1FVQA

Solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
AREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the yeast copper transporter domain Ccc2a in the apo and Cu(I)-loaded states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 16
structure length 72
sequence length 72
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fvqA00
2XMUA 3I9ZA 2LDIA 2OFHX 4HH0A 4OJ1A 4A48A 1KVJA 3KKFA 3BN7A 5A6WA 4A4JA 1OSDA 1TL4A 2IYIA 2HFNA 2N7YA 1N5SA 2ROEA 4F67A 1YJUA 3QMQA 2AJ0A 1GXUA 4Y2IA 3F44A 2QLWA 3LO3A 2HFOA 2XMVA 1MWYA 4HL9A 1AW0A 1OQ6A 2RU9A 2W4CA 2EW9A 1K0VA 4OIXA 1YJVA 1YG0A 1FEEA 2LQBA 4OJ3A 4OJGA 1ULRA 3BB5A 3CJKB 3HHLD 3K7RA 2KT3A 2AP6A 1LQ9A 1N5QA 2GGPB 2N4CA 3KNGA 1JK9B 2GGPA 2K7KA 2ZDOA 4ZOSA 4DN9A 3HFKA 1SB6A 1FVSA 3GZ7A 3QGPA 3BM7A 1FD8A 4FNIA 2XMMA 4NPOA 1FESA 2BJEA 2BUNA 2GFFA 2BYCA 1R6YA 1RJJA 3BGUA 1YRXA 2BJDA 2RILA 2ROGA 3T9NA 1WD6A 2XMKA 4DL0C 1S6UA 2FIUA 1Q53A 3LGNA 5KAKA 2OP5A 1X7VA 2ZDPA 2K1RB 3FRYA 1VQYA 2G9OA 2HIQA 1JWWA 2KT2A 3TRGA 2ACYA 3VTIA 1TUVA 4NL5A 2RMLA 5A6PA 3HDSA 4EFAC 5IXUA 2HLUA 2ROPA 3FMBA 1TR0A 2W4PA 2VH7A 3FGVA 1APSA 2OD4A 1OPZA 1FE0A 2GA7A 1TL5A 2KKHA 2OMOA 3HHLA 3MCSA 2FB0A 3BR8A 3TNVA 1CPZA 3HHLB 4A47A 2OD6A 4HI2A 5B0GA 1P6TA 2QYCA 3DCAA 1CC8A 1Y3KA 1Q4RA 5B0FA 1YJTA 5B0CA 3E8OA 1AFIA 1OQ3A 1IUJA 5B09A 1QUPA 1CC7A 2PGCA 2K2PA 3KG0A 3DXSX 4OJHA 2XMTA 5K9FA 1S6OA 1Q8BA 2GO8A 1TZ0A 3CJKA 2KYZA 2HQIA 1GXTA 1XBWA 1N5VA 1MWZA 5B0AA 4HI1A 2XMWA 3BF4A 1Y0HA 2QIFA 3IWXA 4Y2KA 1KVIA 4Y2MA 1SQEA 2W4DA 1YJRA 5F0UA 2K1RA 3HF5A 4ZA1A 1P8GA 5B0BA 1FE4A 1W2IA 2HLTA 2OAUA 4QOTA 4HH1A 3MZIA 3WDOA 4DPOA 1X8DA 2OFGX 2XMJA 4FNHA 3BDEA 5B08A 2AJ1A 1KQKA 3HHLC 1V3ZA 1Y3JA 2Q3PA 5B0EA 3KG1A 2ASYA 3UDCA 2L3MA 3IWLA 1U7LA 4A46A 1FVQA 1AFJA 5T7LB 4U9RA 2FTRA 3TOQA 1X0PA 1Y9OA 3HX9A 2FHMA 2CRLA 4Q2MA 2N4DA 4YEAA 2K7JA 1URRA 5B0DA 2JDJA 2AW0A 2GV1A 4Q2LA 1VQSA 2QLXA 2PD1A 1N5TA 1SI9A 2LQ9A 2RSQA 2LXFA 2IFXA 2VV5A 3LGMA 2BBEA 5F0WA 5T7LA 4YDXA 1Q8LA 2OKQA 2GCFA 2IYGA
chains in the Genus database with same CATH superfamily
3EDQB 2I9SA 1JNZB 4RKUC 4K50A 2XMUA 2OTJS 2LDIA 4ZPTR 2GAGC 4PZVA 4IOCQ 4LUBA 4FYYB 5M2RA 1WTFA 3CCUS 2ZVSA 1TU0B 3P4UB 5FDLB 2DBBA 1WACA 4RBVA 3ZTPA 3WBZA 4QW8A 1HPZB 1KFDA 5AJ3F 3MPUB 2RNEA 1UFWA 1QY7A 1HQUB 2EK6A 3K5MA 2BR0A 1DHMA 2IM3A 1RT7B 4ALZA 4DPYA 3M2RA 1B0TA 2DNPA 3MEEA 1X4EA 5DETA 1VQKS 3QZ7A 5BXIA 1CULA 2VG7B 2CZ4A 5LJ5Y 4OHZA 4CNYA 1FVSA 3GZ7A 2C1EB 1WC4A 2H9ZA 3QT6A 3K59A 4F50A 1NDKA 1NM2A 1N34J 5A8RA 3IBCB 2JC0A 1FESA 2J5AA 2V67A 2ZVIA 5J1NA 5A0YA 2GFFA 3AA8A 4Q7AA 3CDEA 2N3OA 4XPEA 1U1QA 1R43A 5A0YB 3I4PA 4USUA 1SJFA 3NWGA 1FXDA 4NZ0A 2E7VA 3ZTOA 1M5PC 1HNXF 4PWDA 4K5RA 2OPRA 2FIUA 3HK2A 1Q53A 2V63A 1SVDA 2CJAA 2NSCA 1RAEB 2J8AA 1K1SA 2NUUG 3S01A 4UQGA 1LW2A 2DGQA 1UPPA 3FSXA 2VG6B 2G2YA 4KYZA 1EZZB 4PCQA 1BLUA 1TUGB 3HHDA 3NNAA 2VC1A 2IC3A 4CM2A 1HMVB 2IY5B 1Y5NB 3V6DA 2X51A 4DJBA 2GJFA 4LSNA 4MAKA 3TWZA 3HXMA 3ZZRA 1KR4A 2DXEA 2GA7A 4H4OA 3MR2A 3CXCR 1H6KX 2FPHX 5E3RA 2XI3A 3M6VA 4H4OB 5KFVA 2FLNA 5B0GA 3Q8VA 1RYSA 3V4IB 1JJ4A 4GVBA 2XZTB 3CO0P 1RT5A 2GIRA 2R7UA 4USHA 1RXOB 3SXLA 3G6ES 2ATCB 3SCJE 5B09A 3FDSA 2VODA 1XEZA 2EEYA 1FDBA 2K2PA 2QV6A 5E3QA 1FJGJ 5DGBA 4OYZA 2RB7A 3PW2A 5KFZA 2XULA 4IUFA 4LF9F 1M5HA 2QSWA 4ZP6A 4C2MA 4LRFA 2G0IA 4JI3J 4FP9A 2BM0A 5LMNJ 3TYTA 2Z8QA 4O44B 1XC9A 1WKLA 2VUGA 3MMBB 3NWRA 3O1LA 4IDKB 1FX2A 4WPAA 2MQPA 3QGHA 2L48A 4OMFG 3PX4A 4PYAA 2U1AA 2C2NA 1UJ4A 2K1RA 4PYDA 3OTOJ 3NKYA 2DGVA 4XK8C 4NLDA 1X4DA 4ZJLA 2VOPA 3N9UC 5IM0B 1TAUA 3SFUA 1JJ2R 3CD6S 2MEWA 4X4PA 1S9EB 2RF2A 2Z56B 3BDEA 3IBFB 4DPWA 3KYLA 3BJYA 1SKUB 2B9WA 4IRKA 3K5LA 1N88A 3KG1A 3B6BA 3M32B 3OR1B 4RWWA 5F8IA 4DV6J 1U4BA 2DIVA 4YN3B 4OYPA 1XNQF 1RACB 1U7LA 1FVQA 5DM7Q 2FTRA 4CLLA 1K73T 2FY1A 1IWGA 1HBNB 5GMEA 1RT4A 3JTPA 2YWHA 1RAJA 2AW0A 2JDJA 3ADAC 2B8PA 3W63A 3UD3P 1D9FA 4ZMMA 2UXDJ 3QIDA 2K06A 5AE3A 2ZUGA 1QVGR 2R7OA 2CPJA 3I4HX 1FKPA 2J0WA 4DDFA 3D0IE 4RW4B 2BJ8A 2X7IA 5D77A 1PJ6A 3FVYA 2YKOA 1WEZA 5FJ4A 2H5IB 2HRTA 4CQ1A 1HQUA 5HMYA 2WVCA 1L3VA 2IYIA 3AB4B 4M5NA 5ETVA 5C25A 4AQYJ 4J91A 4LR7A 2VICA 1V6HA 1DLOA 1WTBA 4Y2CA 3CCZA 1GXUA 5EWGA 1ROFA 3G86A 3T6JA 2KJWA 3RJMB 3B54A 2C3YA 1RADB 3TUIC 3VAFA 1DZ5A 3JSYA 5F9LA 4DR7J 2I38A 3MEKA 3BQ0A 2EKNA 2J0XA 4OJGA 2R8GA 2RE1A 4KGVB 4ZVPB 5LMNF 4HDHA 4G6VB 1U48A 1AYEA 3A4TA 4FPIA 5DLGA 4GKKJ 1D8ZA 1F9HA 2IIHA 2PDAA 3PRDA 2VC0A 4X66J 3MM7B 4DF4A 4LF9J 1GT8A 2V69A 4LIRA 1RHQB 2C2ZB 1DRZA 4CLTA 1FJGF 2MZSA 2D9PA 4UY8T 3MM8B 5IOLA 3RW6A 2FD2A 1NK8A 3LH2S 3BBCA 3IRXA 1T9VA 5DRKA 1MG7A 1XR6A 5IFMA 3GQCA 2BJEA 3T5JA 1SXLA 3DI6A 3F56A 2GO9A 4DX6A 2RQMA 4DR6F 3TAMA 3UFCX 1RJJA 3ILLA 1U6FA 4K4YA 1KC8T 5LT5A 1OS5A 5AT1B 1MMLA 3T3FA 1T7PA 1QM9A 1N52B 1HWLA 1UZDA 2CNKB 2PT0A 3NAHA 2VU5A 3LGNA 1CS4B 2LQ5A 2YWGA 4TLQA 4DL4A 2QC3A 5HATA 4DV5F 2QL5B 4DL2A 2XGQA 1ZTTA 2AF6A 4I2QB 2F8HA 2I5JB 2G9OA 2HIQA 2R7QA 4FYWB 4I1TA 4OYXA 5HBMA 2CA9A 4P73A 3M05A 3GP9A 2CZ9A 1SBRA 5IV4A 3M8RA 1CQNA 4CLUA 1TAQA 4M5IA 1TVRA 1TR0A 2I1RA 2MYFA 