH3A 2CL7X 5IX8A 4FMCF 4NJEB 1A8QA 1KMHB 1N9ZA 2FPLA 3ZIMA 1JCQA 2C5FA 1JA9A 2I1VB 4WWPA 3HNRA 3LLMA 5JVDB 1BE6A 2AYXA 1W52X 1O1YA 1HETA 1YDMA 1N1GA 5K3AA 1CJUC 1CNEA 3STUA 2OG1A 1R16A 3MJEA 2WXRA 1TJNA 5L9AA 2ZBVA 4IYJA 3L7OA 5ALEA 1P62B 3T9BA 4NQZA 5DNUA 5K3EA 2QVYX 1JVSA 1SUSA 3O3OB 3OPQA 2MOKA 1M8GA 4CDMA 3EIEA 3E3LA 2IODA 4KEAA 1O87A 4TX1A 3CZ9A 3MA5A 2AW6A 5BW6B 2P65A 1Q77A 4BCBA 1N2SA 3F7MA 3JX9A 3YASA 4LYDA 5C8VA 2XCBA 1UBCA 4JHJA 3FUEA 3OZUA 4RM2A 3K2IA 5J2TA 1GG5A 1H6KA 3HJGA 4DLUA 2D06A 5B37A 2DQSA 3ZQUA 1GARA 2EZ8A 4MINA 4P92A 1CIVA 1D5WA 3TW4A 3UJNA 4MDYA 4TL9A 1P4GA 2GPTA 1TUEA 3IODA 3JW8A 4KXLA 5AW8A 3OU2A 4Q21A 1EZ4A 3RFFA 1ZM7A 4EB3A 3AHFA 3K1TA 1V43A 4LZNA 5CXSA 2XX3A 5CRUA 3THXA 2ZRJA 3ONVA 3UC9A 1QHFA 3L8YA 1CQZA 5AQ9A 2FX5A 2XQVA 3QEKA 1PJSA 3UY4A 4BZPA 5LMZA 4C5BA 4QODA 3EZ6A 3SS9X 1MIOA 4JFRA 5EWLB 1WAO1 4RS4A 2ODWA 3T5VA 3CZAA 1HY3A 3KR2A 1Z3YA 3GA5A 4WRRA 1FJGB 1DLIA 4JLVA 4LJ4A 4MKXA 4UHDA 1CY6A 1VDMA 2JHAA 3I3SR 4FX2A 4ZD6A 4OB7A 3I4GA 3K5PA 1NW9B 3ZYLA 5KJMA 3NIWA 2J4BA 4JLOA 5CCXA 4M0PA 1EKXA 1Y8AA 4TKLA 3ZX5A 3WHKA 4CF7A 3H5RA 4LK2A 4LTDA 4D9BA 1AKEA 4TV3A 1TM7E 1XEAA 2WA2A 3QY0A 5BNIA 1UC9A 1ZWKA 2OORC 4DTIA 3RIGA 5JXJA 3AOGA 4ZYLA 2X13A 1ULHA 3DWEX 3O8OB 5F23A 2Q5HA 1XWIA 2VYQA 1XVLA 2WMOA 4YRQA 5DT2A 4A0GA 2D5CA 3M2TA 2V3CC 1O95D 4ATNA 4L7TA 2MSKA 4EHLA 4RKQA 2J0UB 2BHNA 2PL5A 4WKNA 1N0UA 2BKKB 2RG1A 5B3LA 4V1CB 4UQXA 1ZNXA 1BE0A 1M6EX 1SUIA 1T8UA 4NMMA 2EYUA 3ZCVA 4H17A 3G8DA 4AL4A 4FJYA 4TS1A 3SEQA 5BWOA 3LJ3A 2WMNA 1PL0A 1W4LA 3LBIA 5TT0A 2JK1A 2X6QA 2ZSUA 3WSTA 3U19A 1GHTA 2HSJA 4C7OA 1GPUA 2OSVA 3ABME 4UWKA 2AEFA 3PYXA 3KOZA 3NDBB 3FGPA 4RHCA 2NQ8A 1JE0A 2M6LA 1H4VB 1AUPA 3E2IA 4KQEA 1NX6A 3N58A 3WWEA 3ZY2A 1T6ZA 1Z73A 4A3VA 2BBTA 4ZA2A 2CVOA 3ZDFA 2WTNA 4EPZA 5B1DA 1GFSA 1BH2A 4YP0A 1U9JA 3U3ZA 4YRBA 4N41A 2ZYGA 3THXB 4CR8A 3UUFA 4RTQA 3BDAA 3EIXA 3IOCA 1WNTA 2IZ6A 3AU8A 3AIMA 1Z2CA 1C7FA 3PQ8A 4TUYB 4V2IA 4HNVA 1JDPA 5FZSA 2XW6A 5FB3A 1J56A 4IHJB 5AQAA 3OX1A 1NR1A 1V8DA 1R4NA 3OY2A 5AJXA 3AL3A 4ZPXA 9ATCA 4B3HA 2KWIA 4DCOA 4DR1B 3R6TA 1XCLA 4D9JA 1Z5WA 2VDWB 1B1CA 1XEXB 5EIOA 4JQYA 1J2JA 3V7YA 4CG2A 4BASA 1AZTA 2FFJA 1D07A 1ODLA 4V0ME 4HVBA 2G7MC 4G07A 4WLFA 4QD3A 4CIWA 2ORVA 3TW8B 1U02A 4QJ3A 1KI3A 2BEUA 2QXUA 1JQLB 3OM1A 5IFKA 2ETBA 2V0PA 5FPTA 2WMOB 1GFZA 2B25A 4ZJUA 5JAHA 2AK3A 4OTZA 5THQA 4CEMA 2WSBA 5I5GA 5A0VA 3KHSA 4PQYA 4LV5B 4YDQA 3HU3A 2K2WA 2QGFA 1SXJE 1BPOA 4PEVA 2IXGA 3I1JA 1JPLA 1N2OA 1NW4A 5DHSA 2XYQA 4RDXA 1G3QA 3CURA 3O94A 2OEVA 3MMSA 2PSEA 5ENDA 1E6WA 3PUVA 4IMJB 3VTYA 3GX1A 1WNFA 3TGOA 3HACA 4P4TA 1PJBA 2Z43A 4F2DA 3OD1A 1IHYA 4KN5A 3WK8A 4C0BA 3DV9A 1HFEL 3JSXA 2F0YA 4BUJA 5LP6F 4D8TA 3CFYA 4DLYA 1Z17A 3ZOKA 1GPLA 4GRDA 1QCZA 5BRNA 3L4SO 3UEOA 1CY4A 2DHCA 2NO0A 1GTL1 1DRJA 3KOWA 1U8FO 4MA5A 4HXIA 5IKMA 1XMQB 1PV1A 5B7PA 2DKNA 1YVUA 3EXHC 1V25A 1KYZA 2WXJA 4HATA 1ORTA 2X15A 4HX5A 4JGBA 2D0IA 3PR1A 4YLYA 1I2AA 4WD3A 1UZLA 2RGRA 4GKBA 4MV0A 1JAIA 3PHIA 5J59A 2X1MA 1GXSB 1KMNA 4W99A 1NXPA 1XWWA 2X1LA 3JZDA 4C7JA 2QMEA 3HCFA 6ABPA 4Z9FA 5EESA 4UXIA 3ZIAA 4DQUA 2J46A 3E9MA 4WXPA 4P84A 3KSLA 3CEPB 3AWDA 1R4MB 3FTNA 4GZ5A 3DOEA 3NQPA 1XKQA 3OZ7A 4G1BA 2ZCUA 3D8TA 4Z9AA 3VZBA 1QHYA 1XVIA 4N3BA 1BMFD 1H9AA 3RYTC 4BGDA 3FEYA 1CQXA 2CKMA 3N2NA 2XUIA 2OYCA 1CR6A 4PVDA 2QSJA 1BEZA 3IIJA 4A0QA 4QHSA 4EMTA 4L8YA 2F1RA 1YS6A 1G42A 3V4OA 3ZDYB 4EJSB 5F7XA 1TXGA 1TAGA 3PQ4A 4TWJA 2QUKA 3HCPA 4XVRA 2GNPA 1XNRB 4M53A 1MZVA 1ABBA 2IY8A 1K4MA 1KLXA 1JWGA 1PZFA 3EBLA 1RWMA 3MLAA 4EGSA 4OAQA 1SXGA 4TV9F 1A9YA 3CIOA 3OX3A 1JZTA 4RH1A 4S1OA 1VGQA 1JPNA 4JBWA 2DVMA 1U0JA 1XOIA 3MM4A 3H97A 2B35A 2A7XA 1H42A 2HUNA 1UG3A 2A9JA 1FQJA 3CLKA 4YXFA 4BX3A 3PXBA 4LF9B 4PX2A 4TKUB 3BREA 4UXJA 2O8DB 2X6HA 3BRSA 4OOEA 5TGZA 3T9FA 4O59O 3ZE1B 2KCLA 2DCUA 3GAFA 3T7AA 3VC3A 4FUQA 3QBEA 3U49A 1W85B 3AKCA 4CM9D 2HF8A 1ZUIA 1DFIA 2E4YA 2FQWA 4X1IA 4KE8A 2NADA 3DTNA 3RBVA 2CHVA 4TTRA 3A6GA 3Q1LA 1RRVA 5DLDA 4IDFA 1U0BB 1STOA 3MPOA 4PANA 1GPAA 2B4RO 1VIDA 2G80A 1OHHA 4OYHA 4YCCA 2CMGA 3RUDA 1DKUA 1L7AA 2Q5JA 3LC1O 1KJIA 4EVSA 1THGA 2DWCA 2ZB7A 1QE5A 5ESRA 4Z99A 2OO7A 3SOPA 1DNPA 1WSWA 4NPHA 1U0TA 2EZ9A 2HHCA 4OQ4A 3EXAA 4YT8A 1R0WA 3MJFA 3DFIA 1UAYA 2GTPA 2L42A 5H5JA 5F12A 1VPWA 4M3NA 4LEIA 3TIGA 2J49A 1CRQA 4KR6A 4HYEA 3COVA 2YHCA 3S7ZA 3KJHA 4CCYA 3KQQA 1GU7A 5BYKA 4QU5A 2RHBA 1YR3A 1VI2A 3Q8MA 3V97A 1K92A 3EGCA 3P2YA 4HRVA 3IQDB 3A11A 5ALSA 3U3MA 3R9KA 3N6XA 4KWEA 3V32A 1ZI9A 4LHEA 3EK2A 3RJMA 4E2YA 3VR3D 3UKRG 1K7SN 3M49A 5KTPA 1RRFA 1YR7A 3G7UA 4V0OA 1BS2A 1JH9A 3IX7A 1JIVA 2BHRA 2VJOA 4EKYA 2W2TA 2Q9BA 3ABIA 3GJQA 3GLHA 4OMDA 3SY8A 3L08A 3KJXA 2AOXA 1NYTA 4JY7A 4LC1A 4INPA 2WWIA 3LCAA 2DZNA 4LQLA 1R64A 2Z5FA 4Q12A 4F2GA 3AVYA 1QQAA 4AVYA 4AQ7A 5B1YA 1SBHA 1PT7A 4HFNA 3NNNA 4UVEA 4EBBA 1QK4A 2VT7A 2BSAA 