1FVQA

Solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
b'AREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-TRANSPORTING ATPASE
publication title Solution structure of the yeast copper transporter domain Ccc2a in the apo and Cu(I)-loaded states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 16
structure length 72
sequence length 72
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fvqA00
2AJ1A 2AP6A 3HHLD 5K9FA 3BGUA 4HI1A 1OQ6A 1FE0A 1FD8A 4Q2LA 3WDOA 4YEAA 1FVSA 3KG0A 3FRYA 2KT3A 4A47A 1P6TA 1AW0A 2OD6A 2VV5A 4OJ1A 2XMVA 2FB0A 1SI9A 2LDIA 5B0AA 5B09A 1OPZA 3HHLB 3FGVA 1TL5A 2CRLA 2HLTA 1VQSA 2ROEA 4EFAC 2GCFA 4NPOA 4YDXA 1LQ9A 1Q53A 1S6OA 5B0EA 2GGPA 3TNVA 1S6UA 1Y9OA 2IYIA 3HHLA 4HH1A 5B0BA 2N4CA 3DXSX 5B0DA 1FESA 1JK9B 4DPOA 1YJUA 2RSQA 1U7LA 2ACYA 1P8GA 1SB6A 2GFFA 2QIFA 4ZA1A 1URRA 3VTIA 3K7RA 1KVIA 3MZIA 2W4CA 3QMQA 4OIXA 4A4JA 2LXFA 5B08A 2K1RB 2LQ9A 3T9NA 3LGNA 4Y2IA 4FNHA 1FVQA 3UDCA 1VQYA 1OQ3A 2KKHA 4NL5A 2QLWA 1Y3KA 5F0UA 1GXUA 1XBWA 1YJRA 1Y0HA 2AJ0A 1R6YA 1ULRA 3IWXA 2FTRA 1GXTA 1X0PA 2FIUA 2ROGA 2VH7A 2XMMA 1K0VA 2OD4A 2QLXA 1YG0A 1V3ZA 2XMWA 1KVJA 2BYCA 1W2IA 3E8OA 1IUJA 3KKFA 2XMKA 4Q2MA 2LQBA 2QYCA 2W4DA 4Y2MA 3KNGA 1AFJA 2K7JA 4F67A 2GV1A 2HFOA 1TUVA 2IFXA 2OKQA 2OP5A 4ZOSA 4HI2A 3QGPA 5B0GA 3BB5A 4OJHA 2K7KA 4A46A 5A6WA 1YJVA 1Q4RA 2OAUA 2XMUA 3IWLA 5T7LB 1JWWA 3BN7A 2HQIA 1CC7A 1TZ0A 3BR8A 3TRGA 2HFNA 1N5QA 2ASYA 2K1RA 2OFHX 2ZDOA 3HFKA 3CJKB 4Y2KA 2BJDA 3HHLC 1N5VA 1TR0A 2HIQA 1RJJA 2IYGA 5B0FA 1N5SA 2RU9A 5A6PA 1WD6A 2L3MA 3MCSA 3LGMA 2OFGX 3LO3A 1MWYA 1FEEA 3TOQA 3CJKA 3BM7A 1Q8BA 2BBEA 4HL9A 4OJ3A 1OSDA 2N7YA 2ROPA 5KAKA 4HH0A 1TL4A 4QOTA 2GA7A 1KQKA 1X7VA 1X8DA 2XMTA 5F0WA 3DCAA 2PD1A 3BF4A 1YJTA 2KT2A 2XMJA 1CC8A 1FE4A 3F44A 4DL0C 3KG1A 3HF5A 2GGPB 2GO8A 4FNIA 3GZ7A 2RILA 2W4PA 2K2PA 2BJEA 1SQEA 3HX9A 4A48A 4DN9A 2EW9A 2N4DA 4U9RA 5T7LA 5IXUA 2OMOA 3I9ZA 4OJGA 2ZDPA 1QUPA 1APSA 2FHMA 3HDSA 2Q3PA 5B0CA 1Q8LA 1Y3JA 2KYZA 2AW0A 2JDJA 1YRXA 2RMLA 1AFIA 2PGCA 2BUNA 1N5TA 3FMBA 1CPZA 1MWZA 3BDEA 2G9OA 2HLUA
chains in the Genus database with same CATH superfamily
2DGSA 4K50A 4EO6A 1I51B 3EE3A 3MPVA 2BJ7A 4N76A 4GKKJ 1X9WA 3DOKA 3QQCD 4DUYJ 1SCJB 5A8KB 4WXWA 4NYOA 1KP6A 3WC2A 3UDEA 2HHPA 2ZH7A 2KXFA 4AXIA 2NUUG 4U7UK 3BGRB 4N41A 2AT1B 4K0KJ 5AE3A 5H9EK 1YHQS 4ECYA 4ZOSA 2UU9F 1F0XA 1S1XB 1UJ4A 3DRSB 4ICLB 3CJTA 3CDBA 2HW3A 2OEMA 1BWVA 1ZPWX 1SKSA 5B0FA 4DL4A 3UR0A 2MHNA 4DR2F 3I0RA 3KDOA 3I32A 1ZBTA 4BCAA 1VC5A 2A6MA 1N33J 1M1KT 4DV3J 1RQ0A 4EEYA 2VC0A 4OZ0A 1U1RA 5T7LA 3MM9A 2R2RA 3Q23A 5D3GB 1M5OC 3GSDA 5IM0B 4UZBA 2MZTA 3OTEA 3OUYA 4UY85 2X7IA 4O3NA 3BSNA 2MQQA 3TNVA 4N5SA 3MR7A 3MM5B 4C8MA 4ILLA 3OR2A 2UUBJ 5B08A 1H98A 4JI3J 3I0SB 1RHJB 3LQVA 4UOGA 2VG5A 8AT1B 2XMWA 4JI1J 2UUAJ 1SIZA 1TKXB 1HYSA 2DITA 2RDIA 3QGHA 4LF8F 3WIVA 2MQPA 2W24A 3M6WA 3RRHA 2ZDOA 3DI6B 2HHXA 1GMWD 1B64A 3V6JA 3QLHB 5KFNA 4CO3A 1WTBA 4ANCA 5GAEU 4K4VA 4J5OA 2QX0A 3TJAA 4USVA 2G0IA 2LU1A 4MFBA 3DM2A 3K5PA 2Y8YA 3LP0B 3QBCA 3EXCX 2WB1D 5HATA 3Q24A 1ACMB 1ITPA 2ATCB 1UPMB 3MMAB 4DCPB 4USTA 4JI2J 3AD8C 1HIYA 4OLPA 1H74A 4QQBA 1DURA 1MU2B 4ZVUB 3QJJA 2O1PA 3J80U 2DNRA 4QWBA 1VFJA 3W62A 2P8IA 1WELA 4YY3J 5BYSA 4KR0B 2YWEA 3VALA 3OV7A 2QLXA 2J8AA 5I3QA 2BW2A 1WC1A 4OI0A 2AGOA 3ULHA 3AXKA 1OY8A 1XIQA 3SI8A 2JL9A 2J9CA 3OJSA 1TKZA 3C6UB 2APOA 3HHNB 5CZVA 2C42A 4LRDA 2NXJA 1BMQB 2A3JA 4HL9A 3SV4A 4WE1A 4K59A 2GA7A 1FI4A 3TUZC 1KEKA 3KJVB 1VRUA 4DUYF 1AYEA 5G0RA 1U1PA 4WZMA 3RBEA 3AA8A 4RUBA 2R3VA 3J7ZT 4LF6J 3KG0A 1EQMA 5AXLA 3UD3P 2KT3A 1P6TA 4DG1B 3MGJA 2NXEA 4DFMA 3U02A 4NLXA 1FWKA 3TQEA 1SL0A 2QEXS 5AXMA 1YJUA 2YH0A 3UPFA 2EC2A 2H51B 3FEYB 1KVIA 2HHVA 4J9NA 1FNMA 3QSYB 5JUMA 2DR9A 4H54A 4Y2IA 1RTJA 3K8VA 3H4DA 1F5BA 3GTYX 2DIVA 4RW4B 1S9EA 2B4UA 3PJ9A 2LXIA 2VOOA 2MZJA 4X84A 4X64F 2KB2A 3PW2A 3IA0A 1Y5NB 1R8PA 1B4SA 3PJWA 3BYRA 2IRUA 5J2NB 1QJHA 3HPOA 2F8EX 4TLQA 3HKWA 3CD7A 2HNZB 3MTJA 3DXBA 4HH0A 3VZHA 4C97A 4CO2A 3DOLB 3UWTA 5FD1A 3EPGA 1WI8A 2DGTA 4DQIA 3W5ZA 2BQ3A 2CPHA 2IM1A 2G4BA 1MROA 4LFAF 3BDEA 1ZM2A 3HHDA 5KFYA 1REVA 4V19X 2RF2B 5FJ4A 4JI1F 2CRLA 2R4FA 4EYIB 2MXYA 1U1LA 4RBVA 3VWSA 2GFFA 2W7AA 4OIXA 4MH8A 2BJ3A 1RT4A 4DMZA 1EP4A 3G9CA 2BQUA 2ADBA 3PW0A 4YR3A 1FJGJ 4NLQA 4LFBF 3QWUA 4OX6A 1Z4UA 2YNGB 3NLCA 4DR6J 8RUCA 1RT2A 3NS6A 2Y0SD 3PYDA 1WUUA 1BUXA 3UVJB 3ENVA 2HQ3A 4WWSA 3OFEA 2LU2A 1JNZB 3G6VA 2BBEA 2P9EA 4YHHF 2BKPA 3V6DB 4M5IA 3S01A 1O51A 1IKVB 4IOBA 3JQKA 4RL1A 1K0TA 4TYAA 4RUCA 4ZN3A 4O0NA 3HK2A 2Q6BA 2FUG9 4B9TA 4U9RA 3ET6B 2R8IA 2ZZMA 4C2MA 4OX8A 3DRYA 5IQ6A 4N56A 1EJ7L 7FDRA 2XCAA 2AYMA 2IAJA 4RWXA 4F36A 2JHEA 4B9LA 2RIJA 1KOOA 3ITHB 5HMWA 2BE9B 1P8GA 3NGRA 3Q0AA 1H2UX 2LQ9A 5EWEA 3D0HE 2ZOGA 4ILRA 4N7TA 3RU0A 3IR7B 2RKIB 2LQBA 2Y1RI 2MKSA 4CRJA 4ES3A 1HBUA 2Q43A 4OLOA 2F3JA 3BN7A 2OEKA 1IWAA 4LVOP 3D28A 3CMES 1WG4A 4LF6F 3E3XA 2DNHA 1VK8A 3J7Z5 1RHRB 2BE7D 2RQCA 3BKTA 5F0WA 5L1IA 5E7OB 3IXQA 3KLEB 3D2WA 2HAIA 3T5KA 4ZVHA 5CXTA 3TARA 1U8SA 4PWWA 3W2WB 2F40A 1ZM3A 3J81j 3I96A 5E3RA 