3HSZA 5DG9A 3W2WB 3CJ2A 3BO2A 2V4QA 3GV8B 3MCSA 1P27B 2R7RA 4ELTA 4NXNJ 5E3AA 2YNFB 3JS9A 5F3ZA 2O1PA 4RNFA 3HHLB 2ZJQQ 2APOA 4J7CA 4DSFA 4Y6IA 5F3TA 4O0NA 3ZC4A 1FDAA 1U1OA 2NXCA 3MAAB 3MM5B 4GVLA 3R6LB 4M94A 2WVBA 9ATCB 2CPYA 1TL3A 2ZNZA 3R7NB 4G3IA 1QUPA 3HHKA 3JTNA 4P71A 3DXSX 2HHUA 2CQ1A 1HBOA 5MAOA 3ILOA 3OJUA 1N4LA 4DI6A 2GO8A 2OEMA 5L1KA 1QTMA 4ID5A 4DFKA 1UW9A 1I51B 2CJBA 4USMA 3TJAA 3OSPA 1UW4A 5IQ6A 1C1CA 3MCOA 4DU7A 1M90T 2A2DA 4MFBB 4OYOA 1JLCB 4DZ6A 5E0OA 1O5JA 1SC4B 1YGYA 3HVWA 3EZOA 3KXDA 1VISA 3RBXA 1S1XB 3DKDA 1W2BR 3UWTA 2P8IA 5A8RB 3DLGA 2YBVA 1SH2A 4NE9C 2XS5A 1H7WA 1HHQA 1WG1A 2JSXA 4M5GA 2W9CB 5J2QB 1H2VZ 1R89A 1XJWB 2GQ2A 2E7XA 4PABA 3UQSA 2YKNA 2DR8A 2MTLA 3CB4A 4RW8B 5C5JA 2XQCA 3PYEA 6FDRA 4X4TA 4YEAA 2R7WA 4DR3F 1KLMA 4O3SA 3DLLQ 3GCXP 2MY8A 4HACA 4NEYA 1FNXH 1IR2A 4OZ3A 1RE1B 2XZDB 4MK7A 5I3UA 1CEZA 2QLBB 4UTGA 4X4OA 4RNOA 4KGMA 1HPZA 2ALYB 3IO1A 3TVYA 2DY1A 4DPXA 1UA0A 1WNEA 4B3RJ 2DTJA 4ED4A 1WI6A 1FFSB 3AFGA 3I0RA 2ACMA 2GCFA 2ZOGA 5G0RA 3DRRB 3TVZA 2X3GA 2VD3A 3HSDA 3OT9A 3EX7B 2FLPA 3CCMS 2HVHA 1S1VA 4OJ1A 1C0TB 3DRRA 4RX6A 3LP2B 2G2OA 3AOCA 1OJ4A 4DX5A 2AX0A 5KG0A 5E41A 4C8OA 1QTNB 3GIRA 5B7WA 2GQCA 3IG1A 4OZ1A 4FZVA 4UUWA 4Y2IA 1GMWD 1W25A 3BGOP 1KD1T 4F4WA 1HQEB 4F04B 1GTHA 1FA0A 1RBOB 3FZ2A 4Q0BB 4V1Ak 4BWJA 1RHJB 1NSKL 4XDDA 3OL6A 2UV8A 4RU9A 2HHHF 2XNRA 4ZPCA 4K4XA 2B6AB 3K7RA 3NEKA 4M5MA 4USVA 2ZH2A 4NMXA 4KV8B 2MZ1A 2ZDOA 2V8PA 3ZNUA 2MLXA 4E98A 4K2XA 4RW7A 4J9MA 2NLWA 1T02A 4OYBA 3HHEA 2WZ1A 3HKZD 5GAEI 1S6PB 3FBEA 3B78A 3PY8A 1H72C 3VGSA 1YJWS 1KTVA 4C0BA 1RWOB 5F8GA 1FJCA 2JH3A 3GONA 1VJQA 2XI2A 2ZFHA 4HTIA 1N32F 2CNLB 1XMBA 1DQ9A 2ZUAA 3U1NA 3US5A 2ERRA 1Q81T 1RU2A 1HFEL 1OO0B 1RTJB 2J9DA 2L9DA 5CYQA 3EDRB 1F2HA 1RWMB 4OV6A 4DR3J 1T0TV 1AT1B 3DHWC 4W98A 2P9CA 2J6UA 1JWWA 2IVFB 3TR5A 1TUVA 3W5YA 3UE2A 5HN0A 2RMLA 3QZ8A 2DYAA 1JKHB 3ET6B 1QAXA 5CZVA 3U27A 3ZNJ1 4RNHA 4YB1P 4QWDA 1XWLA 4EI2A 1XN9A 1H38A 2RDIA 4IFVA 1PBUA 2VH7A 1VK8A 3QJPA 2D3UA 2KTQA 1APSA 2Z4PA 5MLCV 4DV4F 2HG4A 3PJ9A 3U02A 3TAPA 5EHHA 2CPXA 3MOJB 1PILA 2CADA 2FQQB 2IM1A 2OJ3A 2ZM6F 5HBMB 1HQ2A 4P6QA 2WW8A 1WC6A 1RAAB 1IM4A 4I69A 1N56A 2IBKA 3OFEA 5B0CA 1C1BB 1S1UA 1RUSA 2BMBA 2W1BA 5EX3A 3NNCA 2XSJA 3C6TA 3A8IA 1C4AA 2P9GA 3W9HA 3W5XA 3KG0A 1HIYA 2W2MP 2YWEA 3E3XA 4JI4F 2W2PP 3W8GA 5HVGA 1LWXA 4JI8J 1V3SA 4P2MA 3IR7B 3M30A 2XY6A 1ELOA 4ZVGA 3P96A 5SZTA 4ENOA 1GXTA 1IVZA 3KLVA 2CNNB 4PG7A 2BEFA 2QIFA 4K4UA 2VBWA 4B08A 1O0PA 2YQ1A 1NHUA 3SV3A 2V50A 4C7QA 1FFGB 2CQHA 4H4MA 4CLFA 4URGA 1NK7A 4FXWA 4QWBA 3H42A 5LSLA 2AGQA 5JVGQ 1NPPA 3SBMA 1OWXA 1Q8IA 3GV5B 3OHAA 3TP2A 4LRCA 1FRHA 2NCKL 1PO6A 1H2UX 2A10A 4DLEA 1SKRA 1J5OA 3J7YI 3JSBA 1ZOTA 2HBRB 3LGHA 4QJVA 4C6AA 4EU0A 4NLGA 4NXNF 2XTJP 5GADI 2NQPA 1NB2A 1NZ8A 3SQGB 1CQMA 1HBMB 1RP5A 2EFQA 1S1TA 3MMJA 3Q24A 1XIQA 2E66A 4V19J 2ZZMA 1AFJA 2E5IA 2KI2A 4ZS6A 2ZH3A 2D41A 3TZYA 2G0JA 3HX9A 4X62J 2HMIB 2VDIA 3MECA 2N4DA 2BKNA 3H8YA 3FEZA 3V6DB 1S1UB 5DQHA 2FJEB 2NYIA 3JQJA 3QIPA 1B70B 2LQ9A 2MY7A 2GS8A 4DV5J 4ECYA 1RTJA 3R2DJ 4UOHA 4USKA 5A8WB 4NCGA 4OI4A 2W7PA 3VAJA 2MB0B 3LP1B 1E6VA 4DSLA 3IM8A 1Z2ZA 3I0RB 1R6VA 2BX6A 5L8RC 3T5HA 2WVEA 4WIQA 3KUGA 2AEFA 1MMNA 1XR5A 5KG2A 1L3UA 3HT3A 1RWXB 2BJ7A 4X2BA 2CIMA 2IAJB 4ED7A 2XWYA 3R1LA 3DYAA 1R0AB 3W5ZA 4DMZA 2XS2A 2QLWA 3LO3A 3CMES 1AW0A 4JI7J 3RR7A 2GHWA 1OPIA 3PKYA 2PSZA 3PRBA 2HNYA 1IWAA 5H9EK 4U7UD 1IKYA 3R27A 4M8LA 4RW9A 5HROB 3GIMA 4LJMA 3G4SS 2HNDA 3UCUP 3EZ5A 3D6FB 5F41A 3GFHA 1IR1A 3BGFA 2BACA 4MIBA 8ATCB 3BM7A 2FJWA 3IG1B 4B3TJ 2PC6A 4FNIA 5BR8J 3PYGA 2DNRA 2H3EB 2LCWA 3AJ2A 4PR6A 3WZ0A 1S9EA 2RF2B 4U6PA 3LWMA 2LXUA 4PUOA 3DMJA 1VQMS 1RWNB 1VRUA 2CPFA 1CG2A 3OPKA 4CYUB 5KFQA 1HWUA 2ILYA 2EBEA 3E01A 4KGXB 3AD8C 4G65A 1DARA 2E5JA 1NB7A 2HHQA 1IBKF 1RA7A 1HWKA 1S9GB 4N41A 5HLFB 4JI6J 2QLJB 2C22A 2PI5A 2CQIA 3KG4A 1Y11A 1R8CA 1VQYA 2AYEA 2KN4A 2OIHA 2UP1A 1RTIB 5E7OB 1AA1B 5F9NA 1NKEA 2DNMA 3ITHB 1VIXA 3SEOA 1EJ7L 5LSOA 1OY9A 5RUBA 1T9WA 3OJSA 3DRSB 3M2VA 1SIWB 4MKVA 4Q44A 1EQ0A 3PFEA 5AJ3J 3NRBA 3CDWA 1FEHA 1OY6A 3HDSA 3MMCA 4I6WA 4KY3A 2DO4A 4WE1A 4P52A 3RBDA 4L76A 5DLFA 1XNQJ 3OTEA 2XLKA 4AUKA 1FE0A 3C6TB 3QLHB 3DU6A 3UD5A 2HYIB 3S1TA 3JAMU 2CJKA 3CC7S 1SIZA 1N5YB 4A47A 1S0VA 3B4MA 3GIKA 1VQNS 3JB9k 3UVJA 4RUAA 2O67A 1WC1A 2LMIA 4PG8A 3GIIA 1TVRB 1WI8A 1IM6A 2VPWB 4CH7A 4QR0A 3NGRA 3WX4A 3BO4A 3N01A 4F25A 3ONQA 1UEUA 3OXGA 3M8ZA 2FY8A 1NHVA 2XMTA 2DPJA 1HW8A 1R8HA 4DR7F 3IM9A 3C46A 5F8NA 2YX7A 2HQIA 1QUVA 2ZEJA 4X64F 5JJBA 2L08A 2ADCA 4ZLNA 3H0PA 4NZ7A 5BYRA 3OUYA 5FLXY 2XYHB 2R42A 1FF2A 1HBOB 4C3KA 1SQEA 4J37A 1WG5A 3TJ8A 3W62A 2VQEJ 2DXFA 4ERDA 4X4NA 1G3OA 1NJYA 1WHYA 2R2UA 2BXJA 1FJEB 3M2RB 3ITHA 4RUBA 2EPIA 3QBCA 5B08A 2DH8A 1C1CB 1UWBB 3HVTA 3QAEA 3Q8UA 1M5SA 2NXJA 4FKYA 4YOEA 2P5VA 3EJMA 3NCPA 4ZK7M 3KLEA 1Y10A 1PGZA 1O51A 1YJNS 3LA0A 2M70A 3W61A 3FEYB 2NZ4A 4P75A 5CYJA 1YIJS 1SJQA 1FXRA 2Z2LA 1NSAA 1X0PA 3TOQA 1VRUB 4EK2A 1UKUA 2LP4A 5K20B 3HPOA 4NLQA 1S6QA 1ZPWX 2WOMB 1JLBB 3R5AA 3G9CA 2DJWA 4TY8B 