1ZRNA 2GCGA 2J4FA 2VTKA 3I72A 3PNLA 3PXDA 5G1NA 5HQJA 5BV7A 4D26A 1AXRA 3GPDG 1FUEA 3DHNA 3FPAA 1VKOA 4HH4A 3VHLB 4D8WA 2G36A 2GF2A 3A4LA 3GO4A 3GOQA 4GBJA 4OQXA 2CG2A 1OIXA 1E2QA 3BPSA 3NPAA 2BFNA 2EKDA 4R0NA 3U61B 3CUYA 4E1AA 3D7LA 1FDTA 2G9UA 3FBGA 3LGSA 3PFFA 3WJ2A 4P31A 4PYIA 3KJNA 3TZCA 3SOZA 4DCCA 2R4UA 5CDYA 3MVEA 4A15A 4E6PA 3RO2A 1R74A 3EA4A 4MDHA 3CUSA 4YDWA 5DHQA 3K73O 2BHLA 2F8SA 3NOVA 4K03A 3TR5A 4BCCA 2WRZA 1HDXA 1E1MA 3FETA 1IULA 1G20E 1KEZA 3IR7A 3OOEA 3QBJA 1A77A 2MR6A 3C45A 3DOUA 4U0KA 4A03A 1Z22A 4BV9A 4LMPA 3VDMA 3R7AA 3LHDA 3D1LA 4PZEA 4BAUA 1R15A 4YMGA 1DEAA 2D54A 1SFRA 3FYHA 1DJPA 3ND6A 3DH0A 4Y7CA 1GITA 5HIJA 4DIOA 5G05J 3KQNA 2CXHA 3L18A 4ETIA 3PYLA 5IDXA 2FWJA 3VM6A 2WLTA 5LQJA 2LUOA 2LXNA 4Y2UA 3IBCA 1DCTA 2WK1A 4RNDB 3FMFA 2X8WA 1V37A 4UBLA 4B85A 1I3KA 5A06A 2HHHB 4U63A 4G1MB 4TTTS 5TIIA 5LD2B 3HL4A 1P3JA 4XQ9A 1RZUA 1TVKB 1DEXA 2C4VA 1MJNA 4UREA 5H7PA 1F5NA 1SZAA 1T9ZA 5D6NA 4Y1RA 4A8HA 5HW0A 5I7FA 4DA8A 3GLHB 1FBTA 1XTUA 5CXQA 5JI2E 5L95A 4CM9A 1DKLA 3IAFA 1CUCA 2ZIUB 1WCXA 4DR7B 2RHMA 4N0PA 1EP9A 1LF5A 4QBIA 1QFJA 5IBRA 1G64A 3AB3A 3ORFA 4Q93A 5GP1A 2XA2A 2EL9A 1J2EA 1LC3A 2PVCA 4PZYA 4P9NA 3JQDA 2GDZA 2OEPA 4G3XA 1N0HA 4M0KA 3NHWA 4Q3DA 3ZHSA 2EWMA 3H17A 3K30A 3C16C 1YUMA 3PWSA 1G17A 1C0LA 3R8FA 3WLFA 5CEFA 4GZDA 1JAHA 1HKUA 4OIMA 4RE5A 5FUBA 3VR5H 4LJRA 1NN5A 1SQ6A 1QSGA 3C87A 1VP3A 5L40A 1N9KA 1SY7A 2AEJA 4R8RA 3RBAA 7MDHA 2ZI6A 2DSTA 1V9SA 2FPSA 3MWFA 3NTQA 1R5BA 3TYXA 1E9FA 4TZTA 3U0BA 1SEVA 2C9BA 2YBDA 3H2ZA 4Q34A 5EFOA 2P9IG 3VO1A 1KWGA 4N76A 3KTAA 1HT3A 4D2IA 4QPZA 1YDWA 4BNWA 5IUJC 1UBJS 4G36A 3CHYA 5ENRD 1GNTA 3DA8A 4YRRA 4D44A 4EW6A 1PR4A 3V5NA 3RU9A 3K0BA 4L9WA 5A4FS 2R6DA 1PKXA 4MS6A 3SIPA 1SU6A 4TT3D 3CMCO 1DHRA 1FRQA 3V2OA 2RHLA 4G65A 4LXHA 3ZIAD 4BQIA 4DSAA 3LZDA 4MS3B 3LUKA 4NY1A 4UCXA 4G8DA 3AS4A 3SLRA 4BNMA 2GF9A 5DYWA 2XRMA 3K6JA 4LZOA 5FBHA 5ITWA 2N75A 5AUQA 3ONWA 4W5OA 3D7RA 5AI6A 3GFOA 1GQFA 1P74A 3IXLA 4AMGA 1M1XB 4BNIA 1RWBA 4ACBA 2QMZA 2GBGA 4FWTA 2M1ZA 3TEJA 4GTTA 4HRNA 1W0JA 5EJ9A 1UOPA 2XRZA 1CF9A 3UJBA 2HXGA 4RYDA 4NBTA 4DJTA 4Y2TA 2FMUA 5FBZA 4RE6A 2RI6A 4DBLE 1TQ8A 4MJXA 1U7UA 1Q57A 1WKCA 5E9JA 2X9LA 2OKCA 3AY3A 4PLPA 3VTZA 1K3ZD 1TNUA 1VMEA 2Y1KA 4HNAB 2GW1A 2OD7A 5DV9A 1FDVA 2V5FA 1JPUA 1Q22A 2QAIA 5D66A 2B0JA 1Z2EA 4PS8A 4JLJA 3TB4A 2J48A 2J8SD 1N2ZA 1VHWA 3EWSA 3L43A 3CVJA 3NGLA 4PUCA 2FE1A 4M1MA 4RK0A 2FWIA 4XM0A 4V0QA 3U4AA 1TLLA 3H5WA 3HEMA 3C4VA 4KQCA 4K6MA 3TCKA 4BNJA 1PDWA 2PBZA 4MAMA 4UFPA 2LUHA 1H2AS 3GLQA 1WEKA 5LX8A 1XKTA 2WF9A 3BL8A 4QWMA 3UJHA 1U6KA 2WE7A 4N0DA 1NUUA 3TIFA 3AR3A 1FT2A 2XUFA 4K9RA 1VJ5A 5HILA 1AV6A 1N7HA 1MHQA 3F3MA 1UAAA 2WXPA 1ABEA 2D2IA 4ZP1A 3U3JA 4JC0A 4KR9A 3Q9UA 1NXXA 3LK6A 3P0FA 3FTUA 3FLAA 6Q21A 2VEOA 4B9AA 2V8SE 1XN1A 1E3SA 1RMYA 3OQIB 5DP2A 1F0YA 1UK7A 1U4NA 2WVIA 1CQJB 2OL4A 2OUIA 4PC3A 3V8EA 4XJVA 3BSYA 2IHZA 3EWNA 3R24A 2RGYA 3JWHA 2BT4A 1Q7TA 3LY5A 2HPHA 1CTQA 2CFUA 1JR3A 1UOEA 3K1AB 4XJSA 2E4AA 1YKSA 4G5GA 4B48A 2DVWA 3GLKA 2I5PO 4L5BA 4GA2A 3VZPA 1F7UA 5LQDA 2I9PA 2FUKA 3G2TA 3JQRA 3KEAA 2W2QA 2WABA 5FI3A 1ID1A 1T2DA 3KT3A 5F1PA 4CKCA 3EFOB 1W0CA 1WSAA 2CF6A 2F90A 3BMQB 5IASA 5LMUB 3F5DA 2RONA 2Q4EA 3DAGA 4DA6A 1AK9A 5JZ9A 1E6UA 1UJ5A 2BFBA 2R4QA 3JQ8B 3Q72A 1K3TA 4AKHA 4B2IA 2WXFA 2P9LG 1VL2A 3H18A 4MVYA 4L3OA 2Q6OA 1ZD1A 2JEOA 5A23A 2OO5C 3A04A 4TZKA 4NMWA 3F73A 3CCBA 3WWYA 3MN1A 5J90A 1GUFA 4RU1A 4BIIA 2G04A 1ZM4A 1PZXA 1SURA 2IEZA 2FEXA 3R3HA 1N2CB 3TPZA 1XD2A 1XEWX 1PAQA 1RLMA 2JCBA 2YR0A 1LI7A 3IQFA 4H7KA 3RO3A 4P82A 2YXBA 4ID3A 1A7AA 4KXUA 3CKMA 1EDBA 2YMQA 6ADHA 2GB4A 3PFCA 1NI4B 1Z4IA 4DV1B 1D6MA 4XOUA 3UTMA 2VK2A 1E1NA 2FLVA 4RY0A 1P0QA 1A96A 1K7CA 3ROPA 5L3SB 3BORA 4HT3B 5DH9A 1QZ3A 4PHFA 3SR0A 5KNBH 4JYAB 4P7BA 5BSGA 2J8ZA 3DT8A 2VQEB 2DLCX 1TU3A 3HBJA 3GGJA 2C4HA 2P9SG 1ORIA 1TK2A 3GUHA 3KJIA 4J1TC 4MS4B 5EZQA 1LPNA 2FPGB 3ER6A 4GNRA 4RQUA 1WSBA 1QZ2A 2JFFA 5CYOA 4WKPA 1K97A 1LLDA 5A04A 3ZHRA 1EUYA 1K6IA 1FW6A 2YV3A 1UCFA 1FP4A 3P8ZA 1H2ZA 1SUPA 2A86A 3TS1A 3UK6A 2Q46A 1RJGA 2O3QA 4K81B 4S1NA 1W29A 5CGZA 1UWCA 4Q4CA 5AI5A 5JNVA 1Z28A 3G6KA 4RTPA 3UYKA 1WHTB 3UI2A 1ZIDA 3FHEA 1AGYA 1E2UA 1FYEA 1OXJA 2BGIA 3FAZA 4Z3KA 2ISSD 1G9SA 1XXLA 1P5HA 1EF1C 3H19A 5DNEA 1FT1A 5KTRA 3NHZA 1CDZA 3VAZA 2Y8EA 3F6PA 1Y3HA 5JH7F 3A1UA 4BZQA 2BHTA 2PHZA 2ZT6A 1P29A 4S0XA 3SSAA 4D9HA 1U31A 2CNKA 1NE7A 4FYVA 3U48A 3OZRA 1LF8A 2A84A 3F7TA 3WKBA 2VHQA 1V6CA 4YV1A 2QE6A 3DVLA 3W4JA 2UZ1B 2I3BA 2HF7A 4ZANA 3IKMB 3L93A 1DOHA 3FI0A 1UBSB 1D3AA 5GZ3A 3E3OA 2FK8A 2Y2UA 1X7XA 4HNTA 2PKRA 1ELWA 2AWIA 2F1OA 2VF7A 2ZW9A 5J4YA 1TVMA 2O7QA 3G2HA 5CDUA 3RM3A 4K9LA 1G55A 1Z3IX 5BN3A 4HJXA 1PQWA 3WFJA 3JQQA 5JY1A 1SA0A 2ZRFA 4F3TA 2DUNA 2ERXA 4EA8A 4FULA 4ZO7A 4BP9A 5FL7D 1UFQA 3N2IA 2FY8A 2REBA 4OHVA 1WXXA 1K06A 3A37A 2BF7A 1NTRA 