1FVSA

Solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) load states
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
AREVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDCEILRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the yeast copper transporter domain Ccc2a in the apo and Cu(I)-loaded states.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords COPPER-TRANSPORTING ATPASE
total genus 18
structure length 72
sequence length 72
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fvsA00
3BM7A 4A47A 1OPZA 3FMBA 1AFJA 3HHLC 3KG0A 3CJKA 1K0VA 3K7RA 1S6UA 1P8GA 1TUVA 1LQ9A 1Y3JA 3HHLB 4OJGA 4YDXA 1YJTA 4A46A 2OD6A 2RSQA 2GO8A 4A4JA 1IUJA 2QLXA 2GGPB 3HFKA 2GGPA 1FVSA 2RU9A 4Y2KA 1P6TA 5T7LB 2FHMA 2FIUA 4HH0A 2OAUA 3KNGA 3QGPA 2ZDOA 5B0AA 1CC8A 2OMOA 4QOTA 1JK9B 3TNVA 4FNHA 1FE4A 5B0FA 3WDOA 2HQIA 2RMLA 1FD8A 3FGVA 2AP6A 1YJVA 1R6YA 2OKQA 4FNIA 5K9FA 1FEEA 2ZDPA 1SB6A 2KT2A 1CC7A 2BJEA 1V3ZA 1YG0A 1YJUA 2ROPA 3LO3A 1KVJA 2HLTA 2BUNA 2Q3PA 2K1RA 5B0BA 5B0CA 1AW0A 2G9OA 4ZOSA 2ASYA 2LDIA 1TR0A 1WD6A 3HX9A 1TL5A 1TL4A 2XMJA 4Q2LA 2OD4A 2VH7A 1MWZA 3DXSX 2K1RB 2KYZA 2FB0A 4OJHA 4U9RA 5A6PA 2FTRA 4HL9A 2KT3A 2PGCA 3F44A 1Q53A 2GCFA 2PD1A 3IWLA 4OJ1A 1GXTA 2XMUA 2GFFA 1RJJA 2OP5A 1OQ6A 5KAKA 2BBEA 4DPOA 1VQSA 1X7VA 2IYGA 3BN7A 1Q8BA 1X0PA 3HDSA 1KQKA 1N5TA 3TOQA 1GXUA 3UDCA 4F67A 2HLUA 3MZIA 1Y9OA 3BR8A 2AW0A 2W4PA 4Q2MA 1APSA 2N4DA 1OSDA 2N7YA 3HHLD 4OIXA 5IXUA 2LQBA 2XMVA 5T7LA 4DN9A 2QIFA 1TZ0A 4NL5A 4NPOA 2VV5A 1N5SA 1N5QA 5B0GA 3CJKB 2CRLA 3LGMA 4ZA1A 5B0DA 2K2PA 2N4CA 1FE0A 2EW9A 2HFNA 1AFIA 2W4CA 3LGNA 1VQYA 2HIQA 2QYCA 1Y0HA 3TRGA 2OFHX 2OFGX 2W4DA 3GZ7A 4Y2MA 3T9NA 5B09A 2XMMA 2L3MA 3KG1A 1OQ3A 2LQ9A 2XMTA 3FRYA 1Q4RA 4Y2IA 4HH1A 3QMQA 5F0WA 1SQEA 1X8DA 1N5VA 2GV1A 2RILA 2XMWA 5A6WA 2AJ1A 4A48A 1YJRA 1QUPA 1S6OA 3VTIA 2GA7A 2K7JA 3HF5A 1XBWA 3KKFA 3MCSA 2QLWA 1ULRA 3E8OA 3BDEA 5B0EA 4HI1A 3HHLA 1Q8LA 1JWWA 1W2IA 2K7KA 3BB5A 1FESA 4OJ3A 2ROGA 1MWYA 4DL0C 1CPZA 5B08A 1YRXA 4YEAA 2BJDA 4EFAC 2ACYA 2JDJA 1SI9A 2LXFA 2XMKA 1Y3KA 3BF4A 3BGUA 2IYIA 1FVQA 2IFXA 3DCAA 3IWXA 2KKHA 1U7LA 2HFOA 2ROEA 1KVIA 1URRA 2BYCA 2AJ0A 4HI2A 5F0UA 3I9ZA
chains in the Genus database with same CATH superfamily