3RU0A 3ULHA 5HJYA 3DLKA 1LK7A 2W8LA 4ED3A 4LF8J 1Q16B 5DDPC 2JVOA 1YBTA 4PEOA 2BBEA 4LR8A 3VAIA 5CCLA 1T94A 2B43A 3ZZYA 3BYRA 3AXMA 2IYGA 1HHSA 3O5TB 4EYHB 3HI9A 4TNOA 4Y0FA 1EX8A 3H59A 1NJWA 1CJTA 3D67A 3W64A 4J9RA 2HBYB 1HNIB 2ZHOA 4B9MA 2AYBA 3H4DA 2PEHA 2LECA 2O5DA 5CD4H 2FYXA 4F0HA 1FXLA 3TEHB 1MWYA 3MPWA 3WC2A 3JYTB 2MXYA 2YNIB 1FEEA 2E44A 5KFIA 4UZBA 1SV5B 1NK9A 1YX2A 1RWVB 2AP6A 4RW9B 1N5QA 2ASJA 1KTQA 2KB2A 3AA9A 3K2YA 5CA5A 4PG4A 3L7OA 2HQGA 1IR0A 4DN9A 3RAQA 2DPIA 1KBRA 2N7CA 1FD8A 1RKIA 4OX8A 4XAKA 1LW0B 4K59A 1TUWA 4JI5F 1C2PA 2GVDA 1LK5A 2OLWA 3UN5A 2C42A 3DLGB 4TVAB 2MGZB 1XMOF 2KRBA 2LDYA 3ZTSA 4X65F 2FC8A 3M8QA 1KEKA 1SJ3P 3C16B 1U1LA 1TV6A 3I6PA 3BBFA 1S7IA 4AFFA 1Y00A 5H9FK 3I9V9 3UO0A 3G8QA 3OTBA 4LF2A 1P1TA 2WONB 2UZAA 4CO2A 2DR9A 4F3QA 2NPIA 4ES3A 4PG5A 1HMVA 4IKAA 4WXOA 4RLEA 3W9JA 4W90B 1NBEB 2ZKTA 2NPFA 1F60B 3OR2B 3EWGA 2QA4S 2CG8A 2NXUA 2VFRA 5D0RA 4HVZA 2QJ3A 1GMVA 5I4MA 2M52A 3FBFA 1OPZA 5ETTA 3EE3A 2E9RX 5J2MB 3EGNA 2E9ZA 5KFYA 4RNMA 4DF8A 4RPFA 2KO1A 3QO9B 5L1IA 5U47A 4ECTA 2C2MB 4J90A 4NA1A 4EEYA 2F4VJ 3BSAA 3MM9A 1IJFB 3MAAA 3MM5A 1QSLA 1OQ3A 4TLRA 4ZVTB 3ENVA 3I0SA 5DQGA 4ECZA 4B9LA 4PKDB 3CC2S 1REVB 5KFXA 1RQ0A 2WSFC 2OPSB 2G0CA 3CJTA 2AYMA 4DLGA 1H98A 3NS6A 3T1YJ 2GJIA 3TAQA 2UUBJ 5G4DA 1HNVB 2B7BB 1J5EJ 2E5LF 4DV3J 2OEJA 3BF4A 3DNCA 4F0MA 2FGCA 4TXSA 1GX5A 4MMOA 2DEJA 1L5UA 4P10A 2IA6A 3TARA 1RYRA 1LNQA 2FVSA 4Y65A 2CWXA 4DQQA 4RBUA 3I82A 3SYZA 5F8LA 5D4LA 3ZZUA 3TA0A 4WFNQ 4Z7CA 4KAIA 4WKYA 3QQCD 2HQFA 3HHLC 5L39A 4DR5F 5B0EA 2MDAA 4IOAQ 1CULB 1WWHA 5LXYA 3H7HB 3BKTA 2Z2MA 5LXRA 4IRDA 2Y9HA 1O8BA 3IRXB 3OBIA 1NJZA 3OVAA 1HNZJ 4L72B 3DDNA 2MGZA 2F63A 1IBLJ 2WB1D 1DAXA 3SMZA 2DR7A 4GKJF 3H2LA 1DJ0A 4ECRA 3M1VA 4J9LA 3ET6A 1D9AA 3M6UA 4ES1A 2A18A 4ZIWA 4JI1F 1FNMA 2DXDA 2DNYA 3A3PB 3N4WA 4Q5VA 5FLXU 4LF4J 1U0HA 2UVWA 4WK3A 1EP4A 3NOGA 2CPIA 2HQDA 3CCJS 2BZ2A 3M8PA 2GMJA 5KT6A 4M1KA 1JX4A 4ZPVR 1WG4A 4C8ZA 4K0KJ 4KRWA 4Y3CA 3KJVB 1H2TZ 5C25B 2FC9A 2F8MA 3PW4A 2ZZTA 2YVSA 1S79A 3HT0A 3M9MB 2ZD1A 4NYZA 2CVEA 1HNIA 1H3DA 2RKIA 4WU2A 3UN2A 1PC4A 3MGJA 2G1DA 1S4FA 1WDDA 2LEPA 2OPPA 1J2VA 3CDBA 1S76D 1K0TA 1RK8A 3A13A 1SC1B 3DLEA 5FIIA 3ZO7A 4K4SA 2PA8D 3IBWA 3IAM9 2W24A 3OVBA 1T3OA 2BJ9A 2RQKA 2LQBA 3CCRS 5A76A 2YWFA 2B51A 2YKQA 4L3KA 3WHIA 1VC0A 2UUBF 4I6AA 3MM7A 3T1YF 3PX0A 4P7TA 4DR1J 1N48A 2B4PA 3HFKA 3ILJA 3MMBA 2W2OP 3QGPA 4IDKA 4LRBA 5ETSA 1R7IA 3Q22A 4ES2A 2EK1A 3M8YA 1FDDA 1VHIA 1MN7A 3QT8A 4Y34A 5KFNA 4RZRA 4QCLA 2IM2A 2ATLA 4LFCF 4M5KA 4ZP9A 2P6TA 2YNGA 4ZPBA 2F7VA 1EB0A 2V94A 1FTRA 3AQOA 1PCAA 3GFYA 4R25A 4ZVOB 3T9NA 4LSLA 5KAKA 2AU0A 4DQIA 5G0RB 3HULA 1FHTA 2ZDPA 5LMUF 3Q8QB 4RWXA 2K1RB 2HMIA 3S7RA 2C2OB 3NL0A 2LXIA 4NLRA 2FZCB 2NSBA 4A8OA 3CJSA 1UMJA 1H0HB 1XK8A 1HNWJ 2G1HA 4NL5A 1S6QB 2WOMA 3W1YC 1PBAA 2ZC3A 3H2VE 4LSNB 2J6TA 2IRYA 5EWEA 5HVHA 1UJ6A 5K8MA 2KHDA 2E7WA 3ISZA 5EUHA 2DHHA 2RAQA 4D3HA 3LP0B 2I2YA 4JYAF 2FB0A 1Q5VA 5J1PA 2AT1B 3PCOB 3MR3A 4CO1A 1U09A 1X4CA 2ZH9A 4DQRA 3NS5A 3GLJA 3I5CA 4EUVA 3PR5B 1RDRA 3PM9A 1NK5A 3K5OA 3D0GE 4W92B 4DG1B 2YKMA 3M8PB 5GAGI 1N0VC 4LT6A 4DSEA 4JI5J 4N56A 5K8NA 4MKYA 3MCMA 1F9EB 4CDIA 1VQLS 2J7UA 1IJEB 2ZOMA 3D28A 2F4FA 4QPTA 4TY9A 1N33F 5HVFA 1I6JA 3J7AN 3FKBA 3TANA 3RB3A 4G1QA 7FD1A 5KFSA 2B9EA 3GPAA 3ENWA 1S99A 5B0AA 2XMWA 1F9FA 2PN6A 2RQ4A 4DPTA 2YNHB 2HW3A 1YSJA 4ZA1A 3HF5A 3MTKA 2Y1JA 2E5HA 3MF5A 4LVOP 4QU7A 5KFRA 1FE4A 1GFWB 1W2IA 2OAUA 2RIJA 3IGNA 5C24B 5LL6d 3MURP 2VQFJ 2I5JA 3W9IA 2XLJA 2W8KA 4ECXA 3FQLA 1GH8A 1A7GE 1V3ZA 1BD6A 1Y3JA 3D1QA 4NASA 4OZNA 2MQQA 2FJAB 3B4DA 3VAHA 4M63A 4ZP8A 1HR0F 2YH0A 4JP8A 4BCAA 4CO3A 4B3TF 2JOQA 3GYNA 5BYQA 1JB0C 1FRIA 3M8WA 1RHKB 2KXNB 3OL8A 1VQ5S 2YKAA 4ITSA 1QAIA 3DRSA 4YB5A 4TU8A 4F02A 4DV1F 2DY9A 1S10A 1RCOB 4DR4F 2WHOA 3ZZPA 4PQAA 2JEJA 2GAHC 3MM6B 5K14A 2G4BA 2C2DA 4U7UK 4JI0F 3PZPA 2KG0A 4OZ2A 4EYIB 2YWKA 1JLBA 4OX7A 2LEBA 1REGX 1S1VB 1I94F 4IH7A 1CJVB 3FCHA 2IPOB 1KVJA 2OMLA 5IWAF 4NYPA 1OSDA 3H90A 3LTOA 4C8YA 2KVQE 4ETZA 2DNLA 4IO1A 4JYAJ 2EFOA 5KTQA 5KT5A 2AJ0A 1FK9B 4YUDA 2OSQA 5CZXA 3GR0A 3KJFB 2KFYA 1X5TA 5KFPA 1NH7A 2HSEB 1OQ6A 2RU9A 5HQ8A 3L3CA 2R8JA 2J0SD 4Q0BA 1LEOA 1YKWA 2CFXA 2K3KA 3AOAA 4OIXA 1MROA 1YJVA 3TZZA 5KFGA 2XLIA 3PIPQ 1F2GA 1ULRA 3EUNA 1Q8KA 2RDJA 2QMUB 3H5XA 1Y4ZB 4DQSA 1K44A 2GGPB 2N4CA 5DZ7A 2ZBQA 5LMUJ 1FRLA 3QSYB 2C2KB 5KG6A 2DKOB 2QA4G 4X62F 3VALA 2Y8WA 5FD1A 3Q8RB 2ZHAA 1NKBA 4J9QA 1VQ6S 4IH6A 4ZVQB 5BJRA 3G6VA 1NDCA 4ZN1A 3MTJA 2HHVA 2AGPA 3PYDA 5ADZA 3CULA 4WF9Q 2EI5A 1I94J 3UDEA 2F3JA 4JV2A 2BKPA 1N54B 4FVCA 5ETNA 1UWBA 3BGUA 4JV0A 2M9KA 2ROGA 2B3TB 1JXVA 1KFSA 5A8WA 1RHRB 2P6SA 3OR1A 3LP1A 2MQNA 4W4MA 5C24A 2FUG9 3LAMA 5HSPA 1KKHA 2FVRA 1X7VA 1B64A 4MJKA 5THWA 4ZHRA 4B3OA 1WC0A 3FC9A 2HZCA 3C2PA 1VQ4S 2J7KA 2V34A 2E1MC 3EXYA 3K57A 3KLGA 1OSCA 4DHVA 4TU7A 2V68A 3KTQA 2XEXA 2N82B 2JHEA 1S1TB 3DGPB 5M2UA 1WEYA 3KK2B 4A8QA 1K9MT 3FGVA 4I67A 3PXGa 3MMCB 2HKEA 3NAIA 1C0UA 1GK8A 1KONA 1H74A 4LBPA 2VJVA 5ETKA 2GQQA 4PPZA 4IRCA 4UY85 2WAQD 2V2VA 3LQVA 3FUYA 