3EAFA 4IIVA 4MLCA 3WV5A 5K8JB 4C0AC 4AF6A 1SU4A 3EF0A 4CMJA 1K0FA 1SCAA 3LD9A 4I81A 3S40A 4RDIA 3HVJA 2H63A 3GW8A 4AUEA 3D59A 2XCRB 3PUYA 1V5GA 4XCQA 2H8KA 3KQSA 1Z0DA 3Q8WA 4QOIA 3I2YX 4QRIA 1FP4B 1JDZA 1MGOA 3SIWA 5AJTA 3ZWOA 2PKXA 4QGFA 3OJWA 3VPSA 4Z5XA 1JJ7A 1YFKA 4KFUA 5JMPA 3ZN3A 1MC8A 2GQ0A 2KBEA 3GPLA 3DOIA 1SHZA 4FW8A 5AUPB 2ODQA 4UQYA 2VR1A 3IXMA 3K09A 4U2BA 3GZ2A 3OQMA 5SZIA 2OLEA 2OTCA 3K0FA 3HVRA 3GB9A 4AWBA 2KE5A 2J3IA 4JL0A 2V7GA 1BXRB 4L8WB 4ZAYA 2BFDA 2J41A 3GG9A 5IH3A 1BS9A 2RGBA 2WT9A 3FDXA 4FGZA 4RV9A 4RCVA 2PT9A 1BWRA 1GFWA 1DPGA 3R5TA 3G2WA 5JISA 1AQUA 1XA4A 3B36A 2V7BA 3G2OA 2IYQA 2WWHA 4ZV4A 4WBXC 4H08A 1YS2X 4YMIA 5EZSA 1DCQA 4QXPA 2XEVA 1HE3A 1X9IA 5TMEA 5E76A 3DYVA 3NBFA 2OORA 3G68A 3UUGA 3T1NA 2V65A 2JARA 2ZS7A 3QG1A 1BLXB 3A32A 3C3RA 3CX4A 1EJ2A 4PBRA 4NU5A 2EFHB 5T8KC 1NXQA 2X4LA 4HCJA 4TXNA 3K92A 4CTOA 4CL8A 4Z86A 3IBSA 2WUGA 2QMOA 4Z54A 3DGFC 3QVXA 4UHCA 3NWJA 3R7WA 5HIIA 5AKLA 5CECB 4BECA 4D9FA 4FGUA 3UB2A 1XLWA 2FW7A 4DV5B 3NBMA 1L4GA 3KB6A 4E3ZA 3O93A 1SG6A 4PZAA 1Z6GA 1VCIA 3FSRA 1I32A 3ZI4A 2WJ4A 4FE3A 5JWHA 2HCFA 1U9IA 4KO8A 2JANA 3RAPR 4RWZA 3UUEA 4YXWD 2AA3A 3ZWWA 4Z7NB 5DJ5A 3QXCA 4Z9BA 4XI9A 5A62A 2P6OA 1SGWA 2RK4A 2ENWA 1Y5NA 2R84A 5GJCA 3L05A 2AQIA 4Q9AA 6CHYA 1WB9A 4I7EA 4WESA 3SNHA 3ZWXA 3SD5A 3ZJ4A 2J09A 1UP4A 2I34A 2QAGB 3FCCA 4RVOA 4KXXA 2Y0BG 4M9SA 3EISA 2XSZD 1YCHA 4HNRA 4JBNA 5C9ZA 1Q0SA 2OV8A 1HSZA 2R6GA 3P9KA 1USIA 5IMSA 3DP7A 2BM9A 2PGXA 4HFGA 2BHSA 2QRUA 2UZ0A 1KEUA 2G0TA 2WWRA 3JQFC 3FUCA 3TOCA 1ZNYA 2GFHA 1FJ2A 3PEUB 1OILA 3OKFA 2E4UA 4HKTA 5KKAA 1HS6A 4BVAA 1L4UA 5EE0A 1WY6A 1V7QA 4AS1A 4EUEA 5LOVB 4LF7B 4LZZA 2F8LA 3BYZA 3FR8A 3B3GA 2OZLA 2PXHA 4MI6A 1DDIA 1RC0A 3ZW7A 4DV3B 1Z0FA 3ZH9B 5AW4A 4GMFA 3HGTA 4P4GA 5PGMA 5L45A 3GLUA 4L8LA 4NS1A 3EXIB 4RAOA 5EXTA 3KSRA 1RJ9B 4U7TB 1G8GA 1RAEA 4I4NA 2X7XA 5DW3A 1P1RA 1POXA 1XHFA 2H17A 4Z68A 4B1FA 4G2VA 1K4KA 3OLCX 3R23A 3Q3VA 2ZUTA 3JYHA 3S2FA 3SEFA 5DPMA 4EJSA 1PRYA 4GAEA 4ZOAA 1T1IA 2Z3WA 2AHOA 1UK9A 3VDXA 3NHUA 1VHTA 2YDXA 4IV8A 4PF1A 4JLNA 1E9VA 4G0NA 2OHHA 5EG5A 5T6MA 3ZD6A 4AW9A 4GWGA 4PYNA 2C2WA 1QRAA 1N11A 1VG0B 2ZSJA 4BFSA 3OQNA 1J1ZA 1L4YA 5I4BA 3EPPA 4OATA 5CU7A 1MO6A 1SUAA 2FEAA 1D04A 2ORED 3P9ZA 4FHFA 5ERGB 2L0TB 2M9MA 3UWKA 3UH0A 4A8JC 2R0QC 5BV8A 4CF4A 3NG1A 2HIGA 2PPLA 4ALIA 1QYWA 5JALA 3BMCA 1PGQA 4EJ2A 3LFTA 1QH0A 1A5ZA 1U4SA 1ZJ6A 4MWTA 3O26A 3WVNA 2PZAA 2DETA 1D7AA 1UZAA 2WW8A 4MK4A 4MX8A 4UBOA 4Q3OA 1KIAA 3H1BA 2KB0A 1TZCA 1S1CA 1K9SA 1U3CA 2PWAA 3B20A 1PAUA 3BWBA 3G7SA 4UBIA 1RXVA 1TA4A 2IIVA 4W4TA 3DMTC 1A72A 4FOSA 1F2VA 2AZXA 2XZDG 3H0CA 1W5SA 2RD0A 2WFAA 3SZOA 4BLPA 2GTHA 3TMKA 4GCNA 3Q41A 3HDGA 1QG0A 2HHLA 2OZLB 2XTJA 4KP7A 4DCNA 2Y1GA 3LQ2A 3SGHA 3T0FA 5AOVA 4KSCA 2NXWA 2Q1UA 1QJCA 3W2GA 2BDUA 1P7WA 4D8XA 4C7XA 4HDNA 1YJCA 3NZEA 4Y2VA 1I3OA 1LKZA 5CFZA 5KDOA 1XDDA 3AYZB 2FZ5A 4H3VA 3RIBA 3TLZA 2R62A 1J99A 1Y6JA 4UE2A 4CIXA 1LLFA 3ABQB 1KC1A 1XROA 5HBGA 1ZUD1 4F3CA 1XCPA 3HY4A 4RM3A 3QXSA 2D3TA 1PO7A 2IU6A 3NALA 4Q4JA 3STHA 3HPQA 1TQDA 3C39A 4LS3A 3OFVA 4NEGA 1F12A 3EX7C 1PZEA 3ZE0B 5JOQA 4RS3A 1UOHA 1WM1A 2V6JA 1CE8A 4MPRA 1KEEA 4MWOA 1ZJ4A 4WVLA 2LVBA 2ZBDA 3CG4A 3CVOA 3K8YA 3Q9SA 3L77A 2UVPA 4Q3LA 4KKVA 4Q48A 3MTEA 2VUHB 2HBQA 4REQB 4S1WA 1SKMA 4IAOA 1FFAA 3PYMA 2MMGA 1GIAA 2UZ1A 4HQDA 4FADA 1E62A 3PP8A 4PPNA 2Z9DA 4GGOA 4NTZA 3VDRA 2PUVA 2R7NA 1O1SA 3H2BA 3KKPA 3OAAD 3UJ7A 3HGMA 4EPXA 1TQ4A 1G16A 3TRDA 5JVDA 4EHBA 1RI2A 3PPVA 3SDSA 2FPIA 8AT1A 1DKNA 1SA0B 2X76A 4IIUA 4MUGA 4F8YA 4C3VA 2WTUA 2GSDA 5LMNB 5EIXA 4I5DA 2Y1WA 4XD7A 2PV0A 3LZ6A 4P34A 1VPEA 5DHTA 3AIOA 1LPSA 1LQ2A 1E7RA 1IKND 1ECCA 1SXJD 1Y3CE 1SJ9A 4FI3C 4HVAA 1PK8A 2MSCB 3I23A 2QM3A 2VAWA 4LSGA 5B5SA 3LIPA 1VLHA 5DYGA 1BW9A 1NGSA 3RC8A 2CD7A 3FPCA 2V3WA 3OECA 4QSHA 2HFKA 1U7XA 3UGQA 1TB4A 4H59A 3EWAA 3IB3A 3VMMA 2C2ZA 5BYAA 3R0IA 1XDBA 4PAGA 1SBIA 2V58A 4BVBA 1FVHA 1SMKA 4D0NA 4HUTA 2BKLA 1BHQ1 3EW7A 3Q6NA 4JLUA 5CVJA 4GLFA 1OY3D 1ZH6A 3ROEA 3EULA 3W6OA 3ICOA 2C88A 3CS3A 1ZCAA 4JNCA 4O4HF 5DGHA 3FHTA 2XODA 4AWXA 2WVGA 3LDHA 1MZPA 4PSVA 1UWVA 4C08A 3NTOA 5CXUA 1KNQA 1NQAO 4LTNA 3VOAA 3HU1A 1JT2A 1D2CA 1KEWA 1JCSA 3NOCD 1QFYA 1QLWA 1SOMA 2D1QA 1DJNA 4Y6CA 2HQ1A 3HFSA 2HJRA 1UMCA 4NZMA 3SFVA 5C4MA 1Q2ZA 4YHHB 2CSUA 1GGEA 1M1NB 1VJDA 2JFYA 3ZWAA 5GMOA 2I1JA 2J3HA 4DMCA 2YRXA 4QXOA 4TZ6A 5HTKA 1BRTA 5A7GA 2CYCA 1JL3A 2HWKA 4R7ZA 1SULA 3N7UA 4JB0A 3C1OA 2JLYA 1VE1A 2GPBA 3O8OA 1QCCA 1WMDA 2PLRA 1KSHA 1P0CA 2I3AA 2RAUA 1KFCB 1SCJA 2X6FA 3I64A 1RMTA 1M1ZA 3UIEA 1U0SY 1D03A 4O4LA 3VLDA 3PRHA 2F1IA 3QMPA 3E8SA 1JJVA 5T5QA 2ZWPA 4G26A 4EHDA 2GRPB 1NN1A 4DQVA 2PEYA 4D0SA 1XTTA 4GL4A 5TGTA 5J58A 5F9HA 2ZBQA 3R7WB 4CVNA 1KKUA 1DDOA 1X0VA 4ZOLA 5HJ5A 4A63B 1MB9A 2QVLA 4MVJA 5ALIA 2WMNB 4A9AA 2O2DA 4D4LA 1Y5MA 4OP2A 3MGBA 3OM9A 5CTJA 3LBAA 