2ZFHA 4LFCJ 2HK2A 2MKCA 3FMBA 5A8WA 4KTQA 2XNRA 1L3UA 3TYTA 3FCVA 2O5DA 1RT5A 3G4SS 2O01C 5A2QU 4CZCA 3GQCA 1G6BA 3MTJA 1U0SA 1M0SA 4PXDA 3FK4A 3OR1A 4ENOA 3RW7A 2OPRB 3TUJC 4A4JA 2JZ5A 1Q79A 3SDEA 4NRTA 2QA4S 1UMJA 1XEZA 2PA3A 5DM6Q 4N41A 1NDLA 5KG0A 4K4SA 2IPOB 3HVTA 1RT1A 4Y2KA 1S0MA 1SL0A 3CJ8A 2WVFA 3ET6B 3G6VA 3PR5B 3GILA 1XMQJ 4O44B 3G8TA 4FS2A 4MIWA 4TLRA 1JK9B 5HQ8A 4XPCA 4PEOA 3V4MA 3TQ1A 3PKYA 2H65B 4CM0A 4ZVEA 3IGNA 3MAAA 4LR8A 3P45B 4QR0A 3H25A 4DV5J 5KG2A 4J9OA 5F9NA 4EYIB 2ROPA 1SKSA 5B7WA 3MEGA 1HNWJ 3P8BB 1AW0A 1QJHA 2CNLB 3PW5A 3A8JA 2DH8A 2WAQD 3RYLA 2VUGA 5KOWA 2R9LA 3MMBB 1FO1A 2QMXA 4UQTA 3WIVA 4DV7F 4CCHA 4PCQA 2GIFA 1HW8A 4MJKA 2RUSA 5KFSA 3ZXWA 2UU9F 2NZ4A 4LSNA 2FB0A 2OPRA 4NLVA 3TZYA 5KFKA 2G2ZA 4Q5VA 3V6KA 1XR7A 1ZTTA 1SKWA 3TP2A 5C2GA 3RR7A 4JI5F 2HVZA 3V6HA 2YH0A 2XZTB 1Q53A 1R27B 2F63A 3C8YA 4IQMA 4G3IA 1PCAA 1GH8A 2I5JB 2VASA 2HURA 1KQGB 2BBEA 3N4WA 4ZJLA 2DNMA 3F73A 1XNRJ 1MROB 3BSOA 4IKAA 3S1TA 2CJYB 3EXYA 5A8KA 1RP5A 1WF2A 2AW0A 1P9YA 3G82A 3GR0A 3MPDA 4RW9A 4DSFA 3KTQA 1JJ2R 2VJVA 1I51B 4OX7A 4RKUC 1HI1A 2AYEA 1S77D 1KRPA 1Y00A 1FWLA 2V2ZA 3FBBA 2IA6A 5DQGA 2RDIA 3JB9k 2D1CA 4I7FA 3CC4S 3CWJA 4PPZA 4LUBA 1R0AA 3AB2B 2Z2LA 2OFGX 3T9NA 2LQ5A 2L48A 1V3RA 2KRRA 1JXVA 3A3PB 2B3TB 3QJPA 1FJGF 4X4UA 3ITHB 4Z7YA 2MQ8A 3HZEA 2CVEA 4KC5A 3QIDA 4BHQA 4U67Q 2ZBCA 1NU4A 3I87A 4CWBA 4QWAA 5C7PA 4KE5A 1Q16B 2W9CA 1YHQS 1ZETA 1N33J 2MY7A 4UQGA 1VDHA 2AJ1A 2MEWA 1NHUA 3OV7A 4WFAQ 1GEHA 3AD9C 2GS8A 2VJUA 3QFWA 4LRAA 4WFYA 4EBCA 1JLGB 3RRHA 3SCLE 2B4UA 5DG8A 3OTBA 2E1PA 4M5IA 3M8SA 4OX6A 1Q81T 2YNHA 2FLLA 1JWWA 4PG7A 3WHIA 5M2PA 1TMMA 1T9WA 4RW4A 2QG9B 3CB4A 3SFGA 3GIKA 4W4MA 2VFTA 4UF4A 3H2LA 1VBYA 3W3SA 2VQFJ 2E5IA 4KGKA 2BA9A 4UW2A 5KFXA 4IH6A 3W5YA 5C24A 1CVJA 3OSNA 4RBTA 4DL3A 1QUVA 3IBCB 2GC8A 5ETKA 3P5BP 2IMWP 4LSLB 1RHQB 3GWCA 2A0FB 4FBUA 4N7TA 3BM7A 2EFPA 3TAMB 3Q8RB 1BWEA 5KFQA 4XK8C 3LWMA 1NK5A 1DURA 3QAEA 4P2SA 1KC8T 4NXMF 2Z2MA 4C0OC 1Q8IA 2COLA 3LP2B 1U8WA 2W7PA 1M5VC 3DGVA 4OYAA 4JI3F 2P9EA 1ZZNA 2LU1A 4ECVA 4LFBJ 2MLYA 2IAJA 1XERA 2FVQA 2GNKA 3D6HB 1HQUB 3W8GA 2UUAJ 1HNZJ 3H2VE 1BQMA 1FVSA 2NXCA 1YGYA 2XI2A 3T6BA 4OZ0A 4LF5F 4JI5J 4HACB 4LBHA 3QT8A 3OTCA 1RHUB 4M5DB 2V50A 1S76D 3E3XA 1WC0A 5KFUA 1TAUA 2RMLA 3M6WA 4H54A 4RR5A 4WYLA 1T05A 2DR5A 5GMEA 2DGVA 3EE3A 2B5JA 2B4PA 2VDHA 3M8WA 3OTEA 4KH0B 4DSEA 5GADI 2VZ9A 3M4XA 2R2SA 1XNRF 2BR0A 3OVBA 2V94A 4YN3B 4AD6A 2QLBB 5L38A 3H4BA 4EZ6A 2HEKA 4DFPA 5CQGA 1C0TB 1P1LA 1YZ6A 4JI1J 3PRBA 2ZVIA 4NCBA 2V4JA 2HK3A 2MQOA 2OSQA 3J7AN 1FRJA 2CPZA 3JSMA 2C2DA 2BANA 