4UOGA 1VBYA 2OO4A 2QMXA 2M0GB 3EPGA 4HI2A 1HKAA 1ZS6A 1P6TA 4ED0A 4F8RA 4YY3J 1NK4A 2VBYA 1M1HA 3WC0A 3J7ZT 1FKAF 1C1BA 1FJ7A 4LF8F 2Z58B 2BQ3A 8RUCA 4DV4J 4ZPDA 4KV8A 2X1FA 5E5NA 3JXOA 2UUCJ 1Q8BA 3QO9A 3MUMP 1FDNA 3DMJB 3RBZA 3T41A 3MAHA 1SV5A 1U6ZA 3BSOA 1R8BA 5I42B 2YNIA 3PX6A 5ETMA 1KNZA 3CMAS 3N6LA 3POTA 5I42A 1VRTB 4H4KA 1BC6A 2GX8A 4OI2A 1UTAA 5F0UA 1X5SA 2W4DA 3V6HA 4NLTA 1N6QB 1YRUA 4JI7F 1JLQA 2BANB 3JTOA 3CD0A 4KFBB 4ZDNA 1UEKA 3BGLA 1N32J 1AUSL 4HEA9 3F73A 4ECUA 1B7YB 5CYQB 2OFGX 1BQMA 3CCTA 1JLFB 1T9YA 4PG6A 3UW1A 2YX4A 2Z30B 3QNWB 1B7FA 3EGVA 4HTJA 4WFBQ 1Q7YT 1TFYA 1BQXA 1KRPA 1OYEA 4IQXA 3MXHP 2ZE2A 4WU3A 5GAHI 2R8HA 1DQAA 1EKSA 2EXUA 3IWLA 4LBIA 4A8XA 3NLCA 5KFKA 2AQ4A 4I2QA 4IFVB 2IMWP 4DR2J 2A0FB 4CLWA 1Q86T 2MHEA 3GSDA 2QA2A 1URRA 2YXLA 3W66A 4IO9Q 2IM0A 4ECWA 1VQSA 2Y0SD 4DQPA 1TL7B 2HHHJ 3PKMA 1R8PA 4X84A 1S48A 3ZXWA 5LM7E 2FLLA 1KN6A 3PDNA 2ZJPQ 3NCRA 4OFZA 1RISA 3G96A 3Q2TC 4LFCJ 1RT7A 4K7QA 4FN5A 2F4VF 4I56A 2OFHX 2ZKUA 2WB4A 1J27A 3O44A 1TTHB 4CLZA 3ETOA 3PHTA 2BJ3A 2CQDA 2BE2A 4MIWA 2KZMA 2CQ3A 4DR1F 4TU9A 3D0HE 3V6KA 1KOOA 4B9TA 3LALA 3CE8A 4LQ3A 1SC3B 3IMQJ 2C3UA 2IA0A 2A2CA 4M5LA 1K0VA 2C3OA 2AZ3A 3JYTA 3HJFA 4C0HA 1LXNA 3EGWB 3TX0A 2RKIB 2KT3A 5KFJA 1CLFA 2HK3A 3M6WA 3FRZA 2HQ3A 4P72A 1MSWD 2HNDB 4RUCA 2R2TA 2K7KA 1E6YA 3PRVA 1PJ5A 3G6YA 1N36J 4JI8F 4NMLA 2SXLA 4JI4J 1U24A 3NXZA 1T9TA 1U0SA 5HAOA 5AE2A 1ZYQA 4QWEA 1VRQC 2CQ2A 2V8VA 2V4JA 3W2VB 2Q66A 5HO4A 1SPBP 2B5JB 1NNDA 3IR6B 5CYMA 3RRHA 3R7SB 2HVZA 2NUHA 2YWWA 3JQMA 3AY0A 4PXCA 1WOPA 2MJUA 4NLXA 2JEGA 1M5VC 2MKHA 4DUTA 2MHNA 3THTA 3O8WA 4TQRA 2LYVA 2NYHA 4BBYA 2PMZD 1QD1A 1U1NA 1ZTWA 1KLMB 2YTCA 3QFWA 2QA1A 1EARA 4DSIA 2GMHA 3NBPA 1U8SA 3F41A 3ICLA 2ZOFA 3KUHA 1HBUA 5C7PA 4CLYA 2DR5A 4C0OC 2JEIA 3TW0A 4XPCA 1ZPVA 3SCKE 4DX7A 2VFVA 2B7CB 3CEDA 2GW8A 3CJ5A 3G6XA 1A9NB 2XYGB 3QRQA 2MLZA 3EYZA 3J7A1 4JI2J 2DGWA 2MZQA 1XMQJ 1QVFR 4FXDA 4C4WA 2A6MA 1VGYA 1TK8A 3M9OB 4URSA 5K5MA 3OQ2A 1EETB 2RRAA 3T5LA 2LU1A 1YHQS 3CW2C 4RL1A 3NP5A 1Z2LA 1RA6A 1GMWA 3PG9A 4HDGA 2JEFA 3R5GA 2EFPA 1TKZA 1F6TA 5IV3A 4CWBA 2I6WA 4H4KC 3VZIA 4BLGA 4DV3F 1J5EF 2VFUA 2OPQA 5K9FA 3KJNB 1RTZA 1WEXA 3FFIB 2H4YB 1P9QC 4CNZA 5KG7A 4HHUA 4FKXA 1D1UA 4EZ9A 1G2EA 4YMEA 5C2GA 3DRPA 1ICEB 1Q5YA 2WVFA 4FBTA 2MPUA 3BZQA 4HI1A 4FF3A 1T3NA 1EIYB 4Y2KA 4OHYA 4OV1A 1RAOA 2Q6BA 1ITPA 1U02A 2WONA 3DYAB 4YS2A 3J80U 3R5JB 4OZJA 2HVIA 3JSRA 1FNOA 1Z4UA 4F0KA 3Q0AA 4MYUA 4DCPB 3C16A 2BV3A 4K2JA 3PVXA 3DLHA 4DR6J 2Q3PA 3P8BB 3SIPB 1T03A 2QYGA 5DJBA 2AHOB 3L95X 3N79A 4FYXB 2HWHA 5DZ6A 3ZZOA 3LWLA 3QT7A 3PFOA 1NUEA 5DDQC 4PQUB 3DOKB 2Q43A 3T6BA 1CJUB 3TQ1A 2HBQB 4B3RF 2ZBPA 2FHMA 2CRLA 3QYYA 4DCJB 2AWZA 4MT1A 3EICA 2RQCA 5DO2A 3A8KA 5KFBA 1KHWA 2F9DA 2HHPA 4Z2XA 2W9AA 3GYGA 2RDDA 4WK1A 2LQJA 2X1BA 4EO6A 4V19X 5IT9Y 1BQNA 1X9MA 1REVA 3GJSB 7AT1B 4OZ5A 3R5DA 4CI0B 4LF5J 4O4GA 2VKZG 3RGIA 1HD0A 2XMAA 1D8YA 1UA1A 1HW9A 4P74A 2W25A 1UVLA 3BPSP 2WRMA 4BC7A 1CJTB 2MSSA 3CCQS 3L4BC 1QDUB 1AB8A 2KVIA 4I7FB 3U1MA 2HFNA 4KO0A 1N5SA 4F26A 4YDDB 2VA3A 3A8EA 2OGUA 1BWEA 3MEGA 2C2RA 1IXKA 2BE7D 2F8EX 1KVKA 2HFOA 3C6UB 4HL9A 1E6YB 5CCMA 1NMEB 5DQIA 3MMAA 6AT1B 4QYZK 5KT3A 3KHRA 5AXNA 2MZJA 1M1GA 3I5AA 3M30B 4M5DB 2HHWA 2JNJA 3RW7A 3HZGA 1LQ9A 1VI7A 3KNGA 4HHHA 4R8UA 3V81B 2V4RA 4BDPA 1SQFA 2V2KA 2BE2B 4ZVEA 4I68A 4Z7YA 3DOKA 3ELHA 5HMWA 3CCWA 2VFSA 2MZTA 2XMMA 4FS1A 4FYVB 4TYAA 3BREA 3UI3A 4AYBD 4ZJOA 1EHWA 2QRRA 5IT4A 1LV5A 2E1CA 2OSRA 4CO5A 2R2RA 1S49A 1F3FA 4USJC 2RILA 4LRDA 1NCLA 3I5BA 2CPDA 3IS9A 3SQGA 2EFGA 2LFVA 3DLKB 2QN6B 4KT0C 5E3PA 3HD2A 3BR9A 5C42B 3PIOQ 1NK6A 2CG4A 1RLCL 1U2RA 4DV2F 2OHDA 5EGYA 4BS2A 2HFVA 3GIJA 3TZXA 1LFPA 1ZBTA 5GMDA 3VQTA 3TRGA 5A2QU 4A8KA 4TYBA 4LFBJ 3ENAA 2OUGA 1ZM4A 4DFJA 3N0VA 5A6PA 1LWEA 1PYTA 4CRJA 1NKCA 1UVKA 5CHCB 2J8SA 3I31A 1MN9A 1PIEA 1T95A 3IFEA 1YWXA 2W9BB 3C6UA 3TA1A 2XY5A 2POKA 5A2QY 5F8JA 3MPVA 2OMOA 4C8NA 4J9UE 3SI8A 4GC7A 3PV8A 1S77D 3LP2A 3EGZA 2BJ1A 3BH7B 1F3VA 5I3PA 2D69A 3D68A 1Y3KA 1EETA 3KK2A 4LSZB 2DH9A 1JKHA 3P5TL 5HMXA 2CZVC 2BANA 2YNFA 1HARA 2PGCA 1R8AA 2CQ4A 2R8KA 4K8RA 2MKKA 1S4EA 4LREA 1KDNA 4J5OA 1R31A 1T11A 1MMDA 2DNHA 3PEJA 2XHCA 4WP9A 4ILLA 4GKKF 1VC5A 1KWMA 1HI8A 1Y5IB 2XSFA 2QG9B 4Y2MA 4RW8A 2XSJB 2IJNA 5CH7B 5CD4A 1FKOB 1RWUA 1D9DA 2RT3A 3MR6A 1X5OA 4F3OA 3NMRA 4GRSA 1FKOA 4DPOA 4HH1A 3PR4A 1URNA 1HI0P 1P1LA 4ED6A 2AJ1A 2AGOA 3DC2A 3A3NB 1CVJA 2RD5C 2GC8A 1UFKA 2B4OA 4KSEB 3V81A 1Q82T 3W2VA 4AL6A 4DUYJ 3J7Z5 3SZ2A 2CQPA 2ILZA 1X0FA 1PG5B 2HS3A 4GMKA 3H4BA 2JFKA 5KFFA 2QFIA 1RTDB 2LEAA 5T7LB 3THVA 4OHWA 1U1KA 2DVIA 3R6GB 2EC0A 1V3RA 3AQPA 3ISND 2DNKA 2AJ2A 4OI6A 2VPYB 2HWIA 5J1EA 4MTPA 3DOLA 1RWKB 2R2SA 1VS3A 3AD9C 4NLWA 2VV5A 3M4XA 3C15A 4C9DA 4JI6F 1HBUB 5F8MA 4NLUA 2QT7A 4O0IA 2KDOA 4DFPA 1FO1A 3IC1A 1R0AA 3W65A 3HO1A 2OKQA 3KDOA 4NLSA 3TI0A 3CIZA 2C3PA 3CPWR 3BKFA 3SCLE 2BQRA 2Y1LB 3I9ZA 1LXJA 1OYDA 3MMAB 4DV6F 2E29A 3N5FA 2FDNA 1FRXA 1RHMB 2EVZA 3HZEA 2N7YA 4O4RA 4ZVUB 2EG1A 3RRKA 3SSRA 5BR8F 4J9VA 3GILA 4LRAA 4F4AA 3D5MA 