1BW9B 4GB9A 4I9HA 1Y9EA 3ORRA 2GPNA 2Z9CA 2PKCA 3W4IA 2AUMA 1UXHA 3DVAB 4CEHB 3PXAA 4F1PA 1JI3A 1K66A 2P2CA 3E37A 4TYPA 2FEZA 4UNSA 4X8QA 3F7OA 3Q7SA 4GBMA 4LV8B 2OCIA 4YEDA 3M6IA 3SEAA 2V9CA 3T7SA 4A8JA 2Q99A 1X1RA 2Q50A 1T24A 2KZTB 3HYCA 3KPJA 5ECGC 3TGPA 1XMPA 2D74A 3DO8A 3L40A 3Q4AB 3G0CA 1MO5A 1ODCA 1ZJ5A 3FDHA 1H3FA 1ZK1A 2QN6A 4QUJA 1EE2A 1KEVA 2QGZA 1JJAA 2GJ4A 2WAXA 4PLWA 1V16A 5EHIA 1WS6A 2QAJA 4G86A 4HGYA 4NBNA 3EXFA 4TWBA 4FK8A 5C5CA 1JX6A 1Z75A 5M04A 3SE7A 5JC1A 2DM6A 1BA2A 4BVLA 2G63A 1QB7A 3LU1A 2XIJA 4F4IA 1U0EA 4TQ9A 1S3FA 3U64A 1KZYC 2AMYA 1JSZA 2IIQA 3B7GA 4REOA 5K0FA 2CV0A 3AF3A 4L57A 4HDQB 4MVJI 1H0RA 4KZCA 2EILE 4TT8A 3E27A 1RWWA 5ENQD 2AOTA 3DDSA 3CZQA 4PDXA 2Z8YA 3M7IA 3QXJA 2TYSB 4PPQA 3SMQA 2CT8A 5ELXA 4M1WA 1I24A 3AJRA 2G8NA 5IARA 4IPTA 4YAKA 1JZSA 3LUAA 4TSFD 1HA3A 4Y2XA 5C18A 2Y0EA 1INLA 2G9RA 3EE6A 4ILGA 3GFRA 2WXIA 3WGHA 2J33A 3PQEA 4UEKA 7ABPA 3FHCB 1OT8A 3EIQA 2GK7A 4EQFA 2B5OA 4YVOA 3F6EX 5AKIA 2JD2A 4LX0A 3HXTA 3RWMB 2BCJQ 5KQLA 4KYTA 4JUCA 4GQBA 3EEOA 3PRZA 2W37A 5LC1A 3W6ZA 4WL0A 3D3JA 1XT6A 1BO6A 2RHGB 2Y1DA 5JSHA 1EVZA 1NBHA 2VRBA 2I9CA 3C0KA 1QTQA 1C0IA 1N5LA 1MJGA 2RBKA 5CT4A 3Q3CA 5BXQC 1V95A 5ESWA 1ZISA 2XNJA 2YV4A 1FIUA 2FCAA 5E95A 4C6RA 3UMYA 2QT9A 1YR9A 1ACJA 2XCCA 2EJVA 1AH2A 2C00A 4NNOA 5F4ZA 3ROGA 2HR1A 1VOTA 3PHCA 1D2HA 2MOWA 1E5LA 2QPOA 2DQKA 1JHAA 3N59A 4H0NA 1J22A 1W1WA 2Q5OA 5NULA 5EIBE 2FGJA 4WECA 1MIHA 3H75A 1PTJA 5HYVA 1I3CA 5H9VA 1KDPA 2I67A 3BD7A 4GO1A 1CRLA 4BE9A 4C4OA 3I45A 5AM0A 4CKCB 3OM0A 5LUAA 1KDOA 3QARA 2NTVA 4C6HA 5JYBA 4HDRB 4UMDA 4W5TA 5EE9A 1R4MA 2ZTSA 3ANTA 3TK1A 1IAVA 2QN7A 2O59A 1WVMA 3SHWA 3IT3A 3EIJA 1UXGA 4UQPA 1QV6A 4HDNB 4XX1A 4C1NA 1J2RA 1W35A 3GPCA 4FONA 2XTNA 4K9NA 4OJYA 5G4LA 4EGFA 4JUBA 4JJGA 3OPVA 3RG8A 3UB4A 2I91A 1ZR2A 2JGLA 3KWFA 2QIOA 3OMWA 4C07A 5K8UA 2VQFB 4MUAA 5FPQA 2CXUA 2V59A 1QK5A 2PGOA 4UW9A 4RHYA 2ENUA 1ZC3A 2BMWA 3ZPJA 1KVUA 3NOOA 1ZL0A 5EINA 2RFLA 3ESLA 1IHDA 3ED1A 3P19A 1D9ZA 5CFMA 1B14A 1PEDA 5BVHA 1P6QA 2AI1A 2Q2OA 2FG5A 3EQZA 3LC7O 5T3UA 1RZ4A 1DCMA 4BP3A 1BU8A 4F3RA 1THTA 4X6LA 5ECYA 3O48A 3GQBB 4BKMA 1NURA 1OXBB 2EYQA 5AW7A 4RX1A 6PFKA 3NKLA 4GHWA 3BFXA 3UW1A 3C1AA 3WSWA 3EMDA 5J2TF 3ZCPA 4UDXX 4IDCA 2V4MA 2P3SA 2YUIA 2NZXA 1X9HA 1E3JA 1DAFA 1ONSA 3AUFA 4GVPA 4AXXA 2O3SA 5C7OO 1B1AA 1ZNQO 3KSBC 4HTFB 3V7WA 1KQOA 5TMPA 3UHOA 1O9BA 3RJ9A 5FPKA 5ALUA 3VX4A 1KKLA 2PUCA 2O5EA 5EYPB 3MG9A 3GA7A 4Y6WA 4L95C 5K3DA 4F53A 1S5PA 4WKBA 3GLIA 2OBLA 3F4BA 4ZV9A 3GJTA 2BTQA 1YCFA 5ES3A 2AR9A 3ABKE 1Z5ZA 3TXMA 3QKYA 2QRMA 1JXAA 4BWFB 1NY5A 1DQPA 3RC2A 5FBVB 5F1YA 3SXJA 3PZDA 5ITZB 3EPHA 3IILA 2FR1A 2OECA 1HDOA 1ESEA 3WQQA 1ELKA 3PQDA 2EFYA 2NPIA 3EMVA 1M34E 3R3ZA 1JYFA 3VPAA 4B7ZA 1U0NA 2QM8A 1ZN9A 4EEXA 3S1SA 4LZJA 5DM0A 1JALA 1FPQA 1NP3A 2ID8A 2NU6B 3PQ2A 4WCVA 1J8MF 3O9MA 4G5HA 1SVOA 3NHSA 1E4VA 5IHXA 3A28A 1OYYA 3E32A 3JATB 4PPYA 4YMHA 2R87A 2NPOA 2AMVA 1WDKA 3ZTWA 2IW3A 1N77A 3FU5A 2H3EA 5J5VA 1D2NA 1MW9X 4XQ0A 3L0PA 4MR9A 1YJBA 3W3ZB 5E6RA 3UGTA 1BMQA 2B94A 2BFWA 2TMGA 3B3AA 3MWGA 3PRKE 4F5ZA 4Y1GA 5JR3A 1TZ2A 4FDVA 1KRHA 1FF9A 3NETA 3MTBA 5K4GA 3N6VA 2PCJA 1OH8A 4P83A 4GPD1 1RQPA 3AUAA 3Q5EA 1VDYA 4QNRA 3TOSA 4BMSA 3PITA 1RWNA 4Q66C 3PE3A 2Q0XA 2XRYA 2OKGA 1HZJA 5D3KA 1MJFA 4FE4A 3TQCA 3QPDA 2J6IA 2M63A 1MRSA 3OEED 4NV0A 4A36A 3Q7EA 2OFWA 2X3MA 2WJWA 5DCWA 1Z88A 3CKLA 2ESRA 3D9PA 2ZBUA 1NDHA 1UP7A 4HZUB 1NKSA 1JZQA 2DYRE 1MAAA 2R6FA 1ISFA 4RPCA 4AP6A 2PL3A 4CF3A 2OQRA 4QXAA 5CA0F 5IU6A 3I2GA 4G41A 1N75A 4IL5A 3UIOC 4KQIA 2N0SA 3OBIA 3ASUA 3MA0A 4L23A 4I66A 4UWGA 4EFKA 1V26A 3RSSA 3CB2A 4G1EB 3SF8A 2XPZA 2ZAOA 4UEWA 1JW9B 4KVFA 1WQ4A 4BN5A 3NEJA 2N46A 4S35A 3QWPA 1DWOA 1GA6A 1OW3B 1WF6A 2D13A 2ZIAA 4IHQA 1GM5A 4K5BA 3DVAA 2ZJ7A 1TD1A 2FWRA 2ZB2A 3RUHA 4CEHA 1NXTA 1YBMA 1M5TA 1I2MA 2C0CA 3EZ2A 3CHOA 2F00A 3M3DA 3A8TA 3OT5A 1HU3A 4KPGA 2XUZA 2NYJA 3V8MA 4A8JB 1AZWA 3HM9A 4YXWA 1ZJWA 4U2KA 4V3IA 3HA7A 1FDUA 1E9SA 1D0VA 2PL1A 3AKEA 3IBYA 1EFCA 3NANA 4PZCA 4XA8A 1ZW1A 1C81A 1HO3A 3QJGA 5JCJA 4KQXA 1XFAA 5D6OA 4EAQA 1TRKA 2WV7A 4XIJA 3EGDA 2H2WA 2GZMA 1V16B 1NBAA 2PBLA 2IS1A 1FYDA 4RZIA 1C9MA 2RC6A 2Z6VA 3T5TA 3EXFB 5AKEA 3OH8A 1ESZA 3HO8A 5GV8A 3K35A 2CKDA 3L02A 2YX1A 1NJ5A 3Q1KA 1D5CA 1PWHA 2K2QB 1SBQA 3GDHA 3FPBA 4KI0A 2QG6A 3DD1A 2QA5A 4WAUA 5LLSA 4AMYA 3AB7A 2I4MA 2B8EA 3DLIA 5LA6F 5KTMA 1ETHA 2GRUA 4QLOA 4MRMB 1YRBA 1H2UA 3R20A 5FTWA 2G71A 4KU4A 1WB4A 2G76A 2RB5A 4HI9A 4WH0A 3MB8A 4P2GA 3HVUA 1ZOOA 3KLBA 3EIHA 3CF2A 1TYQG 1PX0A 3KFVA 3OZWA 4UVIA 3FLMA 3TL3A 3EFHA 3WP0A 3QWBA 4U7EB 4H3HB 4BLVA 4ZK2A 3KB1A 1IK4A 4CN8A 4R9UC 3QHQA 3HR4A 4BQOA 2G0NA 1NM5A 4GMXA 4MEAA 2BBOA 4QHYA 3ORQA 1SHKA 3NDIA 4HY3A 2FXVA 2JL1A 2QT1A 2ZWIA 1HDGO 1Q1NA 4JP5A 3PGVA 4LHXA 3D4IA 4ZT6A 2VH5R 4ITRC 3OSZA 4DSZA 2VEDA 1LF0A 2VPIA 1WTCA 1W4RA 4HH3C 