3Q8VA 2CKWA 1GXLA 3NAHA 3PKMA 3FJ2A 2E7XA 4CLKA 3JQKA 5A2QY 1U0HA 1C0TA 1EP4A 1SJ1A 1XJWB 1O0PA 3MEEA 1LWFB 5J1EA 4OLPA 2ERRA 1NSQA 4P10A 2KT3A 4IG0A 3ICLA 1SJQA 2OSRA 5KTQA 2PI5A 1DBDA 5T41A 1WTFA 1ZAWA 2F8EX 5E41A 4MK9A 1U1MA 3EZUA 1RTDA 2D9PA 4FYDA 1HD1A 2HBQB 3FUYA 1X7VA 3PRDA 4NA3A 4WWSA 2BM1A 2DGUA 5MLCV 1B3TA 3MMAA 5FDLB 1HIYA 1FEHA 1AXQA 3TOQA 3FMWA 1WACA 1RA7A 2IRUA 2EC0A 4C4WA 4PPDA 2C2NA 3IBFB 3D6FB 3J81j 5CYMB 1KS2A 4OIXA 3L7PA 2J8SA 4KPCA 3S7RA 5IXUA 3KXDA 3PXGa 5LMUF 1ZM2A 3KJNB 3O8WA 1R7IA 4DL5A 3EGNA 2LU2A 1IN0A 3ADAC 3HI9A 3MD3A 3D67A 4K5SA 1RYRA 2LQJA 1WORA 3F41A 3BKTA 3LP0A 4QZVB 1F6TA 2CNOB 3T1YF 2F8HA 3QYYA 4O3PA 1IJEB 1LK7A 1FDBA 4ECWA 1JJCB 1VLOA 3WQPA 3MUTP 2ALZA 2OPSA 2H5EA 3GJTB 5J1NA 4X4RA 5KFJA 2EG2A 3SMZA 4NXNJ 3UNYA 1OYEA 1P27B 3OTOF 4H4KC 2UXDJ 2BMBA 5F0WA 4ZJQA 5BXIA 3SV3A 1SC4B 2GV1A 2DGWA 4K59A 2LFVA 2UVRA 5F8GA 2XHCA 1HYSB 2XZWA 2JSXA 4O3NA 4DR2J 3FZBA 4QYZJ 3P96A 4AT1B 2VC0A 4DCPB 2L9NA 2D3OR 2DXDA 3AH6A 1N48A 2IBKA 3Q24A 4F50A 1HI0P 3QRQA 2IY5B 3F56A 3CJ2A 5HVFA 1RI7A 2LDYA 1KONA 4MYUA 4XDCA 1YRXA 3H5YA 5HROA 4MKYA 5C24B 3BQ2A 4X2BA 3M8RA 1SH0A 2K3IA 4MFBA 4E98A 1AROP 1S1XB 2XYGB 1NAQA 3OHAA 1PKUA 4LSLA 5D6GA 2JLEA 1PBAA 1D3WA 2HFOA 1JNRB 5DLGA 1RHKB 2YX4A 4ZPTR 2HQ3A 3G6XA 1AUSL 2IDLA 3HHLC 1S6PB 3UFCX 4ICLB 1KFDA 1GNKA 4EO6A 1N32J 2FC9A 2ZD1A 2ZWOA 2QV6A 1MN9A 4TXSA 3WC2A 2BKPA 1KR4A 2BZ2A 2O1PA 2OD6A 1H7WA 5DZ6A 4JI1F 1KTQA 3GP9A 1OS5A 3AXMA 1MMDA 2XWXA 1IR1A 3FDSA 3AXKA 2N3LA 1BHNA 4KV8B 3MAAB 2YTCA 4L72B 4KH1B 3T6JA 1RAOA 2BW2A 4C3MA 1IBLJ 2FIUA 2VFRA 5IV3A 4WKYA 2UUCJ 4ETZA 2AIRB 1UW9A 4K7QA 1U6FA 3TNVA 1YDLA 2GIQA 2RF2B 2QZ8A 3SQOP 2QJ3A 3KUGA 4K4WA 2JH3A 4YHHF 2Y1JA 4RLEA 3PJ9A 2RQKA 3SFUA 3MM5B 1FEEA 5KT4A 1RKJA 1SB6A 4NRUA 3KHHA 3K89A 1RTZA 3UD3P 4UOCA 3ETMA 4DX7A 1NK4A 4QU7A 4RO0A 1BE4A 1VISA 3IS9B 2P5VA 3MR7A 2K1RA 1CJVA 1EKSA 1WOOA 4FDFA 4DSJA 4D3HA 2ZNZA 2BQ3A 2RHSB 2KXNB 1ZA2B 1AT1B 4CLFA 4F0HA 3W2WB 1TL5A 5DQIA 2XMJA 1D8ZA 3IXQA 4OL8A 1KOHA 5EGYA 6FDRA 2HHXA 1FFGB 4DXLA 2NR0A 1YLXA 2FTRA 3JTOA 4DR4F 5A8KB 1CEZA 4RUCA 2ILYA 3MM8A 1TL3B 1YJNS 3BZQA 4EEYA 2JEGA 2EXUA 2OP5A 2MXYA 3GFZA 1SC1B 4E2FB 5HVHA 2IJRA 1C4AA 1C1CA 3VZIA 5CCLA 2KFYA 2WSFC 1O8BA 5DDQC 2MQPA 1GXUA 2J0XA 2OEMA 4V19J 1VR6A 4P9SA 4X64F 1NBEB 1FRLA 3M32A 4NLRA 2CJQA 5ETQA 4DDFA 2XGQA 3N79A 2B56A 3PYEA 3OR1B 5T7LA 4QIGA 2DD8S 2XWYA 4FPIA 3LAKA 1S9GB 2HS3A 2UUWA 