2JLEA 3DLEB 1QJHA 5HQLA 3K0JA 2VG7A 5IT0A 4KPCA 2NREA 3EPIA 4I2PA 1U1MA 4ZVFA 5KFLA 1B0PA 3F0NA 3BB5A 2JX2A 3OTDA 2C2EA 3RB0A 1MROB 1VC6A 5IT9U 4ECQA 4ATNA 2EFVA 3NG8A 3QATA 4WTOB 1VRTA 4AL7A 5FDLA 1X4HA 3AJDA 4ZCIA 4K4TA 1T8EA 5KFUA 1VHFA 1NDLA 1S9GA 1U26A 2FHOB 2HRUA 4FXVA 4PWUA 4WIIA 2PFDA 2JJ4D 1WORA 1J5OB 2PI4A 1VLOA 1GTEA 2YPYA 4DFMA 2V0NA 1BQMB 4MIAA 4WFZA 3C15B 3BH6B 4M5DA 1K1QA 2G2ZA 2XHWA 1WC3A 2I0XA 1FT8A 1S6UA 1X4AA 3KLEB 4I0WA 3VAKA 3N5BA 1YZ6A 1T03B 3MECB 3MHYA 3VR1A 1HI1A 2GVZA 4ED5A 5F8HA 1QSSA 2V9WA 2C3MA 4ELUA 4F4ZA 1IKVA 2UVVA 4NZ6A 1JLAA 4HT5A 5D6GA 3M32A 2ASDA 3NY0A 2KL8A 4LFBF 1XERA 3OHBA 1FRMA 2CQ0A 2HNZB 1VMBA 3R5BA 2VHGA 3DLBA 4ZP7A 2OD4A 1LWFB 3KLIB 1RT4B 4LF7J 2HS4A 4J9KA 4F36A 3QJLA 3OLBA 3FCWA 3TEGA 4DG1A 1PKUA 3S8SA 1XTZA 2B4UA 2DISA 1WHVA 1WKJA 2DGUA 7FDRA 5KFEA 4WFAQ 4RW4A 1RAIB 1RT2A 1LWCB 1XMQF 1TL3B 1VQOS 1CC7A 3CJ4A 3O3LA 2XM3A 1L3SA 1RT1A 1RTHB 3A3OB 2ZH4A 2FHJD 4ECSA 1F0XA 4L3NA 1N5YA 2J0QD 1WJ9A 5IC6B 3KLHB 1XBWA 4G1QB 3I32A 4YP3A 1N5VA 5GAEU 4JV5J 2DB1A 1K47A 4M95A 1UAWA 1OMSA 2YX1A 4NLOA 4YR3A 4X4UA 1NZAA 1WOSA 3FFIA 1TP7A 2MLYA 4ZHRB 4B3OB 3ILIA 2UUAJ 1P8GA 1RU1A 4NX9A 2KH9A 3FEXB 1SH0A 3Q8SB 3TX8A 3WDOA 3OTOF 1QAYA 5HJXA 4LIWA 1DTQA 4CH0S 4RO0A 4YR2A 1S7HA 1RAHB 1F5BA 2LA4A 5AXMA 4DEZA 3CC4S 4YFUA 2PFFB 3W2WA 3RTVA 4D3GA 4N47A 2YNGB 4H4MB 1IKXA 1LWFA 1XNRJ 4HLBA 3BBBA 4U9RA 4LF5F 3LW5C 3DI6B 3J81Y 4O3OA 2B8QA 4NRTA 4CO0A 2E5LJ 2I8EA 5B0DA 1JJHA 3K5NA 5KOXA 2VBXA 1U25A 1A0OB 3NBPB 3CDUA 4IFYB 1X60A 2D3ZA 2Y3YA 2IFXA 1VCTA 2YQ3A 3LPEA 1NXIA 4IYQA 4QZVB 5EWFA 4XIUA 3RB4A 2N3LA 3EMTA 2GVZB 4LSLB 3AXKA 4L75A 1X31C 4ANDA 2HNYB 4RUHA 4QYZJ 3QWUA 1NDPA 3CUNA 5A6WA 3PJWA 2IVMA 2RHQB 4NOHA 3K17A 2IAJA 4LF1A 1C0TA 4N8NA 3D6TB 1YJUA 1RABB 2GMLA 3EVOA 4FDFA 2HVEA 4O4GB 4R0JA 2ZH6A 4HR2A 2M88A 4PPDA 4RW6B 4ZLPA 5JXSA 5KG5A 1JXEA 2M8HA 3T9ZA 5JMNA 4LQ9A 2FZGB 4ZLLA 2EKYA 2IDEA 1YG0A 3BN4A 1PAUB 2OI2A 2R7SA 4CCHA 5GVQA 2J6SA 3R2CJ 4QWCA 3UCZP 1GAOA 3MCNA 3I56S 4J9PA 3KLFA 2BRKA 2GGPA 5AXLA 2RRNA 2KXHA 2IDLA 3H40A 1M5OC 3FSYA 2V5HG 3HMJG 3P49B 2W2QP 8AT1B 3TVKA 1UFLA 3MM8A 3TJ9A 1U2FA 4QR1A 3I55S 4NLYA 4Y00A 4U67Q 2OTLS 3BEGB 4RNNA 3PO5A 4ED1A 2XO7A 4FF4A 1S6PA 5KG4A 2UU9J 2ZWOA 4ZJQA 2QO3A 3H2UB 2RS8A 4ELVA 3MFHA 1HWJA 1JQGA 2JFDA 2DR6A 4JI2F 2XC9A 4DV0J 4KQZA 3ETMA 5LOQA 2YNHA 5GADU 1HL6A 3C3LA 1WHWA 5D4PA 4NCGB 2XG8A 1S0NA 3M2UB 2H65B 4PQUA 1Y7PA 2OELA 4E0DA 1FWKA 3PJXA 3VTIA 3MFIA 5J1EB 5KT7A 1RT3A 5IXUA 2V8HA 1Q78A 3CO9A 3RZAA 5KFWA 2ZH1A 3GG1A 3R1HA 3TA2A 2HNZA 4N77A 3M8SA 4ED8A 3TQEA 4DS5A 4Q43A 1TL5A 4WFXA 1UVMA 4CZCA 2KG1A 3DRYA 3UVJB 2OD6A 2HGNA 1TKTA 2HRYA 2CXEA 2OPSA 3LPYA 3EVMA 2C28A 3QJJA 3CTRA 2QYCA 1CJVA 1T9UA 4X4SA 2UUAF 1YJTA 1MLAA 2VZ9A 4JV5F 5HANA 1NPKA 1F5AA 2XS7A 5JVHQ 2A6OA 2WK4A 3FBBA 1YBAA 1VBXA 3MM6A 5K14B 5L9NA 2VFTA 3D3BJ 1S6OA 2KM8C 2LVWA 1N36F 3DGVA 3DOMB 2RJZA 2Y8YA 4ED2A 2OPQB 2XYPB 3NCQA 2E1RA 1RT6A 1JLEB 2H5JB 3DOMA 3LF0A 3RUBL 5HP1B 3IAS9 1WKKA 3R8YA 2Y1IA 1QAJA 4UOFA 2GNKA 1BXNA 3MPYA 1QSYA 3VV2B 3IWXA 4F7VA 1VQ8S 2NXEA 3ZTQA 2JC1A 5SUHA 4ZVHA 2CUYA 2IRXA 2KXFA 1CJKA 2XGPA 3D1OA 5IZHA 1JLQB 4CH1A 2ADBA 3MZIA 1QE1B 3SCIE 4L73A 2B5JA 3MEDA 1KQKA 2K8GA 1SL1A 2FJVA 5IQQA 4YQWA 4NLPA 3SV4A 1RWPB 2H5EA 1FRJA 3M7VA 3PHEA 4M5JA 4P2XA 2FHJA 3CNQP 2KFZA 4R5PA 2IJFA 3NS7B 3SFGA 4CLPA 3LOUA 3PW0A 4FBUA 3Q2SC 3EM1A 3MUVP 1M5KC 3CDAA 2Y1RI 3VVTA 1U1RA 2DGTA 1TL1A 2IC3B 2IMOA 3B82A 3DXBA 2BW2A 4U96A 4TY8A 5E3CA 5ITHA 2ASLA 4P7VA 2VJUA 1UCNA 4HKQA 4MYTA 3L09A 5D3GA 2AJFE 2PD1A 3LGMA 2RSQA 1AZSB 3OSNA 3H98A 5F0WA 4DOZA 2MKYA 2ZH7A 2B9YA 1JLGB 3W8PA 3LAKA 1IKXB 4FVMA 1VBZA 3CD7A 5ETQA 2HHTA 1JMTA 5K8PA 1C0UB 1S72S 5ETPA 1IN0A 2P2CB 1HQEA 4B9NA 4HH0A 3HP6A 4OZLA 4XDCA 1RT3B 3KKFA 1TL4A 3GJQB 1FK9A 3G8SA 2U2FA 2WSEC 3Q83A 3ISNC 2HZAA 3QT5A 4B3MJ 3F44A 4X66F 2EWHA 2R9LA 1KQSR 4ZVSB 2EW9A 3HM9A 3HJVA 4C8MA 2J9CA 2RUGA 3C14A 3CJKB 1DLOB 2B6AA 1TELA 3ZZZA 4DV2J 2W01A 1HBMA 5D0HA 3ZZTA 2UUCF 4ZIVA 1FX4A 3G87A 1LW0A 1S57A 2GJ2A 1VK3A 3CT9A 4RW6A 4O3NA 4AQYF 3C66A 2WVDA 1JLEA 4J9OA 2KRRA 2CPZA 3PW7A 4K4ZA 2ZC4A 5KFHA 4A8WA 4GO7X 4ETXA 3CCLS 4DL3A 3VGTA 1AZSA 1ZA2B 2CDQA 1DURA 2EFNA 2JVRA 3AT1B 2XMKA 3DDKA 2ZZNA 4Y2AA 1UVJA 2DGSA 2W9CA 2QZ8A 2W2NP 5J2QA 1VQ9S 4AD6A 4OX9J 3MD3A 2HAFA 2GHPA 3R97A 3OD2A 3HSJA 4H54A 4C97A 2GIFA 2AX1A 2HURA 2QE5A 3M2VB 3Q23A 3TUJC 5KG1A 1SUQB 3FZBA 5KFAA 2QFJA 1X5PA 3QRRA 1ZM2A 2AD9A 4ANCA 2KHCA 2HS0A 1PJ7A 1VBKA 2W4PA 5LSRA 4N5SA 2FJBB 2JLGA 1CJUA 4DUYF 2VG5A 4KGKA 4Y28C 2UUTA 3TNVA 5K8OA 2MJNA 1WF2A 3T5KA 2RS2A 3QLHA 4IQMA 3M2UA 2F65A 3HFZB 1WF1A 3BDPA 1TKTB 4QWAA 1X4GA 5B0FA 4KTQA 2CJXB 2BVZA 4CLSA 2EBGA 2BOPA 4OL8A 5EN1A 1G6BA 3A8JA 4TKTA 3D6HB 2V2ZA 5J2MA 3SDEA 4LBHA 1F1BB 1S9FA 2AMCB 1L3TA 1HYSA 2LA6A 3UCGA 1RKJA 4JI3F 3QWPA 2R7XA 1TZ0A 4C11B 1CJKB 2YKPA 4RU2A 2CWKA 5BYSA 4CT8A 3PYFA 3ENQA 4EZ6A 4ZLJA 3DRPB 3K8WA 1SKWA 4ZCMA 3QGGA 4USTA 1W7WA 1U2CA 4L6V3 4FF1A 1TV6B 1YDLA 4KIAA 3HVAA 1SUQA 2BM1A 2CYYA 1RI7A 1NO8A 1X8DA 2AIRB 2CVIA 3IXQA 4O23A 