4R01A 1K75A 3PZ3A 5C1IA 4YS6A 5E4YA 3ZWMA 2VHYA 3ADKA 3SF8B 5KSZA 3MINB 2YFYA 3NTXA 1D7OA 1RHRA 2XMGA 1EDDA 1WXIA 3AY7A 2AVNA 4BNLA 2HPVA 4BS9A 1PFQA 2H7VA 2VPXA 3UPUA 1R5OA 4F84A 5FYDA 2D3WA 2AZMA 2P9YA 2RGCA 2QTAA 3FKJA 4BVJA 2Y1LA 4L8GA 1MJGM 4EW3A 3IV6A 5IN5A 5BYJA 1N2CE 4IIBA 1L5WA 2Q5CA 4INZA 5AK5A 2IDJA 4FJ2A 4G1TA 3SXUB 1H4TA 4US0R 3EDTB 3DQQA 1I3MA 2OC4A 2Q6KA 4LE2A 3PC8A 4QJBA 5AO9A 2C5GA 3FYUB 3QENA 5AHKA 4CLRB 2WT8A 1VJCA 1Z6ZA 4U8GA 1OAAA 4RMIA 2VYVA 4B71A 3MPUA 3AO0B 4B6GA 1US8A 3T5CA 4EWLA 5EIBC 3THWA 3A26A 2NZ8A 2YNQA 4NCKA 3D0OA 1OX5A 4ZHBA 1ISSA 4KQ2A 1NR7A 2FR8A 4K2AA 5CT8A 5EKTA 2DBRA 4IH4A 1NVGA 2ZU6B 1S7CA 4PQRA 2IL1A 2HLDD 3DQPA 3ZE2B 2AH5A 5C8YB 2BEVA 4KYOB 4R5HA 1WL8A 4HNAA 2VYNA 4LK3A 1T0IA 3PV0A 4MRMA 4DARA 4F2HA 2IQ5A 1PV4A 3L41A 1IHPA 1TIBA 1URPA 3HLTA 1XXHB 1UN8A 4KE6A 1IY8A 5A6VA 4IIJF 2R9VA 3MSCA 3R41A 2DHDA 2XXAB 2E2WA 1JKFA 2HMVA 4HB2A 4S2UA 5A3VA 3UW3A 1E7MA 2ZT7A 5K8CA 4R1OA 4RLSA 4QT4A 3LQQA 1O0BA 1OFTA 2R47A 3H1EA 4V0NA 2JI6A 3L8HA 1YU6A 4BSZB 1BFKA 1WPQA 5EQFA 4ZVRA 4OHZA 5HIAA 3QKRA 4YJ2A 1TNOA 1QG2A 4UQLA 2IHKA 3IMFA 1VP9A 4IVQA 5AVKA 1TZBA 2WIJA 2MWMA 3BHMA 1Y1KE 1IQ0A 2YYZA 4HLCA 4MUYA 3HWWA 3QEJA 2HX1A 4U2CA 1YQGA 2XH8A 2Z8XA 4DMLA 1Y7TA 2G5TA 4IKOA 3KQHA 1Z8NA 4JUIA 4YUAA 1CQJA 5B1HA 3Q88A 4BU0A 2C31A 3MWDB 4LDAA 4HLQB 1FTGA 2DU8A 1U9YA 3ZGYA 3ASYA 3BICA 1CFZA 1J24A 1VBMA 4X91A 1FYFA 5ILOA 1IOZA 1WCV1 4CKWB 2P7HA 3ULQA 4YRJA 3TLBA 4CGVA 3ZEFA 3FYUA 2ET6A 3ZYMA 4G0XA 5DO9A 4F93B 1DAEA 3CF4G 1PF7E 3HCWA 3ZBPA 2Z6UA 5EVCA 3PFHA 3WIUA 1RR6A 1YIOA 3AEZA 5EY5B 4G9BA 4EAAA 1CE8B 4BWRA 4QYTA 4MJ7A 3OE7D 4EQZA 1TZJA 4K86A 3T0GA 2V5UA 3FHJA 2G09A 5LKRA 1KETA 5LA6A 4RVHA 3IUSA 5DTMA 1NC1A 4I1OA 4JWTA 4GUDA 4P81A 2I87A 5E9WA 1VRWA 3QV1A 3VPDA 4EMUA 3KZKA 1G8AA 1ANKA 1NXVA 1VL6A 2ATEA 2G83A 4EYGA 1QYIA 3OTIA 4WNGA 4E6HA 2W2XA 4W7SA 1WQ1R 1XNFA 5ITZA 2DFNA 1PIWA 4NURA 1FQOA 2QLTA 1QKJA 1HZ4A 5EP1A 1ZVVA 1Z6YA 3M9XA 3HN7A 3D54D 3JRXA 1TAQA 1W5FA 3ZNQA 1JPJA 1PVOA 4CM3A 3FUKA 2UYGA 4IFBA 1T13A 1YD7A 4RENA 2GKGA 4WDRA 3D3EA 4YBRA 5DM1A 1G8KA 3HDTA 5EUCA 1P7PA 3W8RA 2VSOE 2BKXA 5BQFA 1CQIA 4M7CA 4RHEA 3RH0A 2WWWA 1BE1A 1L1RA 1RZRD 3F98A 4HAXA 4BAZA 1Z7EA 3C7CB 3UHFA 2WJZB 3W9FA 3BBLA 4PCLA 2NQ2C 1ESDA 3WIEA 1CUVA 1W59A 2BKEA 3V4VB 4DBZA 5AI0A 5EWJB 1PNRA 2FPGA 1ZIPA 1H4SA 3ZZNA 3LVQE 5DBIA 4NVRA 4C6SA 4EFNA 5BV2P 1HDRA 3UAYA 3ZDQA 1WJGA 2EF0A 1GTMA 3D7NA 2XOXA 1P2TA 2BAGA 2I6XA 4FBGA 2C3OA 1GL7A 2P2ZA 2QZAA 3A1EA 3FN4A 3R5FA 1LQTA 4RD6A 4CQMA 1WU7A 2B2NA 4UXHA 3ZNPA 5J4KA 3IUNA 4Y8VA 3IT1A 2I66A 3N2GA 4UD6A 2IZ5A 1AWCB 2OCGA 3KXDA 5KYGA 5JCOA 4B3TB 3ENVA 2KHZA 3DG9A 3QGMA 5EHGA 3DTVD 3RJZA 4XWKA 3TECE 2Y0BA 2JHCA 4ALLA 2HIMA 3CW2A 1VSUA 4O63O 2IPAB 3ZQKA 3A9WA 3IPAA 2AUNA 2HADA 2VYIA 3BQ9A 3DLPX 1L5OA 1DBQA 4ITVA 4RSRA 4ISBA 4M98A 1TUBB 2WEKA 4I1OB 5CERB 1P2VA 2C5SA 1ZCZA 5HKOA 4EY3A 1LK7A 4FW9A 4JEIA 3I9V6 4PNEA 3ZK9A 2WFLB 3PJFA 1T5BA 2GERA 1ZFNA 2QEQA 4QWWA 1YTUA 3FCEA 2LCQA 3IUEA 3PX3A 1OD6A 2WNIA 1Z34A 4R05A 5IJWA 2C1ZA 2C42A 2Z3ZA 2FVXA 4F9TA 4BP8A 4YP1A 1F4VA 3KKMA 3CHSA 3VI3B 2BDEA 2PZBA 2FOXA 3ADOA 2JNWA 3GFQA 2WYUA 4IRMA 2V7WA 3E3AA 3VYRB 3A9VA 4H2DA 1Y1QA 3GP8A 1PWEA 4JROA 3NUQA 2D5IA 3I5MA 2PZMA 1ATZA 4PYMA 1GNVA 4NBRA 4D82A 3I6IA 1N2BA 1ULTA 3QE2A 4QL3A 4XDHA 1N2HA 3RJTA 1T10A 2CZGA 3S7DA 3K5IA 1HDIA 3BWYA 2OM2A 2P69A 2QI9C 1GDDA 3OJEA 5CFQA 3ZDCA 3DT6A 2VPQA 4R3WA 1XMXA 2FZ4A 3DUWA 4ECAA 5JQGA 1S2LA 4BZZA 2V03A 2V5QC 1PUJA 2CNLA 5CBPA 1HEUA 3RVMA 3WP1B 4DA0A 4ZHQF 1QV7A 2JEKA 1G1MA 1ONOA 2CVZA 1N5MA 1S9HA 4YJFB 5FYQA 4ES6A 4H1UA 3AI3A 2RGWA 1YKFA 2B20A 2JJYA 3N2GB 1NYQA 4NC9A 5TF0A 4Y6OA 4DE5A 4FMBB 1GQSA 1ADGA 4DKJA 4ONEA 2WUFA 1K1EA 3UAZA 3EYWA 2XB8A 4MWDA 3HXLA 1GKLA 2RARA 2R6R1 2VF5X 2NSHA 2OCLA 4BO9A 4UM9B 5I47A 3QSGA 4Q3EA 1HUQA 3VC2A 1VJRA 4O8ZA 2GWHA 1AS0A 1TU4A 3CJRA 3CLRD 3D5QA 4V24A 4Q3BA 4AY3A 1KI9A 5ICFA 2ONZA 3H6KA 3NHRA 4TQUS 1ZEMA 1B6RA 2XUAA 1VHLA 1Q20A 1YQXA 2ZIWB 2ZJ5A 2H16A 2PLFA 1AC5A 1YVPA 2ZJ1A 2HIAA 4E11A 2XVMA 3I4FA 2XWJI 4Y67A 5JASA 2HLDA 1RLTA 1PT5A 1LA2A 4E4RA 2ZRCA 3BZUA 3MGGA 2OBFA 3OIDA 3R8XA 4D9EA 1FLVA 3L7LA 1WUYA 1H4QA 4CDRA 4DZTA 3FFWA 5TVGA 4A6DA 4EFMA 5HBRA 1CUBA 2D2XA 1EAYA 4JXKA 1DI0A 1USUA 1N7JA 3ND8A 2A2ZA 1JR4A 3IR5A 5DCYA 2Q7OE 3SNKA 5K2OA 4A27A 1KQGA 3F3YA 3QVJA 4P53A 3A9UA 3HB1A 3UJAA 2VRWA 4QJ5A 4UFOA 4O5AA 3B9PA 3L8FA 4F5DA 5G41A 1KMHA 3U4TA 4TYYA 2EW2A 1P0MA 1PQ4A 4PLHA 4CNBA 2A9QA 3QJ5A 3GHYA 1KK1A 4C20A 1G41A 1WKVA 3HB0A 3VTXA 2BEVB 4OQEA 2AFIA 3WHIA 4WESB 3V1KA 1CX9B 3CE9A 5KNGA 1WY7A 2VRCA 4YC7A 2IVZA 3TL6A 1ENPA 5JJ7A 4IHJF 1VLJA 1W581 1SCNE 4BO0A 1PSWA 3H2SA 4X3PA 3MCUA 1H8HA 1B26A 3AOEA 2I6HA 2BEWB 4UHJA 3EVDA 1HNNA 3ZI7A 5EEHA 3ADDA 1JAYA 1OKKA 3IUMA 2CC2A 4MO9A 4YNDA 1RLJA 3RVPA 1O97C 3V4SA 3B89A 3FTDA 3DLCA 3B7TA 1YB1A 