2UVRA 2MJUA 2YWFA 1HBMB 4ECTA 1K9MT 3ZZOA 3QIDA 2GJFA 3SQGB 4D3GA 1J5EF 4B3OA 1TL5A 3P3DA 3S1TA 1S97A 1C0UA 1RAFB 3EVOA 5HN0A 1C4CA 1SV5B 4Q7AA 3D0IE 1YVFA 2PN6A 3C15A 4KQZA 5LMUF 2D9OA 3CCSS 3TA0A 2ZKUA 3A8IA 1N56A 2DISA 3BO4A 2GW8A 3OTDA 2XMKA 3CSKA 3BBFA 2IHR1 2OKQA 2DGOA 3R97A 1UVKA 1KFSA 1R31A 4CP5A 2QGFB 4GKJF 5KTQA 3MTKA 1G3OA 1WOPA 3N6NA 2ZH5A 2C2NA 1RA6A 4PG6A 3CT9A 4TYBA 4ZVQB 1PJ6A 1S1VB 1PAEX 1FWLA 2WOMB 2BANB 5HJYA 5EDWA 3OTCA 2OPPA 3WIUA 1EX8A 1F9EB 1WC4A 4B08A 4O44A 3VGUA 2EFQA 1MMDA 1LOUA 2H9ZA 4ZP7A 3PR5B 2HFSA 1MN7A 3DLGB 1WKLA 2UUWA 2CQHA 3L9ZA 3LTOA 4FS2A 1DQ9A 2XS5A 2RDJA 5GADI 3GIKA 2I9SA 1VQMS 5KFFA 5J2MB 4I68A 1HHTP 3SCJE 4RBTA 4ETXA 2WAQD 2V8VA 2LEPA 1Q4RA 1R0BG 1IBMJ 4CYUA 1QUVA 2E5HA 1F60B 1VK3A 3L7PA 1SC1B 2JLEA 2CPEA 4UOCA 4IFYA 4ECSA 4DV6J 5F8MA 4DQRA 2B7BB 2G2ZA 4MIAA 4QW8A 4JV0A 1Z2ZA 1UTAA 4DSIA 1O8BA 4ZHRA 3LANA 4WP3A 3BJYA 2XLKA 1AFIA 3TUIC 3KLIA 1L3TA 3W66A 3ETMA 2UXDF 1DFDA 1RUSA 1JKHA 5B0AA 2XBPA 5IOLA 1TK8A 2UUTA 3HZGA 1HNVA 2ZFHA 2VQFF 4NLOA 4PPZA 4RW8A 1XERA 1AA1B 3Q83A 1RU1A 1FRHA 4U7UD 1U26A 4QIEA 4LMZA 3B6BA 2V68A 3ZZZA 2HNYB 5BR8F 2YX4A 3V81A 1KVJA 3FZ2A 4ED4A 1D9AA 2HWTA 5I4MA 3JSBA 2W2QP 2NSCA 1TL3A 2C2RA 1M5HA 4L74A 2FY8A 5A76A 4QCLA 3BREA 3Q8VA 5D77A 4AE5A 2ZE2A 1Q82T 3LP2A 1BGXT 4NXMF 5A8WB 4BC9A 3QGGA 4UOFA 3MF5A 1R3NA 3HVTB 2XTJP 1FE4A 2Z4PA 5LOQA 1HNXJ 2ZD1B 1IM6A 3ZFVA 3LUYA 5J2QB 3IRWP 4PYAA 3MCOA 1QVGR 4KGZB 4NE9C 2MSSA 1EAYC 5C25A 2WVDA 5CYQB 5KFKA 3QGIA 2QLBB 4W98A 1U0HB 4OX9F 1JLAA 1HQEA 4JBCA 3T41A 4PUOA 4Q8EA 2C3OA 4RNFA 1X5SA 1FA0A 2R2UA 3LGNA 1WJ9A 4C9DA 1K73T 4NL5A 4OHXA 1Y0HA 1Q79A 3THVA 4C4WA 3AJ2A 2CQ1A 1RTIB 2AYGA 2Y0BB 2QZ8A 2Q6CA 4KTQA 3KWMA 1SJ1A 1VIXA 2ADCA 4NLWA 2ASYA 2RH3A 4NCGA 2AU0A 3DYAA 3FEZA 2VFRA 4R5PB 1RWVB 1HNIA 3IRXA 1A6LA 4GVBA 1DQAA 3T5HA 4ZP9A 3PDNA 3JSMA 3HZEA 3POTB 2Y1JA 3X1LB 1BE4A 3EGNA 2HZVA 1D1UA 3HO1A 2V9WA 5KFMA 1OQ6A 3LA0A 2WSEC 3EMTA 3CE8A 2CWKA 3GP9A 1J27A 3I5BA 3WBZA 2B6AB 3SFGA 4DU7A 1PGZA 4LFCF 3JAMY 2RHQB 1SJQA 1GK8A 3NS5A 2X3GA 2WVFA 1RDRA 3NNCA 2WZ1A 5AJ3F 2E9RX 3AJDA 5J2PB 1NB2A 3AH6A 2IVMA 3MMJA 2W4DA 3EM1A 2CADA 3CC2S 5H9FK 3FSYA 3R6LB 1CJVB 1FKOA 1UVIA 4PR6A 1IQTA 1PYSB 1MWYA 5DLFA 3JTNA 4LSNB 1S1TA 3G82B 3FEXB 5HK4A 5J1NA 2MY7A 3F0NA 1LW0A 4J9UE 3GFXA 4KJIA 3WX4A 3MR2A 1QAXA 3F41A 1RK8A 5E33A 3M6UA 2X1BA 1Y3JA 1CQNA 3HHLD 2ILYA 1SC3B 2XO6A 2VV5A 3QFWA 2XMVA 4EFAC 3QJLA 1C1BB 1LXJA 3HVWA 2V0NA 5DQIA 3MAQA 1F2GA 3T1YJ 3U1LA 3DNCA 2QL5B 3N6MA 2PE8A 2LEAA 2E7VA 1GXUA 3I9V9 4C8KA 3CCVS 5MAOA 1F3VA 5GAHU 2DY9A 4EK2A 3IC1A 1JLFA 1RT3B 3SZ2A 2OPQB 1XQIA 3AHPA 3K5OA 4DR4J 1IUJA 1IQZA 2D3O1 4M95A 2BJ9A 5F41A 4WIQA 3GR0A 3IS9A 4ER8A 1RI7A 2M3DA 4F0HA 2HIQA 4X65F 2VA3A 1TKTA 3IN5A 5KFXA 3CJKA 2X51A 2FHOB 3A8JA 2QLJB 2RRNA 2HYIB 4MYUA 4YMEA 2C3PA 1QSSA 3UCGA 4B9SA 3MURP 1JLCB 3CC4S 4P72A 4ZIVA 3H98A 1TL1B 1T9UA 3D5MA 4OHWA 1HWJA 1WACA 3KK2A 1OY6A 4MIWA 2JH3A 4ZP8A 5IZHA 2IDLA 5EX0A 2FZCB 4M63A 4NPOA 1S6OA 3DGPB 3W9JA 3HHLA 1Q5VA 4JV5J 3MUMP 3L3CA 1FDDA 3IBCB 3BGOP 5K14A 5K8NA 2NS1B 2NUHA 4K7QA 1RT5A 1OJ4A 4LJMA 5HBMA 4LBHA 4OYXA 2CWXA 2HFOA 3G8SA 3T6JA 2PDAA 2AHOB 4OI4A 4I1TA 4JI7J 5HLFA 3W63A 1D0EA 2PC6A 1NDPA 1JMTA 2R7VA 1KHVA 1URNA 2R8GA 4NI2B 5I42B 4DHVA 3HSJA 3E01A 4QPXA 2RAQA 1YK9A 2N7YA 2HHUA 1KQFB 4RNOA 1X7VA 3M7VA 5IC4B 3ILOA 3CMAS 3CJ5A 1HWLA 3AOAA 1WWHA 2B4VA 4YS2A 4OJGA 3DRXA 4DLEA 2ZBIA 2ZHBA 1MWZA 2MKJA 4GO5X 3B4DA 4AYBD 2XGQA 3VGTA 2ZNZA 2R8JA 1FTCA 4ZVOB 1FESA 2G2YA 2VBZA 1LFPA 1S12A 3QIPA 5L38A 1JLQB 2YNHB 1TAQA 1NK8A 3H5XA 1Y00A 5HMZA 2W8LA 1DBDA 5BJRA 2DRDA 3AD9C 1Y5LB 2F4VJ 3KLFB 2BEFA 1C0TA 4KH0B 2XSJB 2ZH6A 4PYDA 2V2VA 2VOPA 3QT5A 1U0SA 4KH1B 2OI2A 1HQUB 1RHKB 3BEGB 5F8JA 3ZO7A 5IT9U 3P45B 2V8DA 4I6AA 2MDAA 1YLXA 5ETTA 2KH9A 4I67A 4YQWA 4ITSA 3QFHA 1WHWA 1Q5YA 5C5JA 4WU3A 4QW9A 3ADAC 3QT8A 4P74A 4C8ZA 4OYPA 2LXUA 4Z7CA 3FJ2A 2FVQA 1NU4A 2HBQB 3AXMA 1M5SA 4PWDA 4P2FA 3JB9k 2CXEA 4P75A 1UEUA 1KHWA 4N47A 1RHUB 3DMJA 1U6BA 5KFQA 2BV3A 2A18A 2DGQA 3PEJA 1FFGB 3F73A 3IO1A 2BYCA 5ETNA 2VONA 1SJ4P 3CJ8A 3GFZA 5BYRA 3OSPA 4H4OB 1UA1A 3SFUA 4NXNJ 3JTPA 4HHJA 1SBRA 5D0HA 4ANDA 2MB0B 1SUQB 4DQSA 3HSZA 4Q45A 5AXKA 5DDRC 4AD6A 2H5EA 3DHXA 1NO8A 5CHCB 3QAUA 1WNEA 1VRTA 3QNWB 3GPAA 4DV4F 2HNDA 1UETA 2GAHC 4YB1P 2G13A 1NK7A 2K2PA 3OTOJ 1T05A 3Q2TC 3EICA 1MMNA 1IM4A 2YWHA 2ZJPQ 2CJAA 1SIWB 4WYLA 5E3AA 1J5OB 3C66A 1HHQA 3B4MA 2ALYB 1HW9A 1WSVA 4Q0BA 4Y34A 4DQPA 1BY9A 3JXOA 4B3TF 3CC7S 1Y9OA 2CG8A 4U8YA 2YTCA 1CULB 2A10A 4AL5A 3FRZA 1U1KA 1X0PA 2VH7A 2CQGA 1IKYB 4JI8F 1N88A 5KFRA 2JVOA 3MPWA 2W2NP 5I3PA 3NMAA 3DC2A 4TY9A 2JNJA 3CJRA 4I6WA 5D4PA 3DN9A 4OYMA 2QTWA 2FVPA 3MEGA 1UJ6A 2CQBA 4DOZA 3UI3A 5KFPA 2E5JA 3Q2SC 2XI2A 4ZVRB 3M8QB 4ZIWA 1KSPA 5DS7A 4X66F 2U2FA 2E1RA 3H5SA 2UVVA 2V8GA 1QLNA 1WORA 1N34J 2R8KA 2MJNA 4O4RA 3GILA 1FD8A 4F4YA 3SSQA 2FLLA 2MYFA 3G6XA 4IFVB 3V6KA 1U1NA 4Y00A 2ZKTA 2ZM6F 1X5PA 2GO9A 2QIFA 4C6AA 1HA1A 2J9DA 1L3SA 1VISA 5DDOC 1R6YA 4LF4F 3L4BC 2AJQA 3W64A 1EETA 3QRPA 1GNKA 3VAKA 1TL7B 1EARA 2V2QA 