4P2SA 4ZKAA 5M2PA 2DRBA 3R7BB 3CIMA 1LWEB 4I4BA 3CCVS 1KLNA 2PA3A 2BOAA 1JNRB 2RHSB 1KS2A 2DK2A 3C19A 4IG0B 1YI2S 1JJCB 1P9YA 2DNZA 5CYMB 3DDIA 4ANEA 4U95A 1HD1A 1SQGA 1IKWA 2WBRA 5GAGU 2MKIA 4JI0J 4F2RA 5KFOA 3H25A 1JLAB 4WP8A 2QLFB 4DUZF 3RG6A 3GV7B 5L1LA 2GV1A 3HFVA 3IS9B 1X4FA 4YHHJ 2A3JA 2DNQA 4QIEA 4PWDB 2VA2A 5DGAA 2B0GA 1YVFA 1RZMA 3MUTP 3A1YG 1EAYC 3Q89A 4PWWA 2FJXA 2HQCA 4DL5A 1VR6A 1HNXJ 2DHSA 4NI2B 4NWBA 2HIYA 2NXNA 4F4XA 1RAGB 2QEXS 1HR0J 4EGLA 4UF4A 3CWJA 4KE5A 2A1BA 4WE1B 2DHAA 3AH6A 1N34F 2RUSA 2DD8S 3TO8A 3BGRB 3W60A 3KJQB 2VQFF 2NS1B 1A6LA 1WSVA 4MK8A 2BE9B 3S6EA 3TUPA 3G2XA 1ACMB 2V6AA 3D54A 2XMVA 2H4WB 2UXDF 3PACA 4LF4F 3FK4A 3OL7A 4JI1J 2KZZA 1IKYB 1UPMB 2VL1A 2NZCA 1BE4A 3U7JA 2W7AA 5D0GA 4ZPAA 4OI1A 4CTAA 5AXKA 4GKJJ 3KHLA 4ZOSA 4ZPWR 1NHKL 5C2CA 1IBLF 4I64A 1PSDA 1HNZF 2HHSA 3TZWA 4OX6A 3DN9A 4TQSA 4N8OA 2X3DA 2HFSA 3M8QB 3CJQA 4UQTA 4N7TA 2BYCA 1ZH5A 4NA3A 2J76E 4WWSA 4A8YA 1K8AT 5HQMA 1YRXA 4ICLB 5DDRC 3QFHA 5HROA 1ZZNA 2E1PA 2H48B 3EZUA 3OLAA 2VONA 2MZRA 3L7PA 2O01C 3MR7A 4OLPA 4UT4A 5H1SV 4A8FA 4EO8A 3GWCA 4QIWD 3WIUA 1S5ZA 1U6BA 4JUZA 3ZFVA 4B3SJ 1FFWB 3GG0A 3M6XA 3DLJA 4IG0A 1TL7A 3MPDA 5HK4A 4S0MA 5DM6Q 4DV7F 3PW5A 3KK1A 4KH1B 5DG7A 2R4FA 4AXIA 3AAWB 4IFYA 4KKOB 2BA9A 1FCAA 2DNOA 2DNGA 3SSQA 1RLDA 2KKHA 1VYAA 5E2QA 3MI7X 4HHJA 1YBUA 3L9ZA 1RTIA 3HVRA 4NEZA 3D7SB 3DCAA 2IVYA 3U1LA 4LFAJ 1AFIA 2CDRB 4WP3A 4Q8EA 4OHVA 3J81U 3KOAA 2HHXA 4OJHA 3KMQA 2YY3A 3H20A 1N6QA 1HWIA 3KDNA 4PXEA 3IGVA 3CJ3A 4ILRA 1RTHA 1MU2A 1HYSB 3OW2R 1Y5LB 3UDVA 4O44A 1ZM3A 4DR2F 1SJ4P 3MOZA 2G13A 1R0BG 4C3LA 3HKWA 1AXQA 3MWBA 2QL9B 1U45A 1SC6A 2ZJRQ 1SL2A 2R3VA 4HYKA 1PAEX 4IG3A 1BMQB 4GO5X 3P5BP 2BRLA 5T14A 5ETLA 1X4BA 2FJDB 1FWLA 1UEVA 1LW2B 2XMJA 1PYOB 3P3DA 2HWTA 4FNHA 1HHTP 2XB2D 2XWXA 4UZCA 4X65J 1EKRA 3ZZ0A 5CABA 4IR1A 2KM8B 3UDCA 4URQU 4K0KF 2E5GA 4KC5A 4USIA 1KQFB 3VCDA 4X4RA 3X1LB 2DRAA 2W9BA 2AJQA 2MSTA 5T41A 3JSMB 1VDHA 3FMWA 4KPYA 1YTYA 4Q2MA 3KUEA 5CQGA 1FI4A 1TKXB 1WELA 4OZ0A 4DL6A 4KHPJ 4GC6A 2MMYA 4BHQA 5CXTA 2FVQA 4N76A 1WSRA 3O6QA 1N5TA 1SI9A 1VJWA 1YK9A 4LF6F 4WZQA 5IS2A 1RT1B 3O2IA 1EQMA 4WYLA 4B9VA 5KT4A 1IQZA 1QLNA 1IKVB 3NGUA 1OY8A 1SJ1A 3RR8A 3D2WA 1B4SA 3KJVA 4DXLA 2O3DA 4X4QA 2UXBF 4NCBA 4DN0A 4A48A 1TMMA 2H54B 2XZWA 2PIIA 2HPUA 3BN7A 4DR5J 4RJVA 3P45B 1YLXA 4F67A 4QIVA 6FD1A 3Q86A 2QTWA 4G1PA 4BWMA 3QMQA 3BGRA 4OLOA 2Z0GA 2KJVA 2COLA 2Q79A 3KLIA 2E9TA 3D4JA 1S97A 2V2QA 5IC4B 4B17A 3VAGA 3W3SA 3RAXA 4PUOB 4K4WA 4J9NA 2CKWA 2R8IA 2XY7A 2QSFA 1ZETA 3OFFA 4OJ3A 3GE9A 4OYAA 3MD1A 4Z37A 2VOOA 2XNQA 3AHPA 4RBTA 3HHLD 4C11A 3MDFA 3CCSS 1RTDA 1KQGB 2AZ1A 1U1PA 3IR5B 3BV8A 4USWA 4WYWA 4DUZJ 2B56A 4A8SA 2VKRA 4A8MP 2NR0A 1GX6A 1SB6A 5HI7A 2HAIA 2JLFA 4HT7A 1UP1A 5D15A 3FCVA 4AL5A 2JRSA 1S12A 3NGSA 4RW7B 3NOCA 3MEDB 2DT9A 4O3QA 3V4MA 4F4KA 2QGFB 1QE1A 5KT2A 4LFAF 5IM0A 1RHUB 3RAMA 2ZHBA 3KFWX 2HGLA 3AJ1A 3OTCA 5KFTA 2DGXA 1KHVA 2VG5B 4DZDA 2OH2A 2OP5A 4LR9A 1TL1B 2ABYA 1T05B 1M0SA 1PYSB 1DTQB 2DO0A 4OHXA 3JAMY 1UVNA 3W7BA 4AXJA 2ACYA 1VOMA 1L3KA 2EC2A 4AT1B 2RU3A 2YPZA 5J2NA 2L9NA 4EFAC 2HLUA 2ROPA 2Z2ZA 3QIPB 3FMBA 4F2SA 5KFMA 3T1HJ 3FBCA 2M4MA 1FTCA 2VF3A 1V5IB 3I0SB 3VQSA 3HHLA 2ZH8A 3X3UA 3BYPA 1CSJA 3GFZA 3BO3A 5D8HB 1UJ5A 1LKZA 1BUXA 2HBZB 3RBEA 3BS9A 5I3UB 1VLYA 3POTB 4NRUA 2HGMA 5L38A 2YKMB 3LUYA 5ETOA 1Z1ZA 4E2FB 1RT2B 3I87A 4UUXA 4B9UA 4NYOA 4E8UA 3GR1A 2KT5A 3J81j 2F9JA 2FZKB 3E2EA 3MR5A 2UXCJ 3HSGA 3VAMA 2GZOA 2IBOA 1O6XA 1BHNA 5DG8A 4KJIA 2DITA 4DV1J 4FF2A 3WIVA 4JB8B 2HFUA 4ID5B 4R0EA 1U49A 1S0OA 3C14B 2KYZA 3CJKA 2HK2A 3HD1A 2CJ9A 1Q1KA 2HVDA 2Z57B 1TMJA 1NPRA 1DTTB 2ZITA 1SH3A 4TN2A 2L9WA 3MM9B 3VZHA 1Y0HA 2MQLA 3TAMB 3WX8A 2X1AA 4R8UB 3QAUA 1IBMJ 1YJRA 2CNOB 2J9DE 4CTAB 1T05A 1UVIA 2UVRA 4YY3F 4OX9F 2PE8A 4QOTA 3SQOP 2ZNYA 1LFWA 3PEHA 2ZBCA 1G7CB 2GVDB 1NEEA 1NH8A 3OUYB 3DHXA 1OIAA 2XCPA 1TK0A 3VGVA 2VIHA 1FD2A 2Z2YB 3K8VA 3R5CA 5HLFA 4K4VA 1SCJB 2L3MA 3K5PA 4CM0A 1V5VA 1IBMF 1D3WA 2B4VA 4FPRA 3IP0A 4MK9A 2VG6A 1I5OB 4IOBA 1HLWA 4A46A 3QSIA 4WCEQ 2ZH5A 3CF5Q 4JOUA 1Y9OA 3FSIA 1ZAVA 2MKJA 3KHHA 4DU8A 1I3OB 3E51A 3GJTB 2K7JA 1VIOA 3A12A 3IA0A 1S59A 4WTYA 4EBEA 4ILMA 1RBAA 1TKXA 2IRUA 4M5HA 4EBCA 3HHNB 3QRPA 4KR0B 4C3MA 2VDHA 4WXWA 2UXCF 4QYRA 1NJIT 3KK1B 4WFYA 2M3DA 2K3IA 1D0EA 1VFJA 2YQ0A 3KNAA 3DM2A 3KK3B 1D09B 1B0VA 1NAQA 4PXDA 4B3MF 1H7XA 3V2UC 1E6VB 4LVNP 1ZM9A 3QPIA 1PC5A 1Q0NA 4NXMJ 1NJXA 1CBKA 4OYWA 5D4OA 3V5RA 3G8TA 3MEEB 4QU6A 4MKBA 2WBMA 5A8KA 1DFDA 2FVCA 4KH0B 1MW7A 2JL9A 2V8DA 2LKZA 1BQNB 4U7CA 2X1GA 2M5YA 1IQTA 2F5GA 3KHGA 2W4CA 3OVSA 3VGUA 2EG2A 2UVUA 3DFEA 3PO4A 5D0EA 1U8WA 1HNWF 4WKRA 1Q79A 4C8LA 5KFCA 1MU2B 3D1HA 5KOWA 1BGXT 2CAJA 1LOUA 3B8HA 3TUZC 3N6NA 3FQKA 4KO0B 4KHRA 3UR3C 1IBCB 4CLKA 4QPXA 1UWAA 4WJBA 1BY9A 5EX0A 2D3OR 2CJQA 2VPXB 5C42A 2AKWB 4NXMF 4U8VA 2YKNB 4NPOA 3OL9A 2JZ5A 3GU0A 2WCXA 4IG3B 3THPA 3QGIA 3WQPA 3HVTB 4KBIA 5IWAJ 1DY3A 1GQEA 3CGIA 3D3CJ 1YQHA 2FGOA 4EMDA 4F3MA 1FWPA 1B99A 4PXBA 1WDTA 1SJRA 3VVUA 4BC9A 4R5PB 2D3O1 2J7WA 2MQMA 2DCUB 3OFHA 