4GM1A 1WDTA 2GRJA 3NRCA 2P3LA 2X6KA 2BR3A 3DNMA 4NK4A 1JV2B 2EW1A 3MMZA 1U8CB 3ESYA 4PY2A 4D9IA 5B4UA 1M67A 4F46A 2VOJA 2C54A 3RUFA 1N32B 4X3CA 1JXMA 1OT5A 2EAUA 2UKDA 5BY2A 3SWWA 2K7FA 3N8GA 4H7IA 3INTA 4GE0A 4B3DA 1L4LA 1ZJYA 4CM6A 2Q6VA 2ZRIA 1NXSA 5HZHA 1CZUA 1O58A 3MT8A 3BXEA 3E5RA 2P4UA 4K5QA 3PC8C 3EG9A 1TPYA 2G1AA 3ESDA 1V39A 5AESA 1G8JA 2DLDA 2I2DA 4AY5A 2NQTA 3STTA 4PX5A 2ZJ0A 5JCJD 4RY2A 3AVQA 2AE1A 4V3CA 4H18A 4JJZA 5EEGA 3DL0A 1AKQA 1X1CA 1YDGA 2NACA 4I14A 4IJ6A 5G55A 3UTDA 4B7UA 3OQ1A 3VU8A 5K6AA 3PX2A 4LECA 1WXGA 3CBGA 1HK7A 2J3QA 2Z2KA 4RQAA 5TQ2B 4JQCA 3X1DA 1LV7A 4GXRA 1R4ZA 2CL5A 2Q29A 4EDFA 2J3DA 3T9CA 2FW8A 2IUYA 5LLTA 3HXOA 3EWIA 3BK2A 4EZJA 3PXXA 4LFAB 1Z13A 2BF4A 5IVIA 4JA7A 4DVJA 3U3WA 2O3UA 3T5PA 2UY1A 1AO3A 3NYIA 1T43A 3O75A 3UK1A 2L82A 3ZHZA 1R6XA 2DULA 2HBYA 1A7JA 1T8WA 2V4UA 4IIXA 1OZHA 4LKOA 3C3PA 4WCDA 5F35A 3R6DA 1W75A 4CMAA 1SXIA 3N7TA 1QHNA 4NULA 3LXMA 1Z7GA 4TXRA 4WA8A 4Y0NA 4R54A 2FYTA 1SG0A 3HJNA 1HORA 2Q2WA 5EYLA 3AF4A 3IEPA 4WA7A 3DKPA 4JOCA 1Y8RA 4M36A 3VKWA 2YXNA 4K6FA 1KI7A 4HN2A 5AHOA 2X4GA 2BTQB 2F37A 3ZLUA 4BX9A 3BVPA 3S2SA 1H0AA 3CV3A 3DBLA 3TOZA 2ZQ5A 1GPJA 1L7RA 2QLLA 3IV0A 1K8KG 4GZ3A 4HYTA 4BX2A 5A05A 4HVTA 4WBSA 1YE5A 4EYOA 5I7RA 3IHKA 3K96A 3O8NA 3DTYA 1SKYB 4XYBA 5DNCA 1OYVA 1R6TA 2VZEA 3SC2B 3Q15A 5LZ5A 3O8CA 4ZRNA 1Z25A 2OY0A 1FFHA 1WXQA 3H5OA 5U1PA 3BHJA 3TWTA 4JYMA 3Q2OA 1ZGZA 1D1TA 2HMWA 2WZDA 3HEBA 1PQUA 1O1TA 1U1DA 4GG1A 4CQMB 3K6SA 3FSGD 2O8EA 1FMTA 1P77A 4FINA 4GMHA 4Q4JB 1Q19A 4LC0A 4CL3A 4K8RB 3SQMA 5LQAA 1VHJA 4XX0B 2QUBA 3KAEA 3V79K 1M2HA 1PZMA 1SOVA 1NW6A 2MJLA 1KEEB 1OZ0A 1L5KA 2EIJE 1MYOA 1MB4A 3CNLA 3QFFA 1PK9A 5E6RB 1H5NA 1ZD2P 4OXKA 2H6IA 1J49A 2WAAA 3U9TA 5IF3A 3T5XA 1HTTA 2CJFA 2UVPB 1WABA 2EJBA 4K6OA 4ODIA 4ALMA 1I6KA 2BEUB 1L5NA 1NNEA 1Q7EA 4ALNA 1YQDA 1VG8A 2GJ9A 4KDEA 1P2GA 4J8DA 3Q6MA 1GYPA 2IVFA 2IBMA 3OZVA 4DPLA 2ACEA 3G59A 2NSYA 4TV8B 5JJ6A 1U3UA 2FZKA 3KKZA 3MT7A 5BYBA 3WGGA 5SYMA 1GQ2A 4I3GA 4GBGA 5JY6A 1OVMA 1A7KA 2XGJA 4XQEA 3GAZA 5B3AA 4D43A 3QEBZ 3U3DA 1IPFA 1EM8B 5AVTA 3C8HA 2YZMA 3GNSA 4JAVC 4NYJQ 2P4SA 2X2PA 3ZCUA 3LCUA 1JFTA 2VHEA 5HF9A 3V4LA 3TB6A 1HL7A 1Y6QA 1ISJA 1DTWB 2GCNA 2ZRKA 1TQ6A 4OUDA 3VPBA 2DTDA 3EPJA 1JTEA 2XCUA 3BG0B 2HK9A 1SCDA 3L9WA 1NXOA 4B73A 1VKHA 3KALA 2GBPA 4B7AA 5CRIA 3TD6A 5BSEA 1DAGA 4PPGA 4OA8A 3WA7A 2J7PD 4ZQFA 1MXFA 2F6RA 3WQSB 1GQQA 1ESCA 1T6NA 3INGA 4MB0A 2L19A 6GPBA 1SBCA 3AM4A 4ZI3A 3O74A 5BW5A 5F98A 3SBOA 4LGCA 3VOBA 1U04A 4Z9YA 5A0TA 3F8TA 1M75A 3CZMA 4MBGA 3DSSA 3VDQA 1Y6ZA 3K0CC 1QDEA 3TEMA 3OIYA 2QLFA 1F4PA 1W47A 3UUWA 3TBFA 2RIPA 3L07A 2WQHA 3HP7A 1M2VA 3T9EA 4HLEA 4C4ZA 4PFKA 3IDOA 3JRWA 1GXSA 3SZGA 3A6PC 1U28C 3DDCA 1WBBA 5F33A 1YA8A 5LR6A 2Q0SA 2H07A 1VGRA 4R41A 4LRSB 1ZHFA 1LX7A 3S7FA 2GKSA 4N5LA 2V54A 1SC9A 2ZSIA 4HDAA 5TPWB 2VTVA 4AJ4A 2IO3C 4KVAA 5BQOA 1T1EA 1FUKA 3HJBA 4IDEA 4P3YA 5G3YA 4CI9A 4EJ6A 1N6HA 3LBHA 3WK5A 1KH3A 5BN1A 4UU8A 4ARAA 3RBXA 3AERB 1QV9A 2X8JB 1L3IA 1M5UA 2EKLA 4F7WA 3B78A 1QIIA 4Y2GA 2A0YA 2V6IA 5HJ2A 3QPAA 3AEQA 2H1FA 4TLBA 1M2FA 5FPPA 3UJ6A 4FDTA 3EIOA 3PXCX 5IJXA 2JI7A 3RK0A 3VZSA 2I78A 3HQ4O 2EZ4A 1L4NA 4O3MA 5E7QA 2X23A 3I6MA 4CGYA 2IOQA 2W6JA 1DTWA 3M5DA 1D4FA 3DGEC 5LXTF 3U7QA 4IDQA 2IX3A 4U96D 2QRVA 4RPGA 2GXAA 4DQ0A 1M6YA 3F78A 2WYIA 3LW7A 1WX1A 4QSMA 3IPXA 3EDQA 4J8PA 3PUHA 3DMRA 4EKEA 1F8UA 3DZJA 4GPBA 3DAHA 4OSEA 1HWYA 4D92A 5KQRA 2GZAA 2FA9A 1A9OA 5M72A 4KGDA 4ZDWA 4HEHA 1WG0A 3SQWA 2C1XA 3K16A 2I7CA 5PNTA 1HRDA 1KO1A 1N8TA 5DXFA 4ZOQI 2GJSA 3ESQA 4F91B 2ZVQX 2AN9A 3EQ9A 4CJXA 1DL5A 2AFVA 4FX5A 2M1XA 2KZTA 3AX6A 1M54A 1N0VC 5FHQA 3R7NA 3UMRA 3RSQA 3HS3A 4HQNA 1B8PA 4ZCSA 1JLLB 4CR7A 1C7IA 2XWBF 2QX8A 3ABRB 3N8IA 1FYVA 2GCEA 3VPCA 3IHLA 1ML3A 4O2AF 3ZV3A 3MBOA 2J9GA 3R2JA 4KLAA 1V6AA 4TKZA 3VAAA 3ZD9A 5IVPA 5EJ7A 4WY8A 1MF7A 2XDQA 1GG8A 4I1MA 2I3GA 2O8CB 1I2DA 2XS1A 3R1IA 1D0IA 2WKWA 1J20A 5DU2A 3VTKA 1GUDA 3D2CA 4YTEA 3ZBUA 3BG5A 5EHNA 4D3DA 5CBKA 3MCXA 2J30A 4DEYA 1O4VA 1YT5A 4XLLA 5EA2A 3BXGA 5LQSA 1AQ6A 5KTOA 4N49A 5ALGA 1MGPA 4M37A 1F1JA 3USCS 3OHSX 4JB8P 1ACLA 4B2YA 4DMMA 5CFLA 1JHXA 2BCEA 2QQGA 3AETB 3DM9B 3RSZA 2E5FA 3F3KA 3S5UA 1Y6GA 3AUJB 4OCZA 3V2HA 3ZIUA 2AS0A 4ROTA 2XXAA 3DMTA 4Q69A 4WASA 1XZBA 3F90A 3H4VA 5FEMA 2GZRA 2WNHA 3BXPA 4Q4LA 3ZU4A 4UNRA 5DN6A 1S8NA 1QO0A 2QYUA 1RTKA 3MNFA 3GR6A 2QC9A 4PRLA 1XZLA 3VGJA 3W8DA 3AKDA 2G9ZA 4CRWA 1D1PA 1FRZA 2YWRA 5DEOA 2WWVD 3NC4A 3PR3A 3D9HA 1W76A 4RNCA 1ZCFA 2FZCA 2WP0A 3AILA 2HUPA 2JI9A 2PY6A 3KXLA 3UA3A 2XYPA 2XKJE 4O8CA 1WDYA 2D7DA 1Z7WA 3ILYA 5JCOC 2TMYA 2RH5A 4KO3S 4MJLA 3GLRA 3TR0A 3G2UA 3DCYA 4U02A 2V98A 5CA1B 3PSHA 1W9MA 4LE1A 3A7DA 3T7RA 4A10A 2C7VA 5DXJA 1YQWA 3H11A 4L8VA 5DHPA 1AN0A 1IM8A 1CNMA 1NAIA 4E13A 2RI1A 2QJFA 2C9MA 5CEDB 2LDBA 2PT7A 3QVMA 4EGAA 6AT1A 1KDVA 2W90A 2ON6A 4H7EA 