2FYXA 4X4SA 4ID5A 3RR8A 4ED0A 3OHBA 2IC3B 2PEBA 2YKMB 2DCLA 4KGKA 2OAUA 3OL8A 4K4ZA 4QR1A 3OSNA 1N5VA 2KG0A 5K8OA 2HRTA 2V5HG 3LGMA 3AQPA 4OJ3A 1WEXA 1SQFA 2HS0A 2XY7A 3N5FA 4PQUA 2F5GA 3LAMA 3V6HA 2J9EA 3PIOQ 2M5YA 3BBCA 3UCUP 2ZOMA 1I3OB 5F8GA 5KFZA 1TK5A 3GYXB 1QM9A 2P6SA 2EVZA 2OHDA 3IAS9 1BQMA 1HBOB 4WU2A 3RAMA 4IH6A 4PWUA 3MXHP 2BE2A 4DN0A 4OI6A 2UXBF 1IR0A 1VQOS 5HL7Q 2PO4A 1V3SA 5IV4A 2GVDB 4DPOA 3HHEA 2ACYA 1VQPS 2O66A 5DZ6A 5KG0A 2CJYB 1CSJA 2DKOB 1UWBB 1UZDA 1X60A 3CPWR 1X4DA 5ITHA 1RP5A 4CLPA 3V4IB 2KHCA 1WHYA 1RACB 1GFWB 2H65B 3CF5Q 2K3KA 5A8KA 3PVXA 4PEOA 4WTYA 1TR0A 3JSRA 1VBYA 1ZAXA 3TP2A 1NBEB 3OJUA 4CH1A 3QSIA 2L41A 4KB7A 3R5GA 5IS2A 2Q66A 1NXIA 4NZ7A 3PX6A 3RAXA 2FVRA 1EIYB 3IGVA 2EG1A 4ENOA 1T03B 3DRSA 3IM9A 2E44A 1HBNB 2XO7A 2IVYA 2HQDA 1IBKJ 3K57A 4RLEA 2OSQA 4C8YA 2IJFA 3SDEB 2QMXA 4C8OA 4OZ5A 2G2OA 1XMQJ 4IRKA 5DG9A 2CQDA 5FDLB 2P6TA 2PT0A 3RYLA 1KQGB 2OELA 5D3GA 5J1EB 2N3LA 1DTTB 2PFFB 2QLWA 2W9CB 3ZNUA 1PSDA 4DFJA 5IM0A 3GIJA 1NEEA 1H2TZ 1U1OA 2ZEJA 2WVEA 1N4LA 1VQKS 4A8KA 2VBYA 3MM5A 4NWBA 1N48A 1FO1A 2MZSA 4PXBA 1FRJA 3M6VA 2HGMA 3I0SA 4C7QA 2AZ1A 2E9TA 2JX2A 4RNHA 1MWQA 1WHXA 3C16B 5KFDA 2CJ9A 1UMJA 4F4AA 5LJ3Y 9ATCB 1CC8A 5E3QA 2CAJA 4NA3A 2IJNA 2G0JA 2KRRA 3FQKA 5HANA 2V4QA 4DL2A 3DI6A 5C2CA 4JI5F 4AXJA 3N4WA 4NASA 1FDNA 1I1GA 2J0SD 4MYTA 1HFEL 3D3BJ 4YB7A 2ZZNA 5CCLA 4PRFA 4B9NA 3I5CA 1S99A 2MQNA 5KFSA 4NLYA 1IJEB 3LP0A 4PG4A 5FIIA 2YNIB 1FRMA 1NK9A 1FF2A 4AQYJ 3MMAA 4CQ1A 2XZDB 5D78A 3KK3B 3P6YC 1MU2A 5GADU 2KVIA 1X4HA 5KG4A 1RA7A 1H0HB 2VJUA 1Q8BA 4HHHA 4BWJA 3PX0A 3I5AA 2CZVC 3QT7A 4CTAB 2M52A 4JI4J 3HHKA 4QR2A 3T3FA 5F9NA 1VQ8S 4K8RA 1PKUA 2CQ2A 3C6UA 2Y1IA 4ZVGA 3T6BA 4Y2CA 3CUNA 1FE0A 2CIMA 1MMLA 2WTFA 3TUJC 2HLTA 2FD2A 3DOMB 2ACMA 3KJVA 3CO9A 1U24A 1TKDA 2JFDA 1Q81T 2IMWP 2QSWA 3Q22A 4W92B 2CPIA 4GMKA 4TN2A 3BQ2A 3M2RB 4B17A 4DPTA 3CDUA 3QATA 3SMZA 4ZJOA 3KHHA 3JS9A 2QLFB 3PEHA 1U49A 4A46A 2HQGA 2GAGC 2J7KA 4DL6A 3FBEA 4USWA 2W9AA 2AV5A 4JYAF 1OIAA 1VMBA 5KFOA 1OS5A 4JUZA 4RW4A 2ZBPA 3H25A 2H54B 1OWXA 4ZVFA 4EI2A 3MM9B 1SQEA 5LJ5Y 1S1UB 3VVTA 2XI3A 4K5SA 4F25A 4KO0B 5J2NA 1Q8LA 2QRRA 2KN4A 3OUYB 3I87A 2WVCA 2HNZA 1UFLA 1JB0C 2RUGA 1RAJA 3OL9A 3IBFB 2HGLA 1FT8A 3PNIA 1TK0A 4FYXB 1VIOA 3DDIA 2NYHA 2QN6B 1VQYA 3BSCA 2EKNA 2VG5B 4C3LA 4RBUA 1BD6A 2AD9A 2H3EB 2UV8A 1GXTA 3MFIA 3OD2A 4ZK7M 2RF2A 4DUZJ 4F02A 2DPIA 5KFVA 1HYSB 4F04B 1VR6A 5K20B 1RT1B 4LR9A 3UDLA 3TJ9A 1VJQA 2K7KA 2QV6A 1OYDA 3GFYA 2V2KA 3MR6A 2QL7B 1AUDA 3EDRB 4CIOA 4KAIA 1WC5A 3RW7A 4QU7A 3NAHA 1R8AA 3H42A 4M94A 3TVZA 1RLCL 2Y1LB 2YNGA 3DM2B 4DN9A 4LIWA 3FSIA 3UVJA 1KTQA 1FK9B 1RAIB 2JDJA 3B8HA 1CPZA 5LM7E 2JZ5A 4RX6A 3KJQB 1PC5A 3GE9A 3V6DA 2LDIA 5CD4H 1X9SA 4L3KA 4NLGA 3OXFA 2MGZB 1KFDA 2MKKA 5C24A 3F56A 2MPUA 1DJ0A 1XC9A 4ZA1A 1N36J 2W4CA 2XCPA 2IA0A 4GVLA 1JXLA 4ED6A 1KLMA 4PCQA 1YI2S 3DHWC 4TKTA 4ES1A 1YG0A 1RHQB 1VQ5S 1FKAF 2YWWA 3ITHA 4DV2F 4L72B 2HWHA 2CPYA 3TANA 4DSJA 4ED2A 2HS3A 4H4KC 4QWDA 2NZ4A 3LW5C 2BM0A 4AT1B 1RWPB 1I94F 4USMA 1S6QB 3S7RA 4DF4A 3R6GB 4XO0A 4CCHA 3IGNA 2RKIA 2IM2A 4HT5A 3FVYA 2FLNA 1O5JA 2GGPB 1REGX 3W61A 2HMIB 3Q8UA 3KUGA 4NLSA 3NGSA 1HR0J 4J9PA 1WEZA 3PACA 1S6PB 3TZYA 5KT3A 4A47A 3P8BB 3D3CJ 4DCOB 1UVLA 2CNKB 5HQ8A 4HH1A 1FNOA 4XPEA 4BLGA 1KOHA 2CYYA 2VB6A 3W2WA 4YR0A 2O3DA 2YNFB 4BBYA 2HRYA 1N6QA 1HBMA 3GV8B 1S9EB 4ZCIA 1K0VA 2B0GA 4CLTA 2EK1A 3LPEA 5SUHA 3WX8A 1SV5A 5H9FJ 1QAJA 4N77A 4LR7A 4DR7F 1S59A 2J7WA 2JRSA 4LF9J 5M2RA 1JXVA 2XNRA 1SKWA 3IM8A 1FEEA 1ZH5A 2Z0GA 1CS4A 2C2EA 4C11B 2OIHA 3EDQB 3CGIA 3NMRA 1GMVA 3MD1A 2BVZA 3BF4A 2WK4A 4HHUA 2KT2A 3NWRA 5IWAF 3MAHA 1B7YB 2D9PA 3FSXA 1F9HA 4ZPBA 3GONA 1REVB 4HI1A 4WFBQ 2DJWA 3M9OB 2OLWA 5IFMA 2GIRA 2UXCF 4X62F 4DUZF 2JFKA 4DU8A 4MKAA 4IR1A 1S1VA 4RPFA 2XMAA 3NCRA 3HI9A 3PM9A 1N52B 5B0DA 2WW8A 1U02A 3O1LA 2WOMA 4L73A 2BANA 4WBFA 2ZH1A 3BPSP 2DO0A 4YB6A 4IDKB 4WJBA 3ISNC 4DPWA 2B4PA 3P96A 1OO0B 1F9FA 3DLGA 2D3ZA 4DL7A 3UD5A 2UU9J 2D69A 4WTOB 5MLCV 4LF1A 2RUSA 3A8KA 5L46A 5CABA 2B7CB 1LWEB 5F9LA 4FXWA 5J2MA 4IQXA 5E3CA 1CQMA 4FYYB 4KV8B 5HP1B 3F44A 3CJSA 2DHSA 2P9CA 3BO3A 1I6JA 1DAXA 1U47A 2HKEA 2F9DA 3ISND 2XHCA 4OHZA 2WCXA 4EYHB 1XNQF 2ZWPA 4FZVA 1T94A 1NRKA 6AT1B 3M32B 2QT7A 1Q7YT 1NDCA 4UTGA 4PXEA 3PKYA 3ISZA 3VAGA 4ELTA 2ZVIA 3OXGA 2DRAA 3CCZA 5HROA 3CO0P 2K7JA 3NOCA 1RTDA 2FY1A 2CKWA 1MSWD 3DKDA 3PV8A 1LWFB 4CO4A 1OYEA 1S9GA 3IWLA 3MM8A 4DSLA 3OLAA 1FRKA 5HSPA 2N3OA 3LO3A 2HNYA 4HT7A 1JIHA 2VDIA 2I6WA 2R7RA 1Q8KA 2I0XA 3C14B 1ZTTA 3OL7A 1U8WA 5I3UB 4F0MA 4I7FB 5DQHA 5A8WA 4NRTA 1VLYA 2DR5A 4OYWA 3LGHA 1GTHA 2WBMA 4J9LA 1Y7PA 2ZJQQ 3MR5A 2B5JA 4ZVPB 1Y5IB 5J2QA 2IM3A 2AJ4A 2HZAA 2K1RB 3CTRA 3VAMA 3MMBB 5KG7A 1O0PA 3NAIA 3VAFA 1U0HA 4M5MA 1RBLA 3CXCR 4M5HA 2XYPB 1V5IB 2DEJA 1FFSB 4L6V3 2AQ4A 3D9BA 2VKZG 3CJ2A 4ECXA 1GQEA 1WD6A 4N8NA 5HO4A 3H7HB 1NKBA 3UDVA 1YJ9S 4RUHA 2DH8A 4YB5A 1RTIA 2BX6A 2XMTA 3R5DA 2Y8WA 5LSLA 5KFWA 2AJ2A 1NJIT 3HX9A 1QTNB 2E5LF 3UFCX 2OPPB 1NK4A 5EWFA 4DPXA 1KNZA 2IRXA 5GAGI 1TTHB 3POTA 2B8PA 1V5VA 1U6ZA 2MEWA 2M9KA 