3ISND 3OD2A 1SV5A 4NPOA 2XY5A 3MURP 1TV6A 2LEPA 3LF0A 4ZCIA 2R8KA 3LGMA 1S99A 3BH6B 4OHVA 3PX6A 4YOEA 4FZVA 2VONA 4C8LA 1N0VC 4ZPVR 3I32A 3IRWP 2XSJA 2Z4PA 4DV5F 1ZAXA 2FVSA 2E5LJ 1LWCA 1S59A 5E33A 1T9UA 5IT0A 4TY8B 1RAGB 2Z2ZA 4CQ1A 1FNMA 1KLMB 2LQ9A 3RG6A 4J9RA 1PO6A 1WHYA 1WG4A 3OJSA 4Y2IA 4HH1A 4J9PA 3QT5A 5A8RB 1IKVA 4WU3A 4JYAF 3QMQA 4JI0F 2F4FA 2YNGB 2C3OA 1CJTA 1DQAA 4ID5A 4A8MP 4ZP8A 1U1QA 4JI8J 4LQ3A 4IH7A 1BLUA 2C2MB 2W9BA 2AYGA 4OYOA 3G8QA 2MZJA 2V9KA 4NLWA 4P2FA 4P2MA 2E5HA 2W2QP 1L3VA 4GKKJ 2C3YA 5ETSA 4WF9Q 4Y65A 4OI1A 4PAAA 2K7KA 4MT1A 2MSSA 4IH5A 4JV5J 4J9SA 4CDIA 2DNLA 2J6SA 4FF2A 1MN7A 3POTB 3R1HA 1VK3A 1U48A 3D6MB 3OUYA 3T5LA 1PILA 2XNQA 4FYWB 5SUHA 1FCAA 4O4GA 4K50A 1URRA 5J2PB 2YXLA 4A46A 1H2UX 4CNZA 2HVDA 2V2KA 3CCVS 3EZOA 4HLBA 3ISZA 3IBWA 1LFPA 1E6YA 1HBUA 2ZE2B 1R43A 3NOCA 1NDPA 4H4OA 5CYMA 5E2QA 1RT2A 1TQLA 1RE1B 4IOAQ 2M2BA 4JI7F 2OO4A 4EBEA 1RZMA 4O3SA 5HMXA 4KJIA 4PXEA 4ES1A 2GHWA 5HQLA 2QA2A 2CDRB 3CCJS 3NNCA 3HFKA 5I42B 3AJ2A 1TL7B 4ANDA 4KHRA 2F4VJ 2D7SA 4MKBA 1ZTWA 5CZXA 2BOPA 2M0GB 1KHWA 2JL9A 5KFLA 3A13A 3CDUA 4FNHA 3CPWR 1ZPVA 1DLOB 2JWNA 3P4UB 1C1BB 4I6AA 4ZPDA 3D1QA 4C7QA 1LFWA 2NYIA 1RUSA 1R89A 3NNAA 2JEFA 4CLWA 2IDEA 4KB7A 2GAGC 2O3DA 3MAHA 3ZNUA 4ERDA 2OEKA 1LK5A 5C42A 2Y1IA 1KVJA 1RU2A 2HLTA 1VRUB 2Q3PA 2V0NA 3UNGC 1SUQA 4F2RA 1NM2A 4FS1A 1J5EJ 3W2WA 3NWGA 2ZNYA 4RNMA 2QMWA 3DOKB 1KSPA 2NS1B 5F8LA 1NPKA 2ZH3A 3D6TB 5GAGU 1RA6A 1MWQA 3A8IA 5C5JA 4FF4A 3A3OB 5GAGI 4P71A 1UVKA 4X4TA 2FDNA 2B7BB 4FF1A 2KZZA 2CWXA 2IC3B 3DRXA 3FRZA 5GAEI 4X66J 1SJFA 2FY1A 4K4XA 2MJUA 4DL2A 1VQ4S 2X7IA 3DXBA 1RSCA 3T1AA 3UVJB 4J9NA 3CIMA 1T3OA 4IOBA 2IYGA 1DLOA 1RKIA 2R8JA 3TZXA 4F67A 2AX0A 1L3KA 2VFUA 2F5GA 3MHYA 2J7UA 5E3QA 3V5RA 3CCMS 3GYGA 2CJKA 2UUCF 3FBEA 5I3UB 2ZZNA 1BC6A 2V9WA 2ZOMA 3H0PA 2QIFA 4CLLA 5KFMA 3VAMA 1HA1A 4DSIA 1K44A 4M5HA 1NUEA 2PFFB 1AZSB 2MZSA 4X65F 3QBCA 1N5SA 2KDOA 5LSOA 3SCIE 2MKIA 5CD4H 3PW7A 1QAJA 4B3MF 1HNVB 4UUWA 3IR6B 3ENVA 4UUXA 3P6YC 1AA1B 4DSLA 4WTOB 2MSTA 3DLEB 4F8RA 2IM3A 1S0VA 1Y0HA 3QO9A 2HHVA 4A8QA 4YB5A 5B09A 2R42A 3EMTA 1U1OA 1YK9A 2XMTA 4FPRA 1HNXJ 1Y7PA 1S9EA 3W64A 1VQKS 1UFKA 2JOQA 1RAJA 4OQJA 4F4XA 9ATCB 3LPEA 5K8PA 3JSMB 2XO7A 3WIUA 5IT9Y 9RUBA 1WELA 2V68A 1SIWB 1YJRA 1U25A 2BJ8A 3TJ9A 4J9MA 3J7YI 3RBDA 3RR8A 4LFAF 4NEYA 3KDOA 4ED1A 1M90T 2HHSA 5KT5A 1LXJA 1XBWA 2H4YB 1OY9A 2QYGA 3W5ZA 2JX2A 4YFUA 2YKMA 4R8UB 