4FS2A 5E33A 3IWNC 4PRFA 1WD6A 2IHR1 3EVWA 1NU4A 2CQGA 5GAHU 4DR4J 1JLCA 4MKAA 4ECVA 1KOHA 4P9SA 1IKWB 4QIGA 3CSKA 4KGZB 4C98A 3KLGB 4EBDA 1HBNA 2LLZA 4OYIA 3AD7C 2W7OA 4OI3A 4B02A 4NA2A 1RGVA 3DOLB 1HA1A 1RAFB 2FHKA 3M1VB 1R0CB 3OXFA 2MQOA 3H5UA 1TFWA 4GVBB 2M7SA 4HACB 1TKDA 2ZE2B 3BQ2A 3T19A 1Q95G 4DX8H 5I3QA 1R3NA 4CT9A 5DDOC 1CPZA 1WC5A 1DBDA 3VWSA 1VQPS 3G82B 2PEBA 1IBKJ 4I7FA 1GNKA 4DSKA 1UL3A 1G1XA 3AB2B 4QW9A 3G71S 2QL7B 2ZWPA 3N28A 5L9XA 2BW7A 4KKOA 4WZMA 1CC8A 2LQ8A 2DRDA 3E8OA 1IUJA 1DTTA 2CJYB 3UN3A 3D6MB 1RB0A 2M2BA 3UR0A 2ZBIA 3D9BA 1V9OA 3OXLA 3FJ2A 3CJRA 3SDEB 1U47A 1SKSA 1GEHA 1RT6B 2DIUA 3FNNA 1RCXB 3H5SA 3J7YU 4JV1A 1X9SA 1GMUA 3VHQA 3RRGA 4C8KA 1UZHA 2IJRA 1N33J 5HP1A 4YB6A 1TKZB 4MFBA 1MWZA 4WBFA 4AE5A 4EWTA 4NLVA 4KHMA 1I1GA 3Q8YA 3RYLA 2D74B 2O66A 1T9XA 1ZAWA 2BKOA 3BQ1A 2XBPA 3CMQA 2HLTA 3EXCX 4CYUA 4DCOB 3D66A 4Q8FA 2WSCC 5EDWA 1FRKA 1NSPA 2PMWA 5LJ3Y 3IRWP 3R3TA 5L1JA 1TK5A 2UU9F 2OPRB 3HLUA 2AEMA 2WW4A 2HEKA 2ASYA 3UNGC 3RB6A 2BDPA 3T1HF 2XCAA 1WF0A 3C8YA 2VPZB 4QR2A 3BSCA 3K58A 3NMAA 4ZCKA 5H9FJ 5GMKa 1BWVA 2R7TA 3H5YA 2HZVA 9RUBA 4CO4A 3JQKA 2P9EA 4ZITA 4MH8A 2KU7A 2CQCA 1S1WB 3DU5A 5J2PA 2RH3A 2LXFA 2CPEA 4XTTA 2OPPB 1AUDA 3UD4P 3GYXB 1C4CA 4PAAA 1NLKL 4DPUA 2F1FA 4JBCA 1Q8LA 4DWIA 2DHGA 4FYDA 1ZZFA 5H9EJ 3NNHA 4ZVRB 4K5SA 4NI2A 2QX0A 4C48A 3DGPA 2ALZA 4A4JA 3GCWP 2ROEA 4ID8A 5JUMA 1EP4B 3MEGB 3AODA 1NSQA 5A8KB 2AEJA 3MAQA 2H51B 5D78A 1FKPB 2DH7A 3CD5A 3R9LA 3KMSA 2D7SA 3GFXA 2OEKA 2DHXA 3DM2B 3KK3A 5ETRA 3KLHA 2ZD1B 3J80Y 1YJ9S 1N8RT 2M8DB 4LMZA 2MQ8A 1UETA 2UV8G 1JK9B 1JXLA 4OQJA 2FVPA 2MKSA 3BKUA 1YRTA 2UUWA 4UW2A 2HFZA 1ZA1B 1DQ8A 1R27B 2JWNA 4Q45A 1S1XA 2Q6CA 1XNRF 3CCES 1F5CA 1XMOJ 1RWWB 2BUNA 1YJ7A 1NRKA 2PMHA 2V8GA 3I96A 3VF0B 5L46A 3UPFA 1R6YA 1S1WA 5J2PB 4CIOA 4QBUA 2UXBJ 2DEIA 2D1CA 3OFGA 2KFNA 1RSCA 2BJDA 5CAAA 4DSJA 1N0UA 4DBQA 2ZM6J 4OI0A 1Q7LB 4KFBA 4DL0C 3LP0A 4KB7A 2BQUA 4LF6J 3NGDA 3NGTA 3FRYA 2F40A 4O3PA 3Q8PB 3CVKA 3GB0A 3JSMA 2GIQA 4RR5A 4O3RA 2KT2A 4OYMA 4KHPF 2VASA 3GJRB 5HMZA 3L7UA 1U0HB 2DGOA 4QIFA 1KP6A 5D4NA 5D3GB 1H73A 1W26A 3OR2A 2RRBA 1TQLA 1SL0A 1GXLA 2D9OA 3UNYA 3BR8A 4DS4A 4ER8A 4DV0F 3AOBA 3V4IA 3G82A 2VBZA 1RT5B 1WUUA 3CJ0A 4QQBA 1Q4RA 2RVJA 3M9NB 1M1KT 3DRXA 1MNEA 2CQBA 2Y0BB 3SSSA 3GMGA 4LF7F 1JLGA 1ZAXA 2LU2A 2CPHA 3CJ8A 2R7VA 4YHHF 1RBLA 4CP5A 3BSNA 4NCAA 2QMWA 4J9SA 4B9SA 4DV7J 2GHVC 1WOOA 2YH1A 3LANA 1G4CA 2ZBRA 3BPDA 4L74A 1HNVA 1KVIA 3KLFB 1XR7A 1YITS 1XQIA 3KWMA 3IN5A 2Q1LA 1LWCA 5KFDA 4YR0A 2WTFA 5B0BA 2E1AA 3PNIA 5DS7A 4XO0A 3PTWA 4ZN3A 2L41A 1B3TA 2V9KA 4YB7A 4ICLA 3ZTRA 1FERA 1JLFA 4U8YA 1KSPA 1AROP 3UDLA 1CS4A 4P2FA 5KG3A 3GTYX 2VQEF 4IR9A 3N6MA 2DCLA 3E01B 5HL7Q 4DL7A 4G1IA 3T1AA 2B9XA 2XO6A 4I6YA 3GSIA 3V6JA 1S0MA 1YZ7A 2V4JB 3K89A 4X64J 5AE1A 2VB6A 2MKCA 4B3SF 2AYGA 1X9WA 4IH5A 2FLOA 2KYXA 2J9EA 4Q2LA 2AV5A 4UOCA 5J2NB 2QLXA 4F4YA 3P6YC 3NGKA 5T7LA 4X4VA 4ZCLA 1JIHA 2DNNA 2AJ4A 4YDXA 2BABA 1WHXA 2PO4A 1NK0A 3HCXA 1MWQA 1VQ7S 4I2PB 3OV7A 2H1YA
chains in the Genus database with same CATH topology
2I9SA 1JNZB 4RKUC 4K50A 2XMUA 2OTJS 2LDIA 4ZPTR 4IOCQ 4LUBA 5M2RA 1WTFA 3CCUS 2ZVSA 5FDLB 2DBBA 1WACA 4RBVA 3WBZA 4QW8A 1HPZB 1KFDA 5AJ3F 2RNEA 1UFWA 1QY7A 1HQUB 2EK6A 3K5MA 2BR0A 1DHMA 2IM3A 1RT7B 4ALZA 5DETA 3M2RA 1B0TA 2DNPA 3MEEA 1X4EA 1VQKS 3QZ7A 2VG7B 2CZ4A 5LJ5Y 4OHZA 4CNYA 1FVSA 3GZ7A 3K59A 2H9ZA 4F50A 5A8RA 2JC0A 1FESA 2J5AA 5J1NA 5A0YA 4XPEA 1U1QA 2GFFA 3AA8A 4Q7AA 3CDEA 2N3OA 1R43A 5A0YB 3I4PA 1SJFA 3NWGA 1FXDA 4NZ0A 1M5PC 1HNXF 4PWDA 4K5RA 2OPRA 2FIUA 1Q53A 2NUUG 2CJAA 2NSCA 2J8AA 3S01A 1K1SA 4UQGA 3OTOF 3CD6S 1LW2A 2DGQA 3FSXA 4PCQA 2VG6B 4YFUA 1BLUA 3HHDA 3NNAA 2VC1A 2IC3A 1HMVB 1Y5NB 3V6DA 2X51A 4DJBA 4LSNA 4MAKA 3HXMA 3ZZRA 1KR4A 2GA7A 4H4OA 3MR2A 3CXCR 1H6KX 2FPHX 5E3RA 2XI3A 3M6VA 4H4OB 5KFVA 2FLNA 5B0GA 1RYSA 3V4IB 1JJ4A 1RT5A 2GIRA 2R7UA 4USHA 3SXLA 3G6ES 3SCJE 5B09A 3FDSA 2VODA 1XEZA 2K2PA 1FDBA 5E3QA 2QV6A 5DGBA 2RB7A 3PW2A 5KFZA 2XULA 4IUFA 4LF9F 1M5HA 2QSWA 4ZP6A 4C2MA 4FP9A 2BM0A 3TYTA 2Z8QA 4O44B 1XC9A 3MMBB 2VUGA 3O1LA 4IDKB 2MQPA 3QGHA 2L48A 4OMFG 3PX4A 2U1AA 1UJ4A 2K1RA 3NKYA 2DGVA 4XK8C 4NLDA 1X4DA 2VOPA 3N9UC 5IM0B 1TAUA 3SFUA 4X4PA 1S9EB 2RF2A 3BDEA 3BJYA 3KYLA 2B9WA 4IRKA 3K5LA 1N88A 3KG1A 3M32B 3OR1B 4RWWA 5F8IA 1U4BA 2DIVA 1XNQF 1U7LA 1FVQA 5DM7Q 2FTRA 1K73T 2FY1A 1HBNB 1RT4A 3JTPA 2YWHA 1RAJA 2AW0A 2JDJA 3UD3P 1D9FA 4ZMMA 3QIDA 5AE3A 2ZUGA 1QVGR 2R7OA 2CPJA 3I4HX 1FKPA 2J0WA 4DDFA 3D0IE 4RW4B 5D77A 3FVYA 2YKOA 1WEZA 5FJ4A 4CQ1A 1HQUA 5HMYA 1L3VA 2IYIA 3AB4B 5C25A 1V6HA 1DLOA 1WTBA 4Y2CA 3CCZA 1GXUA 5EWGA 1ROFA 3G86A 3T6JA 2KJWA 2C3YA 3VAFA 3TUIC 1DZ5A 3JSYA 5F9LA 2I38A 3MEKA 3BQ0A 2J0XA 4OJGA 2R8GA 2RE1A 5LMNF 4HDHA 4G6VB 1U48A 1D8ZA 3PRDA 2PDAA 4DF4A 2VC0A 3MM7B 1GT8A 4LIRA 1DRZA 1FJGF 2MZSA 2D9PA 4UY8T 3MM8B 3RW6A 2FD2A 1NK8A 3LH2S 3IRXA 5DRKA 1XR6A 5IFMA 3GQCA 3T5JA 2BJEA 1SXLA 3DI6A 3F56A 2GO9A 2RQMA 4DR6F 3TAMA 3UFCX 1RJJA 1U6FA 4K4YA 1KC8T 5LT5A 1OS5A 1MMLA 3T3FA 1T7PA 1QM9A 1N52B 1HWLA 2PT0A 3NAHA 4L3NA 