3NKYA 2HAFA 3NBPB 1AB8A 2ZHAA 3NGTA 1X4GA 2VBWA 2O01C 2KRBA 4ZCMA 2LECA 4WFYA 5DM7Q 4Z7YA 3KNGA 2B6AA 2CJBA 5KG1A 2FZKB 3DLKB 5DZ7A 2YX7A 4RZRA 1XR7A 1RCOB 3W2VB 4X64J 3M8PA 3GG0A 1RB0A 4WIIA 1EZZB 3CJ0A 2E9ZA 4Y2AA 1VS3A 3N5BA 2B43A 5J2PA 3CNQP 3KOAA 3NGDA 3H2LA 2EC0A 3PRVA 4DCJB 1LKZA 4P7TA 2CQ0A 2ZC3A 3IWNC 2AYEA 3MEEB 4ZHRB 2W9BA 4MIBA 1L3KA 5HVGA 4NLDA 3W8PA 1S57A 3FFIB 1S0VA 3T1HF 4OX7A 1DTQB 2AGPA 1IWGA 1SXLA 1JKHB 4LFAJ 4EGLA 4CWBA 4KC5A 1S7IA 2M70A 4LSNA 1G2EA 2B51A 1U2FA 3HD1A 1Q53A 5CH7B 4ZP6A 1QAIA 4UZCA 2KYXA 4FKXA 3VGSA 4BWMA 2KXNB 2JOQA 1TV6B 2J9DE 2F8HA 3V81B 2OGUA 3CCES 4DI6A 3M8ZA 1SH2A 3G4SS 4IH7A 5KFTA 2GHWA 4LFBJ 2FJDB 5IT4A 5EX3A 3M9MB 3MCSA 3TX0A 2Z2MA 4NCBA 2XY5A 3MOJB 2E7WA 3K5MA 1RT3A 3J81Y 2LA4A 2OPQA 1RAOA 2I8EA 1NNDA 2HK3A 4YHHJ 2UP1A 4LRBA 2HSEB 4FNIA 1VQ6S 1W26A 4HTIA 4U7CA 1LNQA 2CPZA 2LLZA 2ZBCA 4X4VA 1APSA 1WG5A 1FD2A 2DXFA 2MZRA 4ZS6A 4U8VA 4QIGA 4Y6IA 2MSTA 3RRKA 3Q86A 2IYIA 1PYTA 2CQ4A 2W1BA 4CO5A 4QIVA 1QE1B 4A8FA 4BS2A 1FXDA 3JSYA 1TL1A 1KC8T 2OJ3A 4DV1F 3MCNA 3ICLA 1ICEB 3ZZUA 3MDFA 1R8BA 4DFKA 4O3OA 5KFAA 3MPUB 3QYYA 1FDBA 3GJRB 3DGPA 2VFUA 2B4OA 2LDYA 4NCGB 2F65A 3DYAB 5KFUA 1SH0A 5CD4A 4NMXA 1HNIB 1XMBA 1T9WA 2DGUA 4DV5J 3MAAB 2Q1LA 3GYNA 4QOTA 3WQPA 5SZTA 2ZUAA 1K1QA 1PJ7A 1RBOB 4F4ZA 1J2VA 2V9KA 3N79A 5KT7A 3D54A 1FCAA 4I6YA 4LRCA 2ALZA 3R8YA 4NI2A 2CFXA 2PGCA 2HHHF 3ZZPA 2YWKA 4HKQA 3BGUA 5DDQC 3SCLE 4N8OA 3AT1B 1HPZB 3NP5A 4FVCA 4ZJQA 3KXDA 4NZ6A 4MKVA 1J5EJ 4ECVA 2DEIA 4KGMA 2IIHA 3RBDA 3KFWX 2CNNB 4KHPF 1MW7A 3M9NB 2XQCA 5LMUJ 1YJRA 3D6HB 3N28A 3PIPQ 5L9NA 4TQRA 4DF8A 3CCLS 4OV6A 4WZQA 5IC6B 2O67A 4UUXA 2DNKA 3EZ5A 3NL0A 1LWXA 2CJXB 3OQ2A 2ERRA 3JAMU 1NHVA 4B9MA 1HI1A 4GKJJ 3W9HA 2YNHA 1S1TB 4ALZA 2AEFA 3LOUA 4L3NA 3UE2A 1LW0B 2BACA 3B82A 4R0JA 2DGXA 1P1LA 3DCAA 4M5NA 3I31A 3V4MA 2VBXA 1XEZA 3BYPA 2QSFA 5A0YB 2XLIA 5KT5A 3KLFA 3EUNA 1ZAWA 2OPRB 1YRUA 3R5AA 2ZH4A 1VI7A 2IY5B 2Z2YB 1XMOF 1T7PA 4FXDA 4QZVB 4ZN1A 1UCNA 3BSOA 1HQUA 3G6YA 6FD1A 2E5GA 4KRWA 5KT2A 2DCUB 5D4LA 2F7VA 2J0XA 2ATLA 1S0OA 1HNZJ 4K5RA 4PAAA 4J9MA 4ELUA 3BO2A 3VGVA 2VG6A 5AXNA 4FF3A 3JQJA 4O4GA 3OHAA 2CVIA 3UN2A 2VFSA 2DTJA 4KPYA 4F67A 1ZS6A 3A4TA 5EHHA 3DRPB 5KOXA 2GZOA 1CJUB 5A6WA 3CCRS 1DY3A 4HDGA 2FJAB 1CC7A 3R5BA 4DX8H 3CJKB 3W60A 2XZTB 2KXHA 3BM7A 2BW7A 1UVMA 2XSFA 3MCMA 1YJTA 4F2RA 1PG5B 4H4OA 4HACB 5LXRA 4IG3B 4NLRA 1SUQA 4MK7A 4ZCKA 4J91A 1AZSB 3ZTPA 4FDFA 5K9FA 2BXJA 2J7UA 1N0VC 1AW0A 3MM7B 3HHLB 3LF0A 1S7HA 2UXDJ 1LQ9A 5BXIA 3D1QA 2XEXA 4LF7F 5K14B 4ETZA 4L76A 5HAOA 2VQFJ 1J5OA 1RT5B 4DV5F 4IO9Q 2EFGA 4ZLNA 1X5OA 2R2SA 3CMQA 5EWGA 5BR8J 1TMJA 1ZZFA 3N6LA 2OSRA 4OZ3A 3FQLA 1FJCA 3PRBA 4KGXB 2Q79A 1QSLA 1NCLA 3QRQA 4TNOA 2ZNYA 4EO8A 2UUCF 1IKYA 1X4BA 4QIFA 2JLFA 2R42A 4NXMJ 2XB2D 2FPHX 2XC9A 4YFUA 1N8RT 3CB4A 1NLKL 1L3VA 3I55S 4HTJA 3R27A 1S79A 3AOCA 2LQ8A 1RWOB 3HDSA 2JC1A 2RT3A 3M8QA 1G1XA 4J7CA 2FB0A 1FDAA 2GCFA 1VDHA 2NXCA 5ETOA 4F8RA 4RUAA 4OX9J 2RSQA 4IRDA 3BR9A 3QIPB 1R89A 1Y4ZB 2QMWA 4CH0S 2KKHA 1B70B 4E98A 2FJWA 1NPPA 4QWAA 1R0AB 4IOAQ 2DO4A 4H4MB 4IFVA 3RB6A 2RD5C 2V8PA 2QYCA 1D09B 1TFWA 3EVWA 3G8QA 1R43A 3HFKA 4WFNQ 2VL1A 1TVRB 1T9XA 3DDNA 3RR7A 4PABA 4K4TA 4DPYA 4QR0A 4WPAA 4KY3A 2UVUA 2VQEJ 2VG7B 1TL7A 4IKAA 2RILA 1R8CA 2IC3A 2YKMA 4TU9A 4LREA 5JXSA 3HD2A 3CDAA 1HNZF 3KMSA 2AJ1A 1T3NA 2EFPA 3K5LA 4ZITA 4NYZA 2MLZA 4OYAA 3RAQA 4OYBA 5ADZA 4HEA9 4PWDB 3C46A 1RWMB 2FLOA 2HHSA 2V4RA 2LXFA 4LFCJ 3UDCA 1BC6A 5KG5A 3DRRA 1RABB 2D7SA 3KTQA 3RJMB 5HQMA 3KJFB 2DGVA 1GX6A 3N01A 5AJ3J 4U6PA 2EXUA 4MMOA 4CH7A 1RZMA 4PXDA 4ED7A 3EZOA 2GVDA 4DL5A 1NAQA 1DLOA 4UOHA 2IJRA 4MJKA 5F8IA 4B3MF 5CYMA 3DFEA 3N0VA 3SXLA 5D15A 3BH7B 3W9IA 1RKIA 1T05B 4OZLA 4IG0B 2D1CA 4O3SA 2YKPA 5ETVA 1RWXB 2ZVSA 3MI7X 3KMQA 2QC3A 2ZH2A 4DEZA 5DQGA 3NGKA 1U2CA 5HQLA 1DQ8A 2HHQA 1HBNA 4J9QA 3AFGA 2NPFA 1GT8A 2DNNA 2HQFA 2BR0A 4CDIA 4ZDNA 1RTZA 3CVKA 3SDEA 2LMIA 3K2YA 1SQGA 4I56A 3A1YG 2G0CA 3LALA 3DU6A 1UVJA 1FKPA 4MT1A 5FDLA 2BOPA 4IRCA 2GQCA 1L3UA 4A8MP 4U67Q 4GC7A 5F8NA 2AF6A 2W2OP 4P52A 4KE5A 2W9CA 5ETKA 4X65J 1E6VB 2DR7A 5GVQA 1LV5A 1TL4A 3EWGA 4PG8A 2ABYA 4DPUA 2Z58B 3M8YA 3N9UC 2ZH8A 2GMHA 2HQCA 4ZPVR 1BWEA 2V69A 3BPDA 1RWWB 4ZJLA 3H0PA 5IXUA 1EHWA 3E2EA 4Y28C 4PPDA 3C16A 3M05A 2VD3A 1TU0B 2J0WA 1YJNS 2GQQA 5CQGA 4DUTA 3FGVA 3R2CJ 2FGOA 3DLEA 1C1CB 1JK9B 3J7YI 2IDEA 4LRFA 3BGLA 3BN4A 1RTHB 2VKRA 2XMMA 3H20A 4JI0F 1E6YB 5DLGA 1SL1A 4LF5F 2VQEF 4Y2MA 4NOHA 2IFXA 2CDQA 4RR5A 2DR6A 2BOAA 2YPZA 2HRUA 5U47A 3H5YA 1UKUA 3ENAA 3RGIA 4NRUA 3IG1B 4C0OC 1YJ7A 1WOOA 3FNNA 4ED8A 4Y3CA 4HR2A 2YNIA 1UVNA 3W3SA 2M0GB 1KONA 3KLGA 3A13A 4KT0C 4EBCA 2CQCA 1IBLF 2CNLB 3I9ZA 2X1GA 2GVZB 4JP8A 4K4SA 4OYZA 3NXZA 4XPCA 1X4EA 3M2UB 4WYWA 1X31C 7FD1A 1X4FA 3O5TB 4CTAA 3PO5A 2K06A 2DHAA 1KTVA 4GRSA 4J9RA 4LF2A 1B99A 2M4MA 2V2ZA 3OR1B 1ZM4A 4LT6A 1YTYA 5T41A 2AIRB 4Q44A 2MLXA 3THTA 4RU2A 3RW6A 1A9NB 1JLEB 1XWLA 5DG7A 4P73A 2CVEA 1NJXA 1I5OB 3DOMA 4AFFA 3QAEA 2RQMA 2HVDA 1G6BA 4F2SA 3BR8A 1HMVB 3M2RA 2L08A 4CLLA 3HJVA 1ZPVA 2ZWOA 3GB0A 1JJ2R 