2E29A 3D1HA 3C6TB 3PFEA 3H7HB 4KAIA 4USWA 1KP6A 3UN2A 5IM0A 2LA4A 1GMWA 3NOGA 4ANEA 2GJFA 4OX8A 4M5KA 3ZZRA 2ZKTA 3EM1A 1I1GA 4QPTA 4L3NA 3CJ0A 4CT9A 3UR0A 2N82B 3PJXA 3PFOA 2ACYA 2YKOA 1UZDA 2FJEB 4G1QB 3J7A1 3R6LB 1H74A 2FVCA 1BXNA 2DNOA 3ZTPA 1NMEB 4HI2A 2BYCA 1H0HB 4WK1A 2BE2A 3CNQP 4CLPA 5KG7A 1UJ4A 3OTOJ 3D3CJ 4M5JA 3RRGA 5K5MA 2CPEA 1IBCB 4QWBA 4KPYA 4WE1B 2M88A 1F5CA 3CJ5A 1VIXA 2H4WB 2IC3A 3BBBA 3WZ0A 3MUVP 2HZCA 2CQ1A 3ENAA 2DR8A 3GJSB 4O3RA 2WK4A 1WEZA 2EFOA 2QMUB 1S6QB 1DARA 3JS9A 1LV5A 1WKLA 2FJWA 4OHYA 2DR6A 2WB4A 3D0HE 5JMNA 3M30A 3JYTB 1WEYA 4KO0B 5KT6A 5T7LB 4QQBA 4NCAA 3C15B 2YQ3A 3NBPB 2KO1A 2HAIA 2B0GA 2OPQB 3M2VB 4JI8F 4N8NA 2ZD1B 4ZPAA 2JVOA 4DI6A 2ZDOA 5B0AA 1TAQA 1CC8A 5EHHA 5DDPC 3PX0A 3QT6A 3V6DB 5B0FA 2RKIB 3IRXA 2ADCA 4NLYA 4O4RA 2OMLA 4ES2A 5DG9A 2XGPA 3MTKA 4CT8A 4KKOA 4IFYA 2ZDPA 3H8YA 1IKVB 2C3PA 5HLFB 2DT9A 4ED4A 2UZAA 4B3OB 4QCLA 2AKWB 2BJEA 3H90A 3HSJA 2MKHA 1B70B 1R8AA 2JNJA 5IFMA 1FJ7A 5F8IA 5KFFA 1E6VA 4ZOSA 2CG8A 4WJBA 1FDAA 1KNZA 3QLHB 1TR0A 3SSSA 4C97A 2H1YA 4X4SA 2BXJA 2DYAA 4DFJA 2X1GA 3Q86A 5LL6d 3MR5A 1FWPA 4I67A 4F0KA 2I5JA 2QFIA 1JLAB 4USMA 4LR7A 2WTFA 2FZGB 1RWKB 4DLEA 4ZP9A 4ECYA 1I5OB 2BVZA 2LMIA 1DTTA 2YWKA 3CDWA 4I6YA 2AJ4A 1MNEA 3OT9A 4BWJA 5HI7A 1T7PA 4CLTA 1KEKA 1FNOA 1SV5B 2M3DA 5AJ3J 2RU3A 4WKRA 3BN7A 1O5JA 4F3MA 3QQCD 2VICA 4ED7A 2IJFA 3PJWA 4NI2B 4USHA 1UA0A 2GX8A 3L7UA 4YR3A 5DM7Q 1YWXA 1HLWA 2F4VF 1IBMJ 3KWMA 1XTZA 3LALA 5MAOA 1TKTA 1UWBA 4N56A 3V81A 5KFTA 5BYRA 2HQCA 3AY0A 4RW6B 3PW0A 2V8PA 2YY3A 3DOMA 5C2CA 4RNOA 3NY0A 2QL5B 2DGSA 4IRKA 1JMTA 1QD1A 3D68A 4HDHA 2QC3A 4J9KA 3SV4A 2UXCJ 4UOHA 5DLFA 1EARA 3BO2A 1NPPA 3ITHA 1URNA 2QYCA 1CJUB 3FCHA 1NK6A 3PV8A 4ZIVA 1HNIA 2YNIB 3K5OA 3UDEA 3GZ7A 1RT7A 1FKOA 4H4KA 2W2OP 2XMMA 3HZGA 2LLZA 4RZRA 3NRBA 1TTHB 5I42A 4KFBB 1R0CB 1VC5A 3FRYA 3NCPA 4KT0C 3UR3C 3NCRA 3E51A 3WC0A 3CCUS 4QR1A 1KHVA 3QZ7A 3IM8A 4GC7A 5I3UA 3C16B 1RT7B 1U1RA 4ECTA 3DGPA 1IM6A 2D3ZA 3N0VA 4P7TA 1ZM3A 3CJSA 5F9LA 1MROA 4MK8A 3GSIA 3R27A 1IJFB 2K7JA 4K2XA 1HQ2A 2G1HA 2HBZB 4DWIA 5KG1A 3RAXA 1G2EA 4M1KA 2FGOA 3BDEA 4DV4F 5DO2A 3L9ZA 3OVSA 4C8ZA 4X4VA 2DNRA 1W2IA 3THTA 4JB8B 4R5PA 4DUYJ 1SJ4P 2R7SA 4X64J 4ZMMA 1RTJA 4F2SA 1GTHA 1TMJA 4ZVOB 1KKHA 2IFXA 2E9RX 2QT7A 1HBOB 4I0WA 1N54B 4RW4B 1KVIA 5F3ZA 2LECA 2NPFA 2D3UA 3ILOA 3MOZA 2D69A 3DI6B 3VGSA 4ZVPB 1PYSB 2ZH6A 2FPHX 5K8MA 2UVVA 3UCUP 1DTTB 2CPHA 