4HGZA 4D7AA 5I7UA 4J0HA 4LYAA 2WXHA 2GBLC 3AUXA 1A5EA 3JYPA 1N3BA 3FB1A 2GILA 4O0MA 4P32A 2HK7A 4OJTA 3G2JA 1PP4A 3A4MA 3AM1A 3B85A 3CX7A 3LHKA 3OC6A 4BFRA 4YX9A 5AKHA 3KP1A 1G5TA 3P2KA 4FFRA 4KGXA 1H2YA 3M83A 3STYA 1ISRA 5BORA 2DCPA 2FZWA 1K6MA 2JBAB 3JV7A 2ADFA 4RYLA 3T1TA 5JQGF 3BSSA 3EIFA 5I4IA 3IDQA 1XLTC 1KO8A 1JI0A 1G3IA 3REOA 3ZY3A 3CU5A 3E5NA 4GPEA 1Y8ZA 5AWFC 4JLMA 3OZDA 5FQ7A 1MT0A 5H81A 4KLRA 1FZTA 3PDCA 4TLEA 3U0VA 4DEXA 1JNXX 3VO8A 1NMZA 4JJAA 4DB2A 4RW0A 3BEOA 5ENSD 1X77A 2FWPA 3IS3A 2QLJA 3P9SA 3SYMA 3UO8B 2PO5A 3MT0A 5E38A 3ITNA 3UG6A 2R1VB 4TS9A 4XVQA 3NV9A 5L4NA 3GI1A 3VNBA 4LDPA 3CLSC 1TVCA 3HB7A 4H6WA 1T6YA 2BGKA 1SB8A 4J29A 1N4AA 3UCEA 4C2TA 3PVZA 5KUTA 4PCAA 4V0MA 5ARDA 4CRWB 1B8NA 2RK3A 1DBPA 2GLTA 5EN5D 2BMVA 2ZBRA 1G3UA 5CURA 3V8RA 2Z56A 2YVUA 2UUBB 1X8JA 5ALYA 4AN1A 2XOEA 4F85A 1I5RA 4B4DA 1PVDA 1QIGA 3AZOA 4FC7A 5EWJA 2UUAB 4TN1A 4E4TA 2O8FA 1R1DA 1HYEA 2YASA 2P1RA 2PVPA 4II7A 4LRXA 1ZK2A 4TS3A 5DMXA 5IXJA 5KNCA 4RTRA 5M29A 5DP1A 3UF0A 5CTAA 4DDTA 5FUWA 3VR4A 4YQFA 4AM8A 1Z2AA 1UJ4A 2HFJA 3D6FA 1BZYA 1XZMA 1Y5RA 3I9OA 3B12A 3WNVA 1PR9A 1KAQA 1S2OA 4HB0A 1U81A 1JQKA 1Z5PA 2QVGA 2ZK7A 1UXOA 1X7WA 2AMLA 1QAMA 4I55F 4PC1A 4BJ3A 1PG2A 1S6YA 1XVTA 3GAMA 3M6WA 2JG3A 2POCA 1N6PA 1T3SA 1NXWA 3B38A 3KR9A 5CHEE 4Q1FA 4JA9A 5H70A 5T4EA 3TWSA 2F1HA 5F1KA 1VHDA 3LDZA 3QMVA 3HBFA 4AZWA 1GJRA 1MQ9A 2RBEA 2D59A 3NDRA 4HUQB 5JDCC 1YRAA 3S28A 5KQSA 2I33A 5IBPA 2PS1A 1KPIA 1UP6A 4ER5A 2VJCA 2GN1A 1P6XA 3E9ZA 4BC0A 2IYYA 2W42A 4RV4A 5FH9A 2F43B 4FHGA 1Y48E 4ZVTA 5U4QA 8ATCA 3MELA 1DOZA 3QE0A 1EXMA 2AG0A 2X7JA 1TA0A 2I29A 2HO4A 2QJRA 3CUKA 3PWZA 4Q47A 3T8YA 2CXXA 3DBSA 2IOFA 4BEPA 2BF0X 1T2NA 3LRXA 3W8FA 4MNTA 4WMLA 1R88A 4E5UA 1VSBA 1CPYA 2H1IA 3MB5A 4LHVA 1Z5GA 2XMRA 5JNTA 2Z2XA 2P3QA 2GYYA 2DFLA 1E79D 4JEMA 4ER6A 3DDWA 4RIGA 1TVEA 2GN6A 3JATA 1YYHA 4JP3A 5AN8A 1Z4NA 1OCRE 2WU0A 1JMKC 1W5TA 4AB1A 3FU6A 1PBNA 1E2MA 4U95D 2X5OA 1UBUS 3EG5A 4D6PA 3ZVKA 1BU5A 3ZGLA 1C7QA 4PHGA 1AN9A 4BO5A 2EJCA 1NVEA 1EJBA 4F9FA 1JHPA 1CT9A 5TC4A 5CYPA 5JJBA 2JZCA 2AW3A 1T0UA 3ISVA 2FV8A 4ETMA 3O4HA 5KQGA 3AR7A 2R5WA 1TI7A 5JH7A 3A31A 1DAMA 5JAQA 3W05A 3WLEA 2PSFA 4J1SA 5IY5E 1Y6FA 1IY1A 2EV9A 3QKIA 2Q7DA 4KE9A 2NNLD 3V6LA 3B7WA 3HP1A 4MPTA 2XTMA 3PHJA 1JS1X 4M8SA 2C9YA 4TTAA 5C8YF 3SZ3A 1EP2B 5CCBA 3AUKA 2XCSB 1EXDA 3R3UA 5FHRA 1X1EA 4L4XA 2YJ4A 1IXKA 4UE6A 3LUFA 1UIRA 1QRRA 3TJPA 1H8HD 1OTHA 1HDCA 2HMAA 1PBTA 3U16A 3UJ3X 4AY6A 4ZMRA 3OQPA 2ZJBA 4GC5A 4KNWA 2MYNA 1JQ5A 1C1XB 3S5JA 2CLDX 3DE3X 1O8BA 5G1OA 1KU6A 2VHZA 1OCEA 3VHRA 2Q4RA 2CVFA 2BDTA 1U0HC 3OQIA 2I6GA 2A3NA 2VI5A 4J0GA 2GA8A 4FSXA 4HXGA 1CR2A 2I4RA 3E23A 3LPNA 2VNJA 3C3JA 3G2LA 5LB4A 4M76B 2OCBA 2KW5A 3KSUA 1A8IA 2ZKIA 4ND1A 1EA7A 2CWDA 4G24A 2JFPA 3B1KA 4BFVA 1QAOA 5CITA 4IWYA 4R51A 2P2CP 4N5MA 3L0BA 1TJFA 2H11A 3NH9A 3ANSA 5KOHA 2HCRA 3BMOA 2VGEA 4BKQA 2KPOA 5LQKA 5HQTA 4PZ9A 3DW1X 5K03A 3EFOA 3UT4A 1OF1A 3RAJA 2FZEA 4EVRA 4AROA 4QTZA 4BYGA 5KB3A 2UUCB 4X6XA 4NU0A 5K4AA 4KLNA 1RWXA 3ETGA 5C46F 4NXNB 1NA0A 1A82A 3GRRA 3HY3A 3W06A 1YHZA 4YAWA 1GTRA 3NVAA 4TMXA 3ND7A 4V38A 3CJQA 1IN5A 4B4UA 4R81A 1OLSA 1XNJA 2QFCA 4XKCA 1YB2A 2OD9A 4TT3A 4XPIA 3TWXA 4PC2A 3N3BC 3H8WA 2Y4UA 1ZUHA 1ZX1A 3R6GA 3LUCA 5IM4F 4KPUB 2ZUFA 3HVEB 1BVRA 1B15A 5ENTD 2X0JA 2PXCA 2AF3C 1COWD 4JJKA 2BKGA 2C20A 4GSLA 4J3JA 2KXPC 4R1UA 4URZR 1ZAYA 1YCDA 3P2JA 1S9DA 1V3QE 2I2CA 1HV8A 2BEWA 1QQ6A 2W4QA 4WKOA 3O8QB 1NJGA 4MIYA 5KJ1A 2XKKA 2HPZA 1QG6A 3T6KA 2IU0A 2YCBA 3QWVA 4LZPA 4XRRA 2DC1A 4LSZA 1FX1A 3CVUA 4FD2A 3CH4B 3O91A 2ZBFA 4GLBA 1P7YA 4MV5A 4LQ4A 5KNCH 1KMCA 1TZKA 3NHFA 2VVTA 4BTEA 3FG9A 1KZHA 1LVUA 3CZ4A 4I6EA 1WXDA 2BEDA 2GS9A 5HRYA 5IYZB 1C1HA 2WTAA 1I4TD 3ILHA 4RKYA 5DSTA 1RADA 1T2FA 4JC5A 4TKVB 1W1UA 2OM6A 3PEWA 1P1FA 1MBZA 1NN3A 3TIVA 3CSUA 4UCQA 4LGYA 1MTZA 2QTLA 4DSUA 5JH7B 5HQ8A 4YCSA 2NZWA 3D4PA 1OBHA 3FWKA 1U90A 4RULA 4G8JA 4WXHA 3BXHA 4NS4A 3MRSA 4X63A 3F2IA 1U99A 1K86A 3G0OA 4AX8A 1KJ8A 4CLRA 5AW1A 1VSTA 3VU9A 1JHZA 1PV2A 5B64A 4NDZA 1RQ7A 2O8VA 2ZP1A 4DMRA 4FHDA 4WOKA 2ZU0C 4CR6A 1I4OA 5JAIA 1P5QA 3N1UA 1YS9A 4PZ0A 1KZOA 2Q28A 3CRMA 4OB6A 5F4BA 2QSZA 3LYLA 1M34B 4QGSA 2ASEA 4JYZA 4QUEA 5C8YA 2HZBA 3RAGA 1FFBA 2QTFA 4EH1A 1A98A 3Q7FA 3K1JA 5BN3B 3GNLA 3HUFA 3TUZC 1I2ZA 3ZDXB 2Z57A 4EELA 4AKIA 5C1DA 3F74A 2C58A 3AJIA 3E7XA 3JAWA 1XXHA 2RH8A 1CU1A 4XB2A 1FPPA 2O2JA 1E7VA 2Y76A 2ZROA 1I5OA 3EDMA 4FDUA 3UATA 3EHRA 2BI8A 5E2IA 1GDHA 1HLGA 4IUCS 3TUIC 4IOLA 1CY0A 2ZB3A 4HOUA 1GZ3A 4OHWA 2QGNA 3I2HA 2CN1A 1A9QA 3GJSA 4E22A 4DZZA 4QAQA 4W1QA 5CFPA 5CNIA 5C7LO 1JN0A 1BI7B 5I3CA 1C7EA 5HIKA 2V9PA 1EE1A 1PZHA 3DXXA 1MZCA 2EDCA 3MTDA 3OE1A 3OLWA 4HMQA 1A5SB 5F52A 821PA 3ZY5A 4DDKA 3HCRA 5IJ0B 5AI8A 2YV1A 5JHHB 1EFRA 1UBGA 3UBTA 2QG4A 3H8SA 2IDKA 2QTMA 1DAPA 1X38A 4HNGA 1UKYA 4LWOA 4MHSA 4QTTB 5FWAA 