3PJXA 2MQMA 1SKRA 4F26A 9RUBA 2YH1A 4E8UA 1T9YA 3VAJA 1PO6A 4JV1A 1H7XA 2DT9A 2DH7A 1YIJS 2DXDA 2HHTA 3TR5A 1ZTWA 1N32F 4YEAA 4URSA 5F8LA 2IVFB 2MKHA 5K5MA 3OPKA 1ZZNA 1JJCB 3TZXA 1S1UA 1AXQA 4FBTA 2W7PA 3MOZA 4QBUA 2DGWA 4KO0A 1V3RA 1CBKA 1WF2A 2EEYA 3PFOA 4XDDA 3VR1A 4WFAQ 4PG7A 1CJTB 2GV1A 1F3FA 3QGPA 1KN6A 2P9GA 5HI7A 5B0GA 4DLGA 2V4JB 4OZ1A 4P2XA 4KFBB 1UA0A 4DL3A 4FS1A 4XIUA 2XWXA 2OFHX 4RW7B 2HEKA 2ZH9A 5KFJA 1HW8A 2BJ8A 3EJMA 2E1MC 5KAKA 4P71A 4RKUC 2BABA 4M5DB 3VAIA 2CNOB 1RT1A 3DLHA 4X4UA 2K3IA 4FYDA 4ECWA 3GYGA 2AEMA 2MZQA 4DV4J 3R7NB 3GJQB 3JQMA 3QZ7A 4DR5F 4WKRA 4ZCLA 4AL7A 3MR3A 3H8YA 1SI9A 1UFWA 2C2OB 1JLGB 4ZVSB 1LWCB 2E5IA 5B0EA 1N5YA 2AX1A 3M2VA 4W4MA 4B3TJ 4QYZK 3OVAA 2HFZA 1FK9A 4RJVA 5ETSA 2V34A 3PRDA 4QIWD 1OSCA 5GAGU 2FTRA 1RT7B 2FIUA 3ENQA 1MN9A 3QO9B 2HG4A 1LW2B 2EFOA 2W2MP 3MUVP 2MGZA 4JI8J 3UCZP 1VC6A 2KT5A 1VBKA 3MEDA 4X4QA 4X4PA 1KLNA 4B3RF 3FK4A 3GIIA 3UNYA 1IJFB 1RJJA 3S8SA 4CLKA 1S72S 2R7TA 5JMNA 1YGYA 1PC4A 4WCEQ 4DZDA 2KM8B 4CNZA 1CEZA 4DV7J 2XULA 2VHGA 3OL6A 2DK2A 2CPJA 3R3TA 5M2PA 1M5VC 2YKNA 4KHRA 2L9WA 4X66J 2N4DA 4LR8A 4EZ9A 5AE1A 1H2VZ 1F5AA 2QFIA 4CLWA 4P6QA 3RB4A 1VCTA 2DY1A 4TY8B 4A8OA 4GKKF 5CAAA 1S6QA 1SJRA 1GMWA 4DS5A 1IKWB 4WP8A 5EUHA 2ASDA 1SJFA 2GGPA 3CCQS 2HMIA 2YQ1A 1GTEA 3L7UA 4DJBA 2OH2A 1FEHA 3ZTOA 4ZPCA 3OBIA 3QMQA 1RGVA 2ZM6J 5KFEA 3T9NA 3HVAA 4CT9A 6FDRA 2VF3A 1S6PA 4K0KF 4FYVB 4NZ0A 2ZJRQ 1ZOTA 2HWIA 4CLZA 2WRMA 4LF4J 2ZUGA 3THPA 1GMUA 2KFZA 2F4FA 2U1AA 1S1WB 3HKZD 1S77D 2VFVA 2QA1A 2XS2A 2YNFA 3IBWA 2HBRB 1VGYA 4P10A 4ZLJA 1NUEA 3TA2A 5L39A 2DNGA 1IN0A 4FVMA 4FKYA 3VCDA 1N33F 1MG7A 2FJBB 4U95A 1Y11A 4DV3F 3CJ4A 3U1NA 3AAWB 4KSEB 1X8DA 2VZ9A 4KPCA 1T8EA 5HVFA 2RHSB 1VQLS 1Z1ZA 4Y0FA 4TQSA 3PFEA 3M8WA 4L75A 1TQLA 1B0TA 4XAKA 4I64A 5LSOA 3BKUA 5JVHQ 4C11A 1Q78A 2AGQA 1RHMB 3BSAA 2H4YB 3X3UA 3M8SA 4YDXA 3WHIA 2M7SA 4KKOA 5B0BA 4LQ9A 4J9KA 2UUBF 4ES2A 4JI3F 1SB6A 2UXBJ 1CJKB 3NNAA 3I82A 3W1YC 2W8KA 2UVWA 2D3OR 1NKEA 2UUAF 3HFZB 2BZ2A 4LQ3A 1RWKB 4JB8B 3JYTA 2NZCA 1VYAA 4JV2A 2XMUA 3TW0A 2AEJA 3GLJA 3TRGA 2G1DA 4M8LA 3KJNB 1B3TA 4IDKA 2B9XA 2BKOA 1OSDA 2ILZA 2RE1A 3NY0A 2VPZB 1T11A 2XMJA 3NG8A 3HFVA 3GWCA 1B0PA 2FVCA 4O3PA 3IR5B 3FCHA 2B9WA 5F3ZA 4K4UA 4YR2A 3TZWA 2DNZA 1LWEA 4JI2F 4NLTA 5C24B 4J90A 4KV8A 5HP1A 2PSZA 2EK6A 4QPTA 1Z2LA 2KJVA 4EBDA 1M0SA 1VHFA 3MZIA 1NSKL 4YY3F 3RB3A 2PI4A 4RW9A 2E1CA 1KLMB 2BMBA 4RW6B 1RT6B 1Y3KA 1HARA 3SQOP 1S9FA 2GMJA 2KL8A 4DV7F 3FMWA 2YX1A 1W2BR 2CPDA 5E5NA 5D0RA 2JEJA 4DSEA 1T9VA 2LVWA 4USKA 1IKXB 5JJBA 2LQJA 3M32A 3UW1A 3MMCA 2XM3A 3NRBA 1KS2A 5D8HB 2KHDA 2XWYA 3GCXP 4DZ6A 4I4BA 4ANEA 3SIPB 3AB2B 3B78A 1K1SA 2YVSA 3CWJA 3C3LA 3IMQJ 4F3QA 3MEKA 1LWFA 3DLJA 2LYVA 3AB4B 2EFNA 1ROFA 3CIZA 5C42B 1JLBB 3RG6A 2C3UA 5FLXU 3C6TA 4LSLB 3JTOA 5M2UA 4ILMA 1GX5A 1JJHA 2EG2A 2MTLA 3KDNA 4MKBA 3C14A 4JI5J 2IM0A 4UQGA 5I3UA 5DRKA 1D3WA 3ONQA 2I5JA 4I7FA 3UD4P 1M5PC 2R7OA 1N6QB 2XGPA 4I69A 2MQ8A 4FF2A 3MM6A 4BDPA 2MQLA 3HVRA 1PCAA 4OI2A 1JQGA 3HT0A 2OD4A 3KK1B 1FXLA 2YPYA 1V6HA 4HDHA 3D6FB 1H3DA 1CLFA 3QT6A 3QRRA 1BHNA 3TAMB 3CEDA 4W90B 1BQNB 3OW2R 1M5KC 4ZVEA 3Q89A 2K1RA 4WKYA 3R1HA 2GX8A 1CS4B 4ECRA 3C19A 3MMBA 5RUBA 3W7BA 3ETOA 4G1QA 4DX7A 4TXSA 2OPSB 1WC0A 3RZAA 3KG1A 2GO8A 4HYKA 3FCVA 3KLHB 3Q8SB 2ASLA 3MECB 1U1QA 2YQ3A 2KYZA 3Q8PB 3I4HX 1CVJA 2AP6A 3PY8A 3LP1B 2F9JA 1JXEA 2IBKA 3KHLA 3M30B 4UUWA 3PZPA 1KVKA 3AD7C 1NPRA 1HD1A 1TFYA 1F2HA 2WONB 5D0EA 5A2QU 2H1YA 5C2GA 3A3PB 1U48A 4DBQA 1FJGF 1HHSA 4CZCA 2HS4A 2VC1A 3W65A 2VUGA 5CZXA 4R8UB 2WW4A 3BQ0A 2VJVA 3TUPA 2D3UA 1SKUB 3BGRA 4DR6F 5ETLA 3M8RA 1FFWB 4DQQA 3OXLA 1BLUA 1W7WA 1S1XA 4ICLA 4E0DA 1M1HA 4FXVA 1EKSA 3NBPA 3HLUA 2DBBA 3TEGA 3TEHB 4FN5A 5J1PA 2GC8A 4JYAJ 1XNRJ 2EBEA 3GG1A 1D9FA 1KQKA 2Z8QA 3TA1A 3TWZA 4TU8A 2E1AA 2IPOB 1N54B 3DLKA 3G71S 4NLVA 3W2VA 3CD0A 1NHUA 2NPIA 3UN3A 4ZPWR 1FRLA 3GV5B 1UW9A 3GU0A 3EXYA 2VIHA 2XHWA 5A8RB 5B7WA 3TI0A 1PBUA 2EWHA 2YBVA 3MEEA 3PG9A 2FC8A 1EKRA 1VOMA 3FFIA 1DTQA 4CI0B 3PKMA 1XK8A 3CCTA 4NLPA 2A0FB 4O23A 5HROB 4C3MA 1RTDB 1AFJA 1S9GB 3NGUA 4XDCA 1TKXA 3MM8B 2DRBA 3FCWA 1VQ4S 1UZHA 2ZOFA 4G65A 1TV6A 3ENWA 3HSGA 4K4YA 3GMGA 1EQ0A 2MMYA 1SC4B 4P2MA 3EGVA 4B02A 3QLHA 3J80Y 3AY0A 4WFZA 3GCWP 3NCPA 7AT1B 2PIIA 1NH7A 4QYRA 4BHQA 2QO3A 5CCMA 5F3TA 3PR4A 2FJEB 3KHRA 3HMJG 3ILJA 4CT8A 4ED1A 1MNEA 1WDDA 2UV8G 3C2PA 3M1VB 1LEOA 2B5JB 1RWUA 4I2QB 1AT1B 1S6UA 2NREA 1H38A 1YQHA 1UPPA 4Q8FA 1YBUA 5DJBA 1HD0A 3VTIA 3VZIA 3KHGA 3Q8RB 3ZC4A 5G4DA 1OQ3A 3L09A 5E3PA 3FC9A 2WSCC 3TYTA 1KRPA 1WSRA 4V19J 4PG5A 5ETQA 1M1GA 3KKFA 3EVMA 5KT6A 2V94A 2V6AA 2AZ3A 3U1MA 4KHMA 1K47A 1HQ2A 4I2PB 4Y65A 1NSAA 4J9SA 1QE1A 4DV2J 4OYIA 2MKIA 2CQ3A 2WB4A 2OUGA 1QAYA 3ZXWA 4CLYA 2GHPA 3AQOA 2I2YA 2CDRB 5DGAA 4KBIA 1VBXA 1QVFR 1I94J 3LWLA 2NYIA 3DOKB 3UN5A 2CPXA 4DDFA 5IT0A 3OT9A 2OMOA 4WK1A 4C3KA 2GS8A 2GQ2A 3ZTQA 1TAUA 3VVUA 3WDOA 4NCAA 3MAAA 3ILIA 4FBUA 1RISA 4DG1A 4C0BA 2DNQA 4YUDA 1SJ3P 3PXGa 1IXKA 3ELHA 2A2CA 2J76E 4R0EA 2GNKA 1UJ5A 5F0UA 2XNQA 1XNRF 4MTPA 1HPZA 2DNOA 3I0RB 3H5UA 