4DL4A 3LGNA 4TLQA 2LQ5A 2YWGA 1ZTTA 4DV5F 4DL2A 2XGQA 2AF6A 4I2QB 2F8HA 2G9OA 2HIQA 2I5JB 2R7QA 4I1TA 5HBMA 2ZH3A 3M05A 1SBRA 3M8RA 1CQNA 1TAQA 1TVRA 1TR0A 2I1RA 2MYFA 5DG9A 3W2WB 3CJ2A 3BO2A 2V4QA 3GV8B 3MCSA 1P27B 2R7RA 4ELTA 5E3AA 2YNFB 5F3ZA 2ZJQQ 2O1PA 4RNFA 3HHLB 2APOA 4DSFA 4Y6IA 5F3TA 3ZC4A 1FDAA 1U1OA 3MM5B 4M94A 2CPYA 1TL3A 2ZNZA 4G3IA 1QUPA 3HHKA 3JTNA 2HHUA 3DXSX 2CQ1A 1HBOA 5MAOA 3OJUA 1N4LA 2GO8A 5L1KA 1QTMA 4ID5A 4DFKA 2CJBA 3OSPA 1UW4A 5IQ6A 1C1CA 1M90T 2A2DA 4MFBB 1JLCB 5E0OA 1O5JA 1YGYA 3HVWA 1W2BR 1S1XB 3UWTA 5A8RB 3DLGA 1SH2A 2XS5A 1H7WA 1WG1A 2JSXA 2W9CB 5J2QB 1H2VZ 1R89A 2GQ2A 2E7XA 3UQSA 2YKNA 2DR8A 3CB4A 4RW8B 5C5JA 6FDRA 4X4TA 4YEAA 2R7WA 4DR3F 1KLMA 4O3SA 3DLLQ 2MY8A 1FNXH 4MK7A 5I3UA 1CEZA 4X4OA 4RNOA 4KGMA 1HPZA 1UA0A 3IO1A 3TVYA 1WNEA 2DTJA 1WI6A 3I0RA 5G0RA 3TVZA 2FLLA 2GCFA 2ZOGA 3DRRB 2X3GA 2VD3A 2FLPA 3EX7B 3CCMS 2HVHA 1S1VA 4OJ1A 1C0TB 3DRRA 4RX6A 3LP2B 4C8OA 5E41A 2AX0A 5KG0A 5B7WA 2GQCA 3IG1A 4OZ1A 4FZVA 4UUWA 4Y2IA 1W25A 1KD1T 4F4WA 1HQEB 1GTHA 1FA0A 3FZ2A 4Q0BB 4BWJA 3OL6A 4XDDA 2UV8A 4RU9A 2HHHF 2XNRA 4ZPCA 4K4XA 2B6AB 3K7RA 2ZH2A 2MZ1A 4KV8B 2ZDOA 4E98A 4K2XA 4RW7A 4J9MA 2NLWA 1T02A 3HHEA 3HKZD 5GAEI 1S6PB 3PY8A 3B78A 1YJWS 1KTVA 4C0BA 5F8GA 1FJCA 2JH3A 2XI2A 2ZFHA 4HTIA 1N32F 1XMBA 1DQ9A 3U1NA 3US5A 2ERRA 1Q81T 2JEGA 1RTJB 1HFEL 1OO0B 2J9DA 2L9DA 5CYQA 1JWWA 3DHWC 2J6UA 2P9CA 2IVFB 3TR5A 1TUVA 5HN0A 3UE2A 3QZ8A 2RMLA 4DR7F 1JKHB 1QAXA 5CZVA 3U27A 4YB1P 4RNHA 4QWDA 1XWLA 1XN9A 1H38A 2RDIA 4IFVA 2VH7A 3QJPA 1VK8A 2KTQA 2D3UA 1APSA 2Z4PA 5MLCV 4DV4F 2HG4A 3TAPA 3U02A 5EHHA 2CPXA 3MOJB 1PILA 2IM1A 2OJ3A 2ZM6F 5HBMB 4P6QA 2WW8A 1IM4A 4I69A 1N56A 2IBKA 3OFEA 5B0CA 1C1BB 1S1UA 3NNCA 5EX3A 2XSJA 3C6TA 1C4AA 2P9GA 3KG0A 4JV5F 4X2BA 2YWEA 3E3XA 4JI4F 1V3SA 3IR7B 3M30A 2XY6A 1ELOA 4ZVGA 3P96A 5SZTA 1GXTA 3KLVA 4PG7A 2QIFA 4K4UA 2VBWA 4B08A 1O0PA 1NHUA 3SV3A 4C7QA 2CQHA 4H4MA 4URGA 1NK7A 4FXWA 4QWBA 5LSLA 2AGQA 5JVGQ 1OWXA 1Q8IA 3GV5B 3OHAA 3TP2A 1PO6A 1FRHA 1H2UX 2A10A 4DLEA 1SKRA 1J5OA 3J7YI 3JSBA 1ZOTA 4EU0A 4QJVA 4NLGA 2E9TA 4NXNF 2NQPA 5GADI 3SQGB 1CQMA 1HBMB 1RP5A 2EFQA 1S1TA 3MMJA 3Q24A 4V19J 2E66A 2ZZMA 1AFJA 2E5IA 2KI2A 4ZS6A 2D41A 3HX9A 2HMIB 3MECA 2N4DA 3H8YA 3FEZA 3V6DB 1S1UB 5DQHA 2FJEB 2NYIA 3QIPA 2MY7A 2LQ9A 4ECYA 1RTJA 5A8WB 4NCGA 4OI4A 2W7PA 3VAJA 2MB0B 3LP1B 1E6VA 4DSLA 1Z2ZA 3I0RB 5L8RC 3T5HA 5KG2A 1MMNA 1XR5A 1L3UA 3HT3A 2CIMA 2IAJB 4ED7A 2XWYA 3R1LA 3DYAA 1R0AB 4DMZA 2XS2A 2QLWA 3LO3A 3CMES 1AW0A 3RR7A 2GHWA 1OPIA 3PKYA 2PSZA 3PRBA 2HNYA 1IKYA 3R27A 4M8LA 4RW9A 5HROB 3GIMA 4LJMA 3G4SS 2HNDA 3UCUP 3EZ5A 5F41A 3GFHA 3BGFA 2BACA 4MIBA 2FJWA 3BM7A 3IG1B 2PC6A 4FNIA 2DNRA 2LCWA 3AJ2A 4PR6A 3WZ0A 1S9EA 2RF2B 4U6PA 3LWMA 2LXUA 4PUOA 3DMJA 1VQMS 1VRUA 2CPFA 1CG2A 3OPKA 5KFQA 1HWUA 2ILYA 2EBEA 3E01A 1NB7A 1DARA 2E5JA 2HHQA 1IBKF 1RA7A 1HWKA 1S9GB 4N41A 5HLFB 2C22A 2PI5A 2CQIA 3KG4A 1R8CA 1VQYA 2AYEA 2KN4A 2OIHA 2UP1A 1RTIB 5E7OB 5F9NA 1NKEA 2DNMA 3ITHB 1VIXA 3SEOA 5LSOA 3OJSA 3DRSB 3M2VA 1SIWB 4Q44A 3PFEA 3NRBA 3CDWA 1FEHA 3HDSA 3MMCA 4I6WA 4WE1A 2VONA 2DO4A 3RBDA 2XLKA 5DLFA 3OTEA 4AUKA 1FE0A 3C6TB 3QLHB 3DU6A 2HYIB 3S1TA 2CJKA 3CC7S 1SIZA 1N5YB 4A47A 1S0VA 3B4MA 3GIKA 1VQNS 3JB9k 4RUAA 2O67A 2LMIA 1JJ2R 4PG8A 3GIIA 1TVRB 1WI8A 2VPWB 4CH7A 3BO4A 4QR0A 3WX4A 3N01A 4F25A 3ONQA 1UEUA 3OXGA 1NHVA 2XMTA 2DPJA 1HW8A 1R8HA 3C46A 5F8NA 2YX7A 2HQIA 1QUVA 4X64F 5JJBA 2L08A 2ADCA 3OUYA 4NZ7A 5BYRA 5FLXY 1FF2A 1HBOB 4C3KA 1SQEA 4J37A 1WG5A 4ERDA 4X4NA 1G3OA 1NJYA 1WHYA 2R2UA 2BXJA 1FJEB 3M2RB 3ITHA 2EPIA 5B08A 2DH8A 1C1CB 1UWBB 3HVTA 3QAEA 1M5SA 4YOEA 2P5VA 4ZK7M 3NCPA 3KLEA 1PGZA 1O51A 1YJNS 2M70A 3FEYB 2NZ4A 5CYJA 1YIJS 1SJQA 1FXRA 2Z2LA 3TOQA 1X0PA 4DV7F 1VRUB 3HPOA 1UKUA 4NLQA 1S6QA 1ZPWX 2WOMB 1JLBB 3R5AA 3G9CA 2DJWA 4TY8B 3RU0A 3ULHA 2W8LA 3DLKA 1LK7A 4ED3A 1Q16B 5DDPC 2JVOA 2BBEA 3VAIA 5CCLA 1T94A 2B43A 3ZZYA 2IYGA 1HHSA 3O5TB 4EYHB 3HI9A 4TNOA 4Y0FA 3H59A 1NJWA 4J9RA 1HNIB 2ZHOA 4B9MA 2AYBA 3H4DA 2PEHA 2LECA 2O5DA 5CD4H 1FXLA 1MWYA 3MPWA 3WC2A 3JYTB 2MXYA 2YNIB 1FEEA 2E44A 5KFIA 1SV5B 1NK9A 2ASJA 2AP6A 4RW9B 1N5QA 1KTQA 2KB2A 3AA9A 3K2YA 5CA5A 4PG4A 3L7OA 4DN9A 1IR0A 3RAQA 2DPIA 2N7CA 1FD8A 1RKIA 4OX8A 4XAKA 1LW0B 4K59A 4JI5F 1C2PA 2OLWA 1LK5A 2MGZB 2C42A 3DLGB 1XMOF 2KRBA 2LDYA 4X65F 2FC8A 3M8QA 1KEKA 1SJ3P 1U1LA 1TV6A 3I6PA 4AFFA 1Y00A 3I9V9 3G8QA 3OTBA 1P1TA 2WONB 2UZAA 4CO2A 2DR9A 4F3QA 2NPIA 4ES3A 4PG5A 1HMVA 4IKAA 4WXOA 4RLEA 4W90B 2ZKTA 2NPFA 1F60B 3OR2B 2QA4S 2NXUA 2VFRA 4HVZA 5I4MA 2M52A 1OPZA 2E9RX 5J2MB 3EGNA 2E9ZA 5KFYA 4RNMA 4DF8A 2KO1A 3QO9B 5L1IA 5U47A 4ECTA 4EEYA 4NA1A 3BSAA 3MM9A 1IJFB 3MM5A 1QSLA 1OQ3A 4TLRA 5DQGA 3ENVA 3I0SA 4ECZA 4B9LA 4PKDB 3CC2S 1REVB 5KFXA 1RQ0A 2WSFC 2OPSB 2G0CA 2AYMA 4DLGA 1H98A 3NS6A 2GJIA 3TAQA 5G4DA 1HNVB 2B7BB 3BF4A 3DNCA 2FGCA 4TXSA 1GX5A 4MMOA 1L5UA 2IA6A 3TARA 1RYRA 2FVSA 4Y65A 4DQQA 4RBUA 3I82A 3SYZA 5F8LA 5D4LA 3ZZUA 3TA0A 4WFNQ 4KAIA 4WKYA 4IOAQ 3HHLC 5L39A 4DR5F 5B0EA 2MDAA 1WWHA 5LXYA 2Z2MA 5LXRA 4IRDA 1O8BA 3IRXB 3OBIA