2LEAA 1S6PA 3VZHA 2E5LF 3C14B 1K0TA 4LF8J 4UY85 3KHRA 1XNQJ 1BQNA 3ZTOA 4ZPWR 2ZH8A 2HFSA 2WZ1A 3M6XA 4AXIA 2HWIA 3QSYB 3TANA 2WOMA 3D9BA 2GGPB 1HBMB 2VG6B 2EK1A 3FEXB 2XCAA 2EWHA 3T3FA 2UVWA 3N6MA 1FI4A 2GMLA 2RJZA 3VGUA 3ZO7A 4GKJF 1TL1A 3FKBA 2OLWA 4C98A 1YBTA 2G0CA 1AB8A 3OHBA 2GIRA 2BX6A 3BV8A 1WC3A 4EO8A 3HSGA 3JSBA 3TI0A 4CO2A 2HHQA 3CC2S 1SC6A 3NS6A 1QY7A 1NK8A 4BS2A 2WVCA 4MIAA 3SSQA 5C25A 3G86A 2HHWA 1TK5A 2QL7B 2ZEJA 1CJUA 3D3BJ 3EDRB 2N3OA 5EDWA 3KLFA 3QATA 2XI3A 2BJ7A 4JV5F 2DY1A 4CO1A 4J7CA 2BKOA 5U47A 1LWFA 3CD7A 2LKZA 4HTIA 4Q45A 1CS4A 4ANCA 3JYTA 1FHTA 2O66A 2DRAA 3DU6A 1NSPA 3KLEB 3KK1B 3ELHA 3KLIB 2B6AB 4I2QB 4OHXA 5CYQA 2OJ3A 3BPSP 3Q8YA 4LFCF 2KYZA 1U4BA 2OHDA 3H42A 2K06A 4M5LA 1WDDA 3EWGA 4AL5A 4K5RA 4TY9A 3GE9A 4OLOA 4KSEB 4NXMJ 4PRFA 2R7WA 2VPZB 1JLEB 1NZAA 1RK8A 1RTHA 1RJJA 4IFYB 5KFWA 4DV0J 4CO4A 4DPOA 1H7XA 4NI2A 2I8EA 1TK8A 2HRYA 2MJNA 3I4PA 5HJXA 4K0KJ 5GADU 4ILMA 1VC0A 3MZIA 5G4DA 5HL7Q 2POKA 4ZP7A 5G0RA 3UCGA 2N4DA 4OZ2A 3DOLB 1XMQF 2WHOA 2NUHA 3EPGA 4IDKB 1T0TV 1RYSA 3HO1A 2F1FA 4KGXB 1T9YA 1UJ6A 3R5AA 5KT2A 4ECQA 1RT3A 1HWUA 1IWGA 1JLFA 5AT1B 4G6VB 3B4MA 5ETPA 1TKZA 4Z37A 3GG1A 3M8ZA 4CTAB 2I2YA 3GCWP 4D3GA 2RQMA 1YJWS 3HFZB 1R0BG 4CLZA 2HIQA 2I9SA 4JI4F 2D9OA 4FYXB 2A3JA 4X66F 5J1EB 5KFPA 3RB4A 4B3MJ 1XQIA 2HWHA 3TWZA 3KYLA 3IRXB 3GIMA 3MEDB 1RT6A 1IKXB 2XSFA 1VRQC 3KLGB 2Z56B 3QO9B 4ECXA 4A48A 3MM7B 4YUDA 3MXHP 1QUPA 4DG1B 2AYMA 1NH7A 1Q95G 2DO4A 4KBIA 4DEZA 1YX2A 4UT4A 2GQ2A 3KKFA 3B6BA 3AA9A 3EICA 1RT6B 3QRPA 5DJBA 3R7NB 1HWKA 2F9JA 3HULA 2XB2D 2VC1A 1FK9B 1RWPB 1M5HA 2VG5A 1SH3A 3DDIA 3AD7C 1RTJB 4ZVRB 1A7GE 3Q22A 4MK7A 2HNYB 2DHXA 2H3EB 4R0JA 3E01B 6FD1A 3CE8A 4ZCKA 3RUBL 5DETA 5ITHA 2KT5A 3HSZA 2B6AA 3MPVA 1XMOJ 4AUKA 3CULA 5D8HB 2YWWA 2HS0A 4Y6IA 3TAMA 3R2DJ 2HKEA 3PIPQ 4LRDA 5KFZA 4M63A 1AFJA 4OI2A 3KK2B 2WVBA 3GJRB 3QAUA 5K8OA 5DDRC 2NLWA 1ICEB 4EWTA 5KT7A 1QSLA 5D15A 1F60B 4ZLNA 1IWAA 2GZOA 3AJDA 1XMBA 3CCZA 3TUIC 5IC4B 5L1KA 3T41A 3CDAA 3OFHA 2FZKB 4EGLA 1IUJA 5JXSA 5D3GA 3EGVA 2EVZA 2LP4A 5FLXU 1Q7LB 2O67A 3DLLQ 2KZMA 1HQEB 2K3KA 5IC6B 3TUZC 4ZIWA 5G0RB 4ITSA 1UWAA 4HYKA 4KRWA 2JEJA 2Z58B 1CJKB 2OIHA 4E0DA 2GVDB 2RD5C 3OR2A 2RQCA 3QFHA 4DHVA 2AEMA 4XPEA 1JJ4A 4UTGA 3WDOA 1MLAA 3CDEA 2P8IA 4I2PB 3QIPB 4DV4J 3T9ZA 2HFUA 1K47A 1C2PA 2FHKA 4ECRA 3M8QB 1PBUA 3LO3A 5AXKA 1SIZA 3I55S 1BY9A 1LKZA 3JTNA 5BR8F 4ZK7M 1B64A 4C2MA 1S1WB 1QVGR 