2VU5A 5GMKa 5EN1A 3KNAA 1IBMF 2DR8A 2HGNA 4ZMMA 3M8PB 1DRZA 5T7LB 1XR6A 3HHLC 2PEHA 4DR7J 4XK8C 2VA2A 4DV6F 2YXLA 1NDKA 1LK7A 2RS8A 3A3OB 2W9BB 1GH8A 4P9SA 3HF5A 3DOLA 3PW7A 2ASJA 5KFBA 5IWAJ 4D3HA 3OR2B 4YP3A 2CZ9A 2BM1A 2RNEA 2K8GA 1KKHA 1N0UA 2RQKA 1B7FA 3LPYA 1VQ9S 2L9DA 4K4WA 1WKKA 2PMWA 3PO4A 2UXCJ 4X62J 5D4OA 1QD1A 1HI8A 1U2RA 1R8HA 4NA1A 1VQ7S 5A0YA 2W01A 4EU0A 4FPRA 2JJ4D 2JEIA 2OPRA 4RWWA 1YWXA 2XLJA 1ULRA 4URQU 2ROGA 3K59A 3J7YU 1NH8A 1YITS 4WP9A 1EB0A 3SSSA 2AJFE 2FHKA 4AUKA 2KO1A 3BB5A 3M6XA 5D4NA 1PILA 1K44A 2ZBQA 3NEKA 4MFBB 3CULA 2R7SA 4ECZA 2V63A 1S4FA 3P4UB 5ETMA 2MY8A 3UR3C 1HNXF 2FJXA 3H2VE 2JEGA 1WTFA 2C2KB 3DRPA 4CLFA 4EWTA 1IKVA 2BKNA 1CJUA 2HFUA 1FX4A 2W4PA 2EW9A 3V5RA 1KD1T 1NJYA 2QMUB 3FMBA 3ET6A 2EBGA 2C3YA 2AYBA 4EZ6A 2DHXA 1FVSA 2J0QD 5L8RC 2B8QA 2NR0A 1B0VA 3J81U 5C7PA 1P9YA 4HACA 3G86A 1XNQJ 4IG3A 3W5XA 1TKZB 3GV7B 1NK5A 3GQCA 3FDSA 3AODA 5KFCA 1AZSA 1FVQA 4FF4A 3FBCA 3CCUS 1S5ZA 2LQ5A 3KUHA 4FYWB 1RCXB 4WE1B 3MM7A 2HHWA 4X2BA 4UQTA 5AE2A 2JSXA 5GMDA 2LA6A 1VRUB 4A8XA 2CG4A 5G0RB 5LMNJ 5ETPA 4USIA 3R2DJ 5D0GA 4U96A 1HNWJ 3UQSA 5DETA 2MHEA 2RU3A 3KLEA 2M8HA 2VFTA 3VQTA 2F63A 1RTJB 4K4XA 1VJWA 1OY9A 1F1BB 2DXEA 4TU7A 3I4PA 2DNMA 4I0WA 4USJC 3SQGA 3ZZRA 4NMLA 4ZPDA 1TELA 2XG8A 2XZWA 1FJEB 3K8WA 4USUA 1YSJA 2AMCB 1U09A 3RUBL 2BJ1A 1WC3A 4Q2MA 1R7IA 3O6QA 1RAHB 2Y3YA 1TZ0A 2R8HA 2KDOA 1RAGB 1MROB 3RBXA 5H9EJ 2PMZD 1R0AA 4A8YA 4H4MA 4QU6A 5LSRA 1RWNB 2NXNA 3VQSA 3AOBA 1WF1A 4O3RA 3G6ES 4DSFA 5B0CA 1VQNS 1TVRA 1W25A 1RT4B 3PW4A 1RBAA 2QJ3A 2E5LJ 5D6GA 1EP4B 3PHEA 2IBOA 2YQ0A 2EPIA 3FBBA 1ZAVA 2I1RA 4M1KA 5B09A 2PA3A 3B54A 1VQSA 3P49B 2VG7A 3T1YF 1RU2A 1YJWS 3DXSX 4ELVA 4H4KA 4J9OA 3OTBA 4OZ2A 1RT2B 2DPJA 2VG6B 1AUSL 4BC7A 4O4GB 3SEOA 4RNNA 4DR4F 3CDEA 3D7SB 1NB7A 1NMEB 1UFKA 4F50A 2CUYA 3CCWA 4HVZA 1RYSA 1KBRA 5LT5A 4Y2KA 2C22A 2L3MA 1X9MA 1NKCA 2VDHA 4MKYA 2IAJB 4DS4A 1RE1B 3CW2C 3OLBA 2HBYB 1RXOB 4URGA 1CG2A 2VPYB 2AWZA 1H7WA 3EGWB 1XJWB 4DSKA 1KR4A 1LK5A 2M8DB 1HKAA 3FRYA 1MLAA 3T1HJ 2RB7A 1OPZA 2CJKA 3QWPA 2DNYA 3I6PA 4JV5F 3H90A 4QYZJ 4IG0A 4OMFG 2D41A 2MZ1A 1HBUB 2QA4G 3W8GA 5LMNF 1NJZA 1NK0A 1ZYQA 3HULA 3HP6A 2AJ0A 1TUGB 1YKWA 1X4CA 4MAKA 2WSFC 5KFHA 2COLA 3OVSA 2DB1A 1HNWF 3GR1A 3TAQA 2RRBA 2XYHB 2JEFA 1P1TA 4F3MA 1SC6A 4JI7F 2DNLA 4IH5A 4B3SJ 4ZLLA 2RJZA 1SPBP 3MUTP 1N5SA 1U45A 1M90T 4RNMA 4IOCQ 4NEYA 2ZC4A 2E1PA 3J7AN 2ZBRA 4YOEA 2DIUA 4B3OB 1C0UB 1ELOA 2CJQA 1QY7A 3HVTA 2A6OA 3C15B 4K2JA 4PQAA 2ZZTA 3R5CA 3QZ8A 2ZD1A 3EZUA 1FRXA 2FHMA 2RMLA 2HLUA 3H2UB 3OFGA 1RKJA 3K89A 1FRIA 3BV8A 1E6VA 2KG1A 5CYQA 1Y10A 1Q95G 2JLGA 2C2ZB 3MWBA 1X5TA 4X4RA 3E51A 4G1PA 2GIFA 1QTMA 2SXLA 1HI0P 3ZZTA 4GC6A 4M5LA 3A12A 3CCJS 1Q1KA 4DV1J 4C8NA 3O2IA 3H40A 2PI5A 4DX5A 5GMEA 2CZ4A 1H72C 2C28A 2KZZA 2KJWA 1C1CA 2F4VF 5DGBA 3GJSB 4OZNA 5KFGA 4WXOA 1XN9A 2MKCA 3Q8QB 3BGFA 3QJPA 2OMLA 4NLUA 2KZMA 5A6PA 1RTHA 5GAEI 2M2BA 4LVNP 4CM2A 4PKDB 1PJ5A 4R5PA 1YBAA 2XY6A 3M4XA 4O44B 2PMHA 1E6YA 2HPUA 3D68A 4FF1A 4ID8A 3ZTRA 3U7JA 4F0KA 3V2UC 1WHVA 2HZCA 3BH6B 1QUPA 3T1AA 4DXLA 3IG1A 2A1BA 3CIMA 5HVHA 1XR5A 4CO1A 2RS2A 4Q5VA 2HHHJ 2GIQA 5CA5A 3OFFA 2MLYA 2WVBA 2RVJA 5IV3A 3GSIA 4CLSA 2DD8S 4C8LA 2W2PP 4CYUB 1WOSA 2GVZA 4G3IA 1FX2A 3DRRB 5T14A 3IAM9 5LL6d 4NX9A 2BRLA 4KHPJ 5KFIA 3M2UA 3UNGC 1Q8IA 4IFYB 3IR6B 2GHVC 1W2IA 5L1JA 4NXNF 1T9TA 3OR1A 4HI2A 1OPIA 1DLOB 1TUWA 1D8ZA 4OJHA 3H4BA 3TJ8A 4TLRA 4F4WA 2J6UA 5CYMB 4X4TA 2DHHA 3R5JB 1CJVA 3KLIB 1JLEA 3KLVA 4Z37A 4A8QA 4OYOA 1VC0A 5H1SV 3OTOF 4LUBA 1UP1A 2Z57B 4S0MA 5IQQA 2Y9HA 3G82A 1DZ5A 4UW2A 4OFZA 4HLBA 1D9DA 1HNVB 2QFJA 5L1LA 4QWCA 4LBPA 1HMVA 4R25A 1H73A 4RW8B 3OVBA 1S49A 3D67A 2G1HA 4ED3A 2B56A 1G4CA 2QG9B 4M5GA 4XTTA 2D74B 1LXNA 2N7CA 2ROEA 4EBEA 3PX4A 2HVZA 1XMOJ 3TX8A 2J6TA 1T02A 1TL3B 3NWGA 4B3SF 1UEVA 1C1BA 2KM8C 5EGYA 1U25A 2ZE2B 5L9XA 4WFXA 3LP2B 1XTZA 5KG3A 3EGZA 2R7QA 3NOGA 3K0JA 3TZZA 4IQMA 2XS7A 3E8OA 1HLWA 1TUVA 1FKPB 2DYAA 3AA9A 3SYZA 2FVSA 3A3NB 4KIAA 1P27B 5C25B 1O6XA 2W25A 4OHYA 3ZNJ1 3TO8A 2R2TA 1CJTA 3BQ1A 1JLAB 1HQEB 1N34F 4O3QA 2V4JA 4PUOB 3Q8YA 4KFBA 1C4AA 1OMSA 4RW7A 4K2XA 4ED5A 1JLCA 3ILLA 2GJIA 4Q2LA 1C2PA 1Q86T 2RQ4A 2E29A 2CPFA 1H6KX 1HL6A 2FC9A 1SL2A 4M5DA 3DLEB 3A8EA 2HVHA 4OHVA 2C2DA 2EKYA 3DLLQ 5KFLA 1HWKA 1JNRB 2B9YA 1KDNA 1LFWA 4LF7J 3OFHA 3CDWA 1NHKL 4YN3B 1RAEB 4ERDA 2LFVA 3IRXB 1V3ZA 5KOWA 4GVBB 3VF0B 3CJ3A 1JLGA 1LWCA 2VPXB 3JSMB 1F6TA 1UW4A 2QA4S 3TAPA 2YKQA 4UF4A 2IMOA 3KG4A 2FQQB 4E2FB 3BBBA 4JI6J 2OEJA 2HK2A 1FHTA 1IR1A 2QA2A 4DWIA 4X4OA 1RT7A 3R9LA 5I42A 3QO9A 1IBCB 2HVEA 4J37A 3VAHA 1L5UA 2ZH3A 1LW2A 2V50A 3KLGB 4IO1A 2AKWB 2UUCJ 2V67A 3GZ7A 2BDPA 1AROP 3PHTA 4KGVB 5K8PA 2X3DA 4CNYA 2Q3PA 5KT4A 1YDLA 3KYLA 3S6EA 2HURA 3FZBA 1JJ4A 1YX2A 1VHIA 3CD5A 2R7XA 2LP4A 2H5JB 2MQOA 3SSRA 3R7SB 3R1LA 3FBFA 4NEZA 5BYQA 5E2QA 3WZ0A 4OI1A 3K7RA 1U4BA 4M5JA 1FKOB 4A8SA 4TY8A 3NNHA 2FLPA 1JLQA 1SH3A 3VHQA 1PIEA 5IT9Y 1IKWA 4CLUA 1NJWA 1QSYA 4C0HA 3VV2B 2B3TB 1FWPA 3ZZYA 5AT1B 2J8SA 1S76D 3GFHA 2IYGA 2RU9A 4Z2XA 1R6VA 3SBMA 5DDPC 2Z30B 3SCKE 1Q0NA 