1HYBA 5GOZA 2GXUA 3SC2A 1SW6A 1FEZA 3DXYA 1ZCBA 2WJVA 4OU4A 1PCXA 3UG7A 1E92A 3H16A 2W83A 2FPMA 1AGNA 2GAIA 2B4QA 2ADOA 2X5NA 3J81A 1DV1A 4AUNA 1AKNA 1OI2A 3FRHA 1Z08A 1E0AA 3K6SB 1CRPA 2C57A 3OQOA 4B74A 3KSMA 1Z07A 2R8YA 3D81A 3KO8A 3KU1A 4EHJA 4RJTA 4CKWA 5DNYB 2H0QA 2O8DA 1BX1A 1BYUA 1BXRA 1X74A 4B3CA 4D5GA 2Q8NA 2G67A 4DRZA 2OZPA 2VPPA 3RJVA 4MRNA 3VPFA 3X43A 3DMHA 3L6UA 5IJ9A 4LXIA 2R5SA 1VPDA 1Z68A 2ZE7A 3QLVC 4NCJA 3T7KA 3CWQA 3KVOA 3CY6A 4AZTA 3V30A 5BO5A 3R7QA 2C7QA 2C82A 1U5CA 4XTRA 3RSFA 3IIIA 1DE0A 3U9LA 1EP3B 1XRQA 4OHBA 5FV4A 2F43A 3GUVA 3V33A 1BJRE 2BM1A 3OQBA 1UQRA 1W5AA 2ORIA 3ZE7A 5HE8A 3FMPB 2QQFA 4GOKA 3RREA 4R6XA 2GETA 3IPYA 3FULA 1A4UA 3NM6B 1WP4A 4K9SA 4BUCA 4RPHA 2C07A 2VLBA 4NV1A 4OYRA 2QD5A 3F2VA 5EX0A 1DTEA 2BM8A 2FSPA 3BB4A 4I36A 1I0LA 1L5HB 2H6EA 2X5KO 2AXQA 2NUAA 3B5JA 5F21A 2Q4BA 2YVQA 4RGBA 1MB0A 1NWHA 4X6UA 4E14A 3K1YA 1GKYA 3DLAA 4OYYA 5IAAA 4O1MA 4EJ0A 1U2GC 3EJWA 4DL9A 4OQNA 3UT7A 2WU1A 1U7DA 1UC5B 4PINA 1TN6A 3U80A 1O77A 1UQUA 4RVFA 2AKYA 2QMUA 4D98A 5FXMA 3UT8A 3AQ4A 2P4EA 1QIEA 2JGDA 4A91A 3RTGA 2ANCA 3COZA 1PEKE 5DBFA 4CMGA 3LDFA 1AQNA 5CD1A 2IUUA 4DXHA 2VCHA 3ET5A 3DZBA 2G4VA 1N7GA 1P8JA 4B82A 3WYGA 1RRGA 5CYFA 1PUXA 4DGSA 4J76A 2WVAA 1U2EA 4XGRA 2G6TA 1LNSA 1R6UA 3CX8A 1J5PA 1L6IA 3FMOB 3L7YA 4FYHA 2W8BA 4YPFA 1NRWA 3E22B 4CKEB 4JBYA 1G6KA 3BWMA 3IALA 4NF2A 4ZYVA 3O8RA 1I6MA 3DFZA 4XUDA 3RU7A 3RS7A 2CUNA 2EFDB 4N48A 4ND6A 2QP3A 1HE5A 4L16A 1OI7A 1L5MA 4KK4A 3SAJA 4DYDA 3ZI0A 2XWSA 1OAKA 3AG6A 1RI3A 3G2NA 2A58A 4BUZA 1CXZA 3K0KA 3RFVA 3GDWA 2E37A 2DE0X 3Q78A 4Y6QA 3QHAA 3QSYA 3TNLA 4XVCA 4NYIR 1U8ZA 1UKVY 1OWNA 1UEXC 3Q47B 2NW6A 3R0VA 1D2AA 2CLOB 4RC9A 2QRHA 3JD4A 1M6VB 4BO4A 2EIHA 3B70A 4INJA 4YA6A 2DP4E 4L5CA 1QBGA 3CPSA 2P4HX 3GUYA 1X8KA 4E15A 2LSUA 1QZTA 1ECFA 1JT9A 3OJLA 3RC7A 4KBFA 4ZEXA 4LBVA 2VK1A 1F60A 5KC8A 3KVNA 4ZEOA 2DOKA 3P2EA 2YC4C 5EKSA 4FC6A 4KV7A 1Y1PA 4C0EA 1K89A 4IN3B 2PX5A 1RI1A 3JYLA 3QVGB 4MW9A 1AKTA 1C1YA 2DR2A 1XQXA 4CODB 4NU8X 4OQFA 4QATA 5DTRA 3UK7A 1OSNA 3KYDB 1UBFA 5KOHB 1XU9A 3I2JA 5BQPA 3NOXA 3ZGOA 4FWBA 4WIAA 4EHAA 1PDOA 4L08A 4N1AA 2B3DA 2G08A 2YFQA 2YHIB 2ARKA 2G25A 5KYXA 4N18A 4WFIA 1TYEB 4ILKA 4KQMA 1TUGA 3QQPA 5B2ZA 4AURA 1KDYA 2I1QA 1YB4A 5CGQB 3CC8A 1IN7A 5CM8B 3VH2A 4H6XA 3L04A 3IV9A 3M6XA 4D45A 1LCIA 3EUWA 4ADSG 2R6JA 4AN4A 3BMCB 4KIFA 3L13A 5FBRB 4CMKA 5EJ4A 3OEHA 1DG3A 3K9BA 5CCEA 3U3KA 4AJLA 4RTSA 4F71A 3DB2A 4AT1A 4FB5A 4YCAA 4DIDA 1RABA 3IPRA 3LE8A 3A36A 4XKJA 2WR8A 3RVJA 5CB4F 2MSDB 1NIPA 1DX6A 1LW6E 1UFRA 3AY0A 1UBLS 3O6VA 4TSRA 3FPKA 4BQPA 4D02A 3T5GA 3AHCA 1I14A 2XT9A 4V3BA 2YHSA 5C8ZA 1WZUA 5EFZA 1XTZA 2HXSA 4PGFA 1TK9A 4CMEC 2O8CA 1DRWA 3TO5A 1OAOA 5ENPD 4NAUA 1W88B 2GN4A 3H2JA 1QYMA 1NVWQ 1ZO8A 2WBLC 3QOWA 5HUQA 4LHSA 4FIZA 1UMBA 1GQOA 2SICE 3K3PA 4WZ6A 4CIDA 4LY6A 2IV2X 2H48A 3FUIA 1G21B 1CULC 2WF8A 4K9KA 1RJDA 2HJ9A 2EKBA 2PS0A 2X9VA 3HR7A 4FLMA 1E8YA 1X7HA 2HBZA 2I03A 5A1JA 1U1IA 2B4KA 4GR4A 2B8TA 4IDDA 5HZGA 1VRCA 3ZKJA 2RJOA 3AHGA 1C50A 3BK1A 3UTCA 3HTXA 4IIJA 2DYKA 2C3PA 3TBHA 1PEAA 3S4YA 4UM7A 1HG5A 2JFXA 3HBAA 4UU0A 5KYXB 3G8YA 4LBWA 4RORA 3J5PA 1KOJA 2LP4Y 2FPPA 3QQ5A 1RTTA 1XN4A 2YDYA 10MHA 2WY2D 3P32A 3ONFA 4TXLA 4PC7A 1T3GA 1W4CA 1I9GA 3HXPA 1JDBC 5D3QA 4RELA 3SZUA 1J8YF 4H15A 1KKMA 4C3UA 5CDSA 5CA1A 1F6DA 3U1VA 3V9AA 1M34A 1PR6A 5A1TA 2VBIA 3I5UA 5AD1A 1IPEA 2LWIA 2WQ6A 2AFIB 3RT1A 2OFFA 2PQRA 3VHQA 3FTXA 4DJ5X 3W3AA 1XIVA 2VA9A 3KT6A 2Z95A 5L7YA 4NEHB 1Y9ZA 3D6VA 2OUKA 4V1CA 3E82A 4ALKA 3UKDA 4M8NE 4EX6A 3W90A 1VB5A 1ECJA 4V0KA 2Q3EA 4I9EA 2YBEA 5EIWA 3C72A 2YFKA 2HV8A 3BGOS 3EMBA 4TYQA 1ZUNA 3RIXA 4FYKA 4JXJA 2UYQA 1LLCA 5TLSA 2EQBA 2FFBA 2PM7A 3S1LA 4DLPA 2JS7A 4B3SB 5HOQA 1W88A 4JA2A 2CHFA 1MAUA 2JAHA 2OV1A 4BVEA 5KJCA 5KWIA 3PREA 2FKAA 3LYUA 2B78A 4YP5A 3KD2A 4HH1A 3EVNA 2JFHA 3FZNA 3PIDA 2RD2A 1VLMA 2HSGA 3WWOA 5KVSA 2DBVO 2K4MA 2DYSE 3DBVO 4DR5B 4N82A 3HADA 3IP5A 1Z6PA 4J16A 3BH6A 1G18A 2IUTA 5DGXA 3VSBA 5KJFA 4XKBA 3DPSA 1SUFA 5JBNA 2YNMC 1EH5A 3CT6A 3R9WA 4QX6A 4DWJA 3LM8A 2J59A 4QBFA 1E8ZA 1NQUA 3IUQA 4K7JA 3SX2A 2O14A 1A69A 4ZOEA 3LC0A 3K0EA 4BATA 3U9SA 5FOSA 2AT1A 1F8GA 1O6BA 5FZRA 1V41E 3A6EA 3EH2A 4M60A 4MLZA 3CVLA 1OROA 1WMSA 4D6XA 3PNLB 4D81A 4LRUA 1UC4B 3OCWA 4YDEA 1LSUA 3I37X 2JHPA 1EU1A 4C0KA 5LNK1 3VO9A 2NYUA 1MOQA 1WXHA 3KVRA 5JA4D 3RUPA 2W9XA 3RIEA 1U1EA 4EA9A 5T7BA 3GJ6A 3CF0A 2R8EA 5AMXA 3TSCA 3CCCA 3AM5A 4XGKA 4PX3A 2XE4A 5E7MA 2LKDA 3ROKA 4YWHA 4HQ6A 2V0GA 1U63A 1SKQA 1IBKB 3DOFA 4FB4A 3TLKA 2Y69E 1E1KA 3PIRA 4O2BB 5K7SA 1KPHA 3QFSA 4Y2PA 2NUAB 4Z4HA 1QUFA 3MZ0A 3LKBA 5FJIA 2VDJA 5IAEA 3VPXA 3WBJA 3MWLA 1Z0ZA 1GPH1 2GSWA 1SBZA 3OPXA 5F5XA 5H16A 1V7ZA 3W2IA 2R3SA 2J9ZB 4DJFC 1DAIA 1U7HA 4OBWA 3UCXA 2YJ3A 4AULA 4EYQA 2BH2A 3BXFA 1CFJA 4X7MA 1MAHA 1GU0A 2JGDB 1ZINA 4EO4A 5EZ6B 1L4EA 5IULC