5DS7A 3ILIA 1VQ8S 4ZVHA 1YSJA 3MFHA 3VAGA 2CPFA 3FFIB 3HX9A 4X84A 2NYHA 5CZVA 2XS5A 2Q6BA 3FQKA 4LF4J 3EVMA 3PNIA 1Z2LA 2VH7A 4FYVB 4KQZA 2K1RB 5E3AA 2YNHB 2DXFA 1FXLA 4U9RA 2JFDA 1V6HA 3MEGB 2IHR1 2U2FA 1U1PA 2DCUB 4A8FA 3IG1A 2FLPA 4B9VA 4MH8A 3EGZA 3J81Y 4QJVA 1WOSA 2CFXA 1CJTB 4ID5B 4LSZB 1Q8KA 1TU0B 1HKAA 3KDNA 5CHCB 3EX7B 1Q78A 2EFGA 3QWPA 2E9ZA 4JBCA 4F02A 2M8HA 3HD1A 2V4JB 2UXDF 1KD1T 2A2CA 2XS7A 2MQNA 3BYPA 1VJQA 4BWMA 4PYAA 4QIFA 3BO4A 4LF7J 4ELVA 2EPIA 3HVTB 3C14A 1WC5A 1WEXA 4ATNA 3H59A 4KFBA 4PQUA 4F3QA 5B0GA 4DPUA 3M8PB 1VQ6S 1RU1A 4YHHJ 2AZ1A 4DV1J 1FE0A 1FX4A 3GFYA 5D0EA 4MMOA 3LGNA 5IT4A 1IM4A 2R8IA 3HD2A 2VQEJ 4ZLPA 4NLOA 1U09A 1KBRA 1N88A 4DU8A 1KQSR 4KHMA 3KG1A 1OQ3A 1NPRA 4CYUA 4FXWA 4WBFA 5KG6A 2APOA 4OZ5A 5F41A 2DRDA 4DUTA 2QA1A 3I56S 3DLHA 3GV7B 1V5IB 1NO8A 2BOAA 1N33F 3HPOA 2ZKUA 4YDDB 1F0XA 4GC6A 1NJIT 2OI2A 1N5YA 2KHDA 1TELA 2LA6A 4URGA 2GHPA 2NZCA 1S79A 4OFZA 3VTIA 2MY8A 4J9QA 1JIHA 2JEIA 3G2XA 2QLWA 1UTAA 2YWEA 4IR9A 2F3JA 3CJQA 3GV8B 3EYZA 3S01A 2ZHBA 4LSNB 1Q8LA 3Q0AA 1S9GA 3FEYB 1I94J 1H73A 4OJ3A 1YVFA 5D77A 2IIHA 4ALZA 1U8SA 4GVBA 4TYAA 4JI2F 1KN6A 2FHJD 1NJWA 2PO4A 4YEAA 3R5BA 2BJDA 4MFBB 4EFAC 1FERA 2DIVA 4YQWA 1YTYA 4DQPA 5KFGA 3DCAA 5KFHA 3IWXA 3HXMA 2MB0B 2KKHA 2ZBQA 1U47A 3G9CA 3OSPA 3O1LA 1RHRB 3CEDA 3NMAA 5KFOA 3L09A 2UXCF 1JLCA 2EG1A 2EKYA 1X9SA 4ZITA 3DOMB 4RW8B 3KG0A 2QFJA 4AFFA 4AQYF 2VBXA 4S0MA 3O6QA 3IG1B 4TN2A 1HMVB 2CQCA 2CVIA 4TU8A 5CAAA 3BSAA 4U7UK 1U2FA 1K8AT 3U1MA 4B3SF 1JLCB 1NHKL 1YJTA 4NCGA 4CNYA 3IR5B 3Q8SB 4JI3J 4OX9J 2MMYA 2KM8B 2BRLA 1WDTA 2QX0A 2PEHA 4A8WA 4IR1A 3VR1A 1U1LA 4WCEQ 2CPXA 2L08A 1VCTA 3P3DA 1M5OC 1EIYB 2JRSA 3K5PA 3OPKA 1PGZA 1FKOB 1T11A 3C19A 4DU7A 1N36F 3BN4A 1S1TA 1FRIA 3KNAA 5HBMB 4F4YA 2YWFA 1FD8A 1UKUA 2HQFA 3M7VA 4QWDA 3A1YG 3B8HA 2V67A 3SYZA 4IG3B 1N52B 2AD9A 5H1SV 2XULA 3NGKA 3FSYA 1D1UA 1L3SA 4GRSA 2RH3A 3OL7A 2OELA 2VPWB 4DUYF 4F4ZA 3DC2A 2NSCA 1JLQB 2YKNA 3GIJA 3PW2A 1H38A 3GFHA 3PM9A 3KLHA 4PYDA 4WIQA 4NWBA 2FVPA 2E66A 3CUNA 1HWIA 1N34J 3THPA 3QLHA 3EZ5A 3OW2R 4A8OA 4NLGA 2GMHA 2P9GA 4PG6A 3ILLA 1HFEL 1YKWA 2YQ1A 3PEJA 4HL9A 4NMXA 1VQLS 1H2VZ 2CQIA 1TVRA 3VVTA 3EVWA 4C9DA 5FLXY 3VV2B 4ZP6A 1Z2ZA 2LQ8A 3K5MA 4RNFA 4P6QA 2F65A 4HDGA 1U0HB 1U6ZA 2HGMA 3GB0A 2JC1A 3MEEB 3PHTA 2I1RA 4PABA 3JQMA 1N6QB 2P6SA 5DG7A 3M1VA 2HLUA 3GCXP 4J9VA 1LWEB 5FIIA 1N8RT 2BM0A 2Z30B 3ILJA 1M1GA 4DFMA 4GKJJ 4QPXA 