3EYZA 1WG1A 2XSJA 2C1EB 4ZLPA 2NLWA 3NCQA 2KU7A 1S1WA 4B9UA 2N82B 5E0OA 3G8TA 2B9EA 2DVIA 5THWA 3G87A 3O8WA 3MFHA 1IBKF 1GXLA 2FZGB 4MK8A 2BUNA 3K5NA 1S4EA 3BS9A 3PW5A 1FTRA 2L9NA 1JLFB 1XMQF 3RB0A 1PYOB 1HWUA 2N4CA 3IS9B 1RAAB 3DLBA 3D6MB 2EFVA 4IR9A 2KI2A 1T95A 2QE5A 1TKTB 2JC0A 3K17A 1FNXH 2HFVA 1WKJA 1P9QC 1DARA 2YWGA 3O3LA 2HBZB 1KQSR 2VODA 2P2CB 3HJFA 4LIRA 1CJKA 3MD3A 2BRKA 1NSPA 5F8HA 3T19A 3KK2B 4B3MJ 3BZQA 3L7OA 3L95X 1R27B 5DM6Q 1UL3A 4QWEA 3RRGA 1N5TA 2XYGB 2P5VA 3P5BP 3J7A1 4OJ1A 4DX6A 2NXUA 1N5YB 3O44A 5HBMB 3G96A 3M2VB 1FERA 4DR1J 4PZVA 1WI6A 2KFNA 2H4WB 1URRA 4CM0A 1KWMA 1CULA 5HLFB 2L48A 4JI6F 2VASA 1TMMA 1XBWA 4KYZA 3E01B 3IWXA 4WF9Q 1NSQA 4AQYF 4WK3A 1UEKA 4G1IA 1RADB 3FUYA 4NYPA 3MEDB 2F1FA 1FJ7A 2X1AA 4Q43A 3AJ1A 1RSCA 2IA6A 2GJ2A 4RW6A 1RT6A 2FJVA 3BDPA 4QJVA 2CQPA 2KVQE 4JI4F 1D8YA 2YKNB 2A2DA 4O0IA 3HT3A 1VRQC 2PD1A 4DV0J 5FLXY 4P7VA 3HXMA 2JVRA 3IP0A 1IKXA 1A7GE 4A48A 4FP9A 2CQIA 1X0FA 1YRXA 2I38A 4LBIA 1R0CB 4V1Ak 2NSBA 1Q7LB 1S48A 3BKFA 4J9VA 3HCXA 2POKA 1PBAA 2KTQA 2R7WA 1Q16B 3ZZ0A 3LWMA 2EI5A 5KG2A 1ZA1B 5C42A 1JLBA 2X1FA 1ZM9A 3D66A 4LSLA 2E7XA 2YKOA 1C0TB 2RRAA 2VICA 1NZAA 1YZ6A 1VLOA 1TP7A 4ZKAA 3W5YA 5HMXA 1U1MA 4JI0J 4LF5J 1BQXA 3TVKA 2LKZA 1U6FA 4M5KA 2HQIA 8ATCB 2OO4A 2HFNA 2O5DA 4DR3J 3SCIE 1RLDA 4X4NA 3MHYA 2BJDA 4RO0A 3TOQA 1WF0A 2MKYA 5DO2A 2HVIA 4FPIA 4P2SA 2YY3A 3KK1A 1UWAA 2AX0A 4EMDA 4RU9A 1NK6A 3IFEA 3DDKA 3DGVA 2BJEA 1ZETA 3TAMA 3CJQA 1BQNA 1QDUB 3DU5A 1IBLJ 1IVZA 3CD6S 3DMJB 1HBOA 3HSDA 1GAOA 1DHMA 3PCOB 2LEBA 5A2QY 4ZVTB 4KKOB 2OPSA 1JX4A 4OZJA 4F4XA 3US5A 1HWIA 2OTJS 3T5JA 4F3OA 3KLHA 3RBZA 2R7UA 4IYQA 4A4JA 3MECA 2Z2LA 3GJTB 5DG8A 3D1OA 3UO0A 3D0GE 3LP1A 3PYGA 3JYTB 3EPIA 1VRTB 3M30A 1UWBA 2HNDB 4F7VA 2OP5A 3V4IA 3ZTSA 2JWNA 1V9OA 2WONA 1K8AT 4NA2A 2QL9B 4IUFA 5E41A 4LSZB 5HJXA 2ROPA 4R8UA 2ZHOA 2NCKL 3G2XA 2J6SA 4Q0BB 1NM2A 3HM9A 1VBZA 3P5TL 4DR1F 3T5LA 3RTVA 2E66A 3PYEA 2BQRA 1T03A 2ZDPA 4DFPA 4GO7X 2IRYA 2G9OA 2H5IB 4YDDB 2C3MA 2CA9A 2OD6A 5JVGQ 4DR2J 4C98A 1N32J 1X4AA 4OV1A 2RDDA 4AL6A 5CYJA 2M88A 1S0NA 4JOUA 1N36F 4ZPTR 4G6VB 1YBTA 1YZ7A 1UAWA 4RW9B 1U7LA 4ATNA 3LAKA 3SV3A 4ECUA 1WEYA 3MEGB 5LXYA 3LH2S 4UY8T 2FGCA 2PA8D 4F4KA 2QYGA 5J1EA 5KG6A 1PAUB 1DTTA 3FKBA 2KFYA 3R7BB 5A8RA 2FHJD 1WDTA 3D1HA 2GMLA 2H48B 4DV0F 2Z2ZA 4PXCA 4OL8A 3GIRA 1NZ8A 3K58A 3MMCB 4MK9A 2YKAA 2BA9A 4UT4A 2C2MB 4A8WA 1BXNA 2OFGX 1GEHA 4TVAB 1RYRA 5K8MA 2ZITA 2F8MA 1HR0F 2NQPA 2UZAA 3D4JA 3C6TB 1YRTA 4LF8J 5HMYA 4EUVA 3U27A 3KUEA 2AW0A 3I56S 2HIYA 3MPYA 4DR5J 1F5CA 3EX7B 3H59A 1EETB 1A0OB 1S0MA 2I5JB 3PYFA 4LRAA 1SVDA 4ID5B 4CO0A 5GAHI 3D6TB 3MPDA 4OQJA 3QPIA 3MM6B 4DR3F 4FNHA 2PFDA 2VPWB 3CCMS 2R9LA 2W7OA 3M1VA 4PQUB 3WC0A 3TVYA 3C8YA 2V8HA 4I2QA 2DNPA 2WBRA 4LF9F 1NPKA 2FDNA 1YJVA 2FHJA 3KK3A 1JWWA 3TQ1A 1BQMB 1N5QA 2OTLS 2LCWA 5L1KA 4B3RJ 2Z56B 4G1QB 1ZA2B 5ETRA 3NS7B 3T9ZA 1NDLA 2BE2B 4OI3A 2DHGA 1T3OA 1WC6A 4ZPAA 1T0TV 4C48A 1FXRA 4USHA 3PTWA 2WHOA 1IR2A 4ECQA 4I2PA 3GIMA 2J5AA 4B9VA 2DH9A 1S10A 1G7CB 4DL0C
chains in the Genus database with same CATH topology
5K9FA 1FD8A 4F4YA 1N0UA 3SSQA 2BXJA 2DGSA 2FLLA 2RQKA 1B7FA 2J7UA 3LPYA 1N0VC 1AW0A 4K50A 1VQ9S 2MYFA 4EO6A 2L9DA 3MM7B 3G6XA 4K4WA 3MPVA 4IFVB 3HHLB 3V6KA 1U1NA 3LF0A 4N76A 3PO4A 1S7HA 4Y00A 5D4OA 1X9WA 1LQ9A 2ZKTA 1HI8A 3DOKA 1U2RA 1R8HA 3D1QA 2ZM6F 1X5PA 2GO9A 4NA1A 2XEXA 4LF7F 2QIFA 1VQ7S 5A0YA 5K14B 4ETZA 5A8KB 1HA1A 4WXWA 4NYOA 4EU0A 4FPRA 2J9DA 1L3SA 2JJ4D 2JEIA 2OPRA 3WC2A 1J5OA 1RT5B 2HHPA 5DDOC 4RWWA 1YWXA 1R6YA 1ULRA 4URQU 2XLJA 4DV5F 4LF4F 4IO9Q 2ZH7A 2EFGA 2KXFA 2ROGA 4AXIA 3K59A 3J7YU 2AJQA 2NUUG 4U7UK 1NH8A 3BGRB 1YITS 4N41A 1X5OA 2R2SA 5EWGA 1EETA 3SSSA 5AE3A 1GNKA 2AJFE 2FHKA 3VAKA 4AUKA 1YHQS 2KO1A 4ECYA 4ZOSA 1ZZFA 3N6LA 2UU9F 1F0XA 4X4SA 2OSRA 1S1XB 1UJ4A 3DRSB 4ICLB 4ID5A 4ED0A 3OHBA 2IC3B 3RR8A 3BB5A 3CDBA 2HW3A 2YKMB 2DCLA 4KGKA 2OAUA 3OL8A 3M6XA 5D4NA 1PILA 3FQLA 1ZPWX 4K4ZA 4QR1A 1FJCA 3OSNA 3PRBA 4MFBB 3CULA 1N5VA 2Q79A 2KG0A 1SKSA 5B0FA 2R7SA 4DL4A 5K8OA 1QSLA 2V5HG 3LGMA 3AQPA 4ECZA 3UR0A 1S4FA 4TNOA 2ZNYA 4EO8A 4OJ3A 1WEXA 2MHNA 2MY8A 2HS0A 2XY7A 3N5FA 2UUCF 1IKYA 4DR2F 1X4BA 3I0RA 4QIFA 3UR3C 3I32A 1ZBTA 4PQUA 2JLFA 3LAMA 4BCAA 1HNXF 2XB2D 1VC5A 1M1KT 2FJXA 2FPHX 3H2VE 3V6HA 2XC9A 2J9EA 3PIOQ 2JEGA 4YFUA 1WTFA 2M5YA 3UCUP 1N8RT 1RQ0A 4EEYA 2ZOMA 3DRPA 3CB4A 2VC0A 1IKVA 4EWTA 2W4PA 1L3VA 3I55S 4HTJA 4OZ0A 1U1RA 3R27A 1S79A 5F8GA 2EW9A 5T7LA 5KFZA 3GYXB 1TK5A 1QM9A 3V5RA 3MM9A 2P6SA 2EVZA 3IAS9 2R2RA 1BQMA 3Q23A 3HDSA 1HBOB 1KD1T 5D3GB 4WU2A 1NJYA 3FMBA 2JC1A 1M5OC 3RAMA 2EBGA 3GSDA 2C3YA 2RT3A 5IM0B 2AYBA 4EZ6A 4IH6A 2DHXA 4PWUA 1FVSA 3M8QA 2J0QD 3MXHP 2BE2A 1G1XA 5L8RC 2MZTA 3OTEA 3OUYA 2FB0A 4DN0A 1FDAA 4UY85 4O3NA 2NR0A 2GCFA 4OI6A 3BSNA 1B0VA 2UXBF 1IR0A 2MQQA 3TNVA 5HL7Q 4N5SA 1VQOS 2PO4A 1V3SA 4RUAA 4F8RA 3MM5B 4DPOA 3HHEA 2RSQA 3G86A 2ACYA 4C8MA 4IG3A 4IRDA 1VQPS 1TKZB 3GV7B 3BR9A 1NK5A 4ILLA 3GQCA 3FDSA 3OR2A 3QIPB 1R89A 1Y4ZB 5B08A 2O66A 1H98A 5KFCA 3I0SB 1FVQA 5KG0A 2QMWA 4CH0S 4FF4A 3CCUS 2KKHA 3LQVA 4E98A 2FJWA 1CSJA 2LQ5A 4QWAA 1R0AB 4IOAQ 1UWBB 2DO4A 2VG5A 4H4MB 4WE1B 2XMWA 3MM7A 3CPWR 2HHWA 1X4DA 5ITHA 4X2BA 4IFVA 4UQTA 1RP5A 3V4IB 1SIZA 3RB6A 2KHCA 1WHYA 2RD5C 5AE2A 2JSXA 2QYCA 1TKXB 2LA6A 1TFWA 1VRUB 1HYSA 2DITA 2RDIA 4A8XA 3QGHA 3G8QA 3CF5Q 4LF8F 2K3KA 2MQPA 2CG4A 2W24A 5A8KA 3PVXA 3M6WA 3RRHA 1R43A 4WTYA 5G0RB 3HFKA 2ZDOA 4WFNQ 2VL1A 1TR0A 1TVRB 3DDNA 3RR7A 4K4TA 3JSRA 1VBYA 1ZAXA 3DI6B 3TP2A 4USIA 4QR0A 2HHXA 1B64A 3OJUA 4CH1A 3V6JA 2L41A 4KB7A 5IS2A 2Q66A 3QLHB 3PX6A 4NZ7A 5KFNA 3RAXA 2FVRA 2UVUA 3UQSA 3IGVA 2EG1A 2VG7B 5DETA 2MHEA 4CO3A 1WTBA 5GAEU 4IKAA 1T03B 2RILA 3DRSA 4K4VA 2RU3A 1R8CA 2IC3A 4J5OA 2E44A 2YKMA 3KLEA 1HBNB 4TU9A 2M8HA 2LU1A 5JXSA 2XO7A 2VFTA 4MFBA 3DM2A 2IVYA 3VQTA 3CDAA 1HNZF 1RTJB 3KMSA 3K5PA 4K4XA 1VJWA 2AJ1A 1T3NA 3K57A 3LP0B 4RLEA 4TU7A 2EFPA 3EXCX 3K5LA 2OSQA 3I4PA 2DNMA 2WB1D 4C8YA 4NYZA 2IJFA 3Q24A 4I0WA 3SDEB 4USJC 3RAQA 2QMXA 5ADZA 3SQGA 3MMAB 4OZ5A 4C8OA 4HEA9 4PWDB 3C46A 2FLOA 4OLPA 3ZZRA 4IRKA 2HHSA 4QQBA 5DG9A 2V4RA 4NMLA 1DURA 1MU2B 3QJJA 2CQDA 2O1PA 5FDLB 2DNRA 4QWBA 4ZPDA 2P6TA 2PT0A 1VFJA 1KQGB 3RYLA 2XG8A 2LXFA 2XZWA 5D3GA 5J1EB 2N3LA 3UDCA 1DTTB 1BC6A 2PFFB 2QLWA 5KG5A 1FJEB 1WELA 2W9CB 5BYSA 1PSDA 3K8WA 4KR0B 2YWEA 4DFJA 5IM0A 3VALA 3DRRA 3GIJA 2D7SA 3KTQA 3OV7A 1YSJA 1NEEA 1H2TZ 2QLXA 2J8AA 2DGVA 1U09A 2BW2A 5I3QA 1U1OA 1GX6A 3N01A 3GILA 1N4LA 4Q2MA 4U6PA 1VQKS 4OI0A 4A8KA 2AGOA 4MMOA 4CH7A 3ULHA 4PXDA 4ED7A 2VBYA 3MM5A 4NWBA 1N48A 4DL5A 1NAQA 1R7IA 3SI8A 2JL9A 1FO1A 2J9CA 3O6QA 3OJSA 1TKZA 2MZSA 1DLOA 4PXBA 3C6UB 2APOA 1TZ0A 1FRJA 3M6VA 2HGMA 2KDOA 3I0SA 2R8HA 3HHNB 4MJKA 1MROB 5F8IA 5CZVA 4C7QA 5H9EJ 2PMZD 2E9TA 2C42A 4B3MF 5CYMA 2JX2A 4RNHA 1WHXA 1R0AA 2A3JA 3DFEA 4HL9A 5KFDA 3N0VA 3SV4A 2CJ9A 3SXLA 4A8YA 4H4MA 4QU6A 4WE1A 1UMJA 4K59A 5LJ3Y 2GA7A 5LSRA 1RKIA 3TUZC 4OZLA 1T05B 1CC8A 1KEKA 4IG0B 5E3QA 2D1CA 3KJVB 1VRUA 4NA3A 3VQSA 1WF1A 4O3RA 4DUYF 2IJNA 4O3SA 2KRRA 3FQKA 3G6ES 2YKPA 5G0RA 4DSFA 1U1PA 4WZMA 3RBEA 3AA8A 5B0CA 2V4QA 1TVRA 1VQNS 1W25A 1RT4B 2ZVSA 3MI7X 3PW4A 3KMQA 4DL2A 3J7ZT 2ZH2A 3DI6A 5D6GA 1EP4B 3PHEA 2IBOA 4DEZA 2EPIA 1ZAVA 3KG0A 5AXLA 3UD3P 2KT3A 5DQGA 1P6TA 4AXJA 4DG1B 4JI5F 3N4WA 1FDNA 2I1RA 1I1GA 3MGJA 2J0SD 4M1KA 4DFMA 4MYTA 3U02A 2PA3A 5B09A 1HFEL 1VQSA 3P49B 2VG7A 4YB7A 3NGKA 4NLXA 5CCLA 2ZZNA 3T1YF 1SL0A 4PRFA 2QEXS 1YJWS 1DQ8A 3DXSX 4B9NA 3I5CA 5AXMA 4ELVA 1YJUA 1S99A 2YH0A 4H4KA 4J9OA 2HHQA 1HBNA 3OTBA 2MQNA 3UPFA 5KFSA 3FEYB 1KVIA 2HHVA 1RT2B 1FNMA 4J9NA 4NLYA 5JUMA 1IJEB 4J9QA 2DR9A 2DPJA 4H54A 4Y2IA 2VG6B 1RTJA 3K8VA 2NPFA 1GT8A 4BC7A 3H4DA 1F5BA 4O4GB 3SEOA 3LP0A 4PG4A 2DNNA 4RNNA 2BR0A 4DR4F 2DIVA 4ZDNA 3CDEA 4RW4B 1NB7A 5FIIA 2YNIB 1S9EA 2B4UA 3CVKA 3SDEA 1FRMA 2LMIA 2LXIA 1NK9A 3K2YA 1FF2A 2VOOA 3MMAA 2MZJA 4F50A 4I56A 4X84A 3A1YG 3CCWA 2G0CA 4CQ1A 4HVZA 3LALA 5D78A 3KK3B 4X64F 3P6YC 2KB2A 3PW2A 3DU6A 3IA0A 1Y5NB 1MU2A 1R8PA 5GADU 1RYSA 2KVIA 1UVJA 1FKPA 5FDLA 2BOPA 4IRCA 2GQCA 3PJWA 1L3UA 5LT5A 1X4HA 4A8MP 4U67Q 4GC7A 2IRUA 4Y2KA 5F8NA 5J2NB 2AF6A 2C22A 1QJHA 5KG4A 1RA7A 3HPOA 2F8EX 1H0HB 2L3MA 4KE5A 4TLQA 2W9CA 1X9MA 3HKWA 1NKCA 3CD7A 1Q8BA 2HNZB 3MTJA 1E6VB 2DR7A 5GVQA 3DXBA 3I5AA 2IAJB 2CZVC 4HH0A 4BWJA 3VZHA 1TL4A 3PX0A 1LV5A 4C97A 4PG8A 4CTAB 4CO2A 2M52A 2ABYA 3DOLB 4DS4A 3N9UC 3UWTA 5FD1A 3EPGA 3HHKA 2ZH8A 4QR2A 3T3FA 2GMHA 5F9NA 1WI8A 4ZPVR 1VQ8S 2DGTA 3OLBA 1BWEA 4DQIA 2BQ3A 1CG2A 4URGA 2CPHA 2CQ2A 2VPYB 2AWZA 5IXUA 2IM1A 2G4BA 3C6UA 2Y1IA 1H7WA 3EGWB 4ZVGA 1MROA 4LFAF 4DSKA 3E2EA 1KR4A 1LK5A 2M8DB 3T6BA 3BDEA 4Y2CA 4Y28C 3CUNA 1ZM2A 4PPDA 1FE0A 3HHDA 5KFYA 2CIMA 1REVA 3M05A 2VD3A 3FRYA 4V19X 2J0WA 2RB7A 2RF2B 5FJ4A 4JI1F 1YJNS 1MMLA 2WTFA 2GQQA 5CQGA 1OPZA 3TUJC 3FGVA 2CRLA 2HLTA 2CJKA 3QWPA 2DNYA 3I6PA 4JV5F 2FD2A 2FGOA 2R4FA 4QYZJ 4IG0A 3KJVA 4EYIB 2MXYA 3CO9A 1U1LA 4RBVA 1U24A 3DLEA 4OMFG 1TKDA 3VWSA 1C1CB 1JK9B 2JFDA 3J7YI 2D41A 2MZ1A 2GFFA 2W7AA 1HBUB 1Q81T 2IMWP 2QSWA 3Q22A 2QA4G 4OIXA 4MH8A 4W92B 3BGLA 5LMNF 1NJZA 2CPIA 1NK0A 4GMKA 1ZYQA 1RT4A 3BN4A 4DMZA 4TN2A 1RTHB 1EP4A 3G9CA 3HP6A 2AJ0A 2BQUA 3BQ2A 2VKRA 3M2RB 4B17A 2ADBA 1X4CA 4MAKA 2XMMA 2WSFC 5KFHA 3PW0A 3H20A 4YR3A 2COLA 3CDUA 4JI0F 3OVSA 2DB1A 1HNWF 1E6YB 5DLGA 3SMZA 1SL1A 3GR1A 4LF5F 2VQEF 3TAQA 2RRBA 4NLQA 4Y2MA 4LFBF 3QWUA 2JEFA 1P1TA 4NOHA 2IFXA 2CDQA 3KHHA 4OX6A 4F3MA 1SC6A 4JI7F 1Z4UA 2YNGB 2DNLA 4IH5A 3PEHA 1U49A 3NLCA 4A46A 1RT2A 3NS6A 2HRUA 2J7KA 2Y0SD 5U47A 3H5YA 1UKUA 2RJZA 4DL6A 3ENVA 2W9AA 2AV5A 4NRUA 3MUTP 1OIAA 4JYAF 1N5SA 3IG1B 1U45A 1M90T 1VMBA 5KFOA 2HQ3A 4C0OC 3OFEA 4RNMA 4IOCQ 2ZC4A 2LU2A 1JNZB 2BBEA 3G6VA 3FNNA 1OS5A 2P9EA 4YHHF 4JUZA 4RW4A 4Y3CA 4ED8A 2YNIA 4B3OA 3V6DB 2DIUA 1UVNA 4YOEA 3W3SA 3S01A 1O51A 3H25A 1IKVB 4IOBA 4B3OB 2M0GB 1OWXA 4ZVFA 1C0UB 1KONA 3KLGA 1K0TA 1ELOA 2CJQA 4TYAA 4RUCA 4KT0C 4EBCA 1QY7A 3HVTA 3MM9B 2CQCA 1IBLF 3HK2A 1SQEA 2Q6BA 5LJ5Y 1S1UB 2FUG9 4PQAA 4B9TA 3R5CA 4U9RA 3QZ8A 2XI3A 2ZD1A 3EZUA 4K5SA 1FRXA 3I9ZA 2R8IA 2X1GA 4F25A 2FHMA 4KO0B 4K4SA 5J2NA 1Q8LA 2QRRA 2RMLA 2ZZMA 4C2MA 4OX8A 3DRYA 5IQ6A