1JLEA 4TQRA 1N56A 5LMUJ 4LBIA 4LREA 4HTJA 1TZ0A 4WXWA 3BYRA 3MD1A 2J5AA 3T5JA 3R5JB 4USJC 4OV6A 5JVHQ 2RRBA 2QTWA 4BC9A 4P73A 3IR7B 4CLUA 5J2MA 1TUWA 3G6ES 3JQJA 1S4FA 2ZITA 2N4CA 4NA1A 1X31C 3B54A 4O0NA 5LM7E 5GAHU 4AYBD 4YP3A 1DRZA 1ZH5A 2SXLA 3UD4P 4UY8T 3IP0A 2C2ZB 2J9EA 2MKJA 4ES3A 2E7WA 1BUXA 3H98A 4DG1A 5L39A 3TAPA 1I6JA 4C8OA 1VQOS 4U7UD 1HQEA 2Q1LA 4NXNF 1OMSA 2RF2A 4WP9A 1ZM4A 4J90A 4DV2F 1ZOTA 2HRUA 2UP1A 2W8KA 3KUHA 4W98A 1IKWA 3H5XA 3DLBA 3J81U 2YKMB 4C8NA 4R8UA 5ADZA 4ZLJA 1UZHA 5A6WA 1CSJA 1JLBB 1MU2B 3M8QA 5BYQA 5KT3A 2YQ0A 1F1BB 1FDNA 4DR2F 1RISA 3WX8A 2VOOA 2A1BA 1X4HA 4Y00A 3CT9A 2FQQB 1RAAB 2HZVA 1GQEA 1U02A 2GAHC 3U1LA 1YJ9S 1X5PA 3W9JA 2ABYA 3W65A 3V6DA 4RWXA 4JI4J 2I38A 1EHWA 4UOFA 5K8NA 1RB0A 2QE5A 2WSCC 3I0SA 2K8GA 5DRKA 3FZ2A 1N36J 1D9FA 3ZTQA 1WKJA 3DLEA 4F04B 2YKAA 3W62A 1U7LA 3M2UB 4PZVA 1RWUA 4WZQA 4Q43A 3VAKA 4DQSA 1REVB 2PE8A 1KFSA 2VA2A 3D54A 2Z2YB 3PIOQ 5HROB 3F0NA 3L7OA 2GMJA 4Q0BB 1TVRB 3R9LA 3I5CA 3MM6A 1S6UA 2DXEA 2Y0SD 1S1XA 2KJVA 2KXFA 1J2VA 3HHLB 5L9XA 4WZMA 1B7FA 3HP6A 3FBCA 2HMIA 3D28A 1TK0A 2V8VA 5DDOC 1HWLA 2BACA 2IVYA 4AE5A 1RWWB 1UFLA 5KFDA 4ED2A 3EXCX 3K2YA 2CZ4A 4DPYA 2XY7A 3KLEA 1HNZF 4EI2A 2Y9HA 3MCNA 4K8RA 1P1TA 3PYDA 4MKAA 4MIBA 4PWUA 1MW7A 4ID8A 4X4QA 2R7TA 1NJZA 2AJFE 2MYFA 5D78A 3V4IB 2MLZA 5HANA 2E9TA 3VGTA 1HHTP 2P2CB 2PFDA 1H2TZ 1ZYQA 2OKQA 1HNVA 5D0HA 4RNHA 2VBWA 3W9IA 3M2UA 3W7BA 2D41A 1VJWA 3V4IA 2H5JB 5E7OB 4L76A 1HWJA 1REGX 1VGYA 1ZS6A 2CDQA 4H4MA 2DNKA 1MMNA 2CNKB 4KY3A 4OYBA 5CD4A 1VQ9S 3MI7X 1B0VA 2DTJA 1SXLA 1R3NA 3MEKA 4OMFG 3QGIA 3GTYX 2P6TA 2RRNA 2EC2A 2BANB 3O3LA 2M70A 1ELOA 1FK9A 4ZVQB 3SQGA 4U6PA 3BQ0A 2AGOA 4ZN3A 1ACMB 4V19X 2G1DA 4OJHA 5EUHA 2IMOA 2XMAA 1RAFB 3BJYA 2NUUG 3CVKA 3OLBA 2XYPB 3MR3A 2PD1A 1OIAA 4UZBA 1GXTA 3VALA 4RWWA 3M9MB 2VA3A 4ZLLA 2Y8YA 3RBEA 1OQ6A 1XR6A 5L8RC 4OX9F 1S1UB 2F9DA 3LP1B 2N7CA 3TEHB 3HDSA 2FJXA 4QYRA 4HHHA 2L9DA 2IVFB 2VBYA 2G0JA 1Y9OA 1V9OA 4JI6F 4Q2MA 1D09B 1EKRA 2XHWA 2LQBA 2YPYA 2FJVA 4N8OA 2UUBJ 3O2IA 3BGLA 1RADB 2CQGA 2XC9A 3KK3B 2LVWA 2G0IA 4CLYA 4AL7A 2MGZA 2PMWA 3GSDA 4WE1A 4F25A 4KHPF 2KTQA 2DGQA 2V2QA 3DYAB 4NLUA 3VQTA 1LW0B 4I4BA 4Y2CA 1LXNA 3H20A 1NEEA 4DR6J 5HMZA 3PCOB 4OZNA 4DQRA 3MFIA 4TVAB 1Q5YA 4O0IA 3FQLA 4HHUA 1Q4RA 1TL7A 4DL4A 1N6QA 4M5NA 4LF4F 2KJWA 3K57A 1SQEA 3DNCA 1VS3A 4NOHA 2AU0A 3GU0A 4IRDA 3M2VA 3MUMP 2CNNB 5LXRA 3CF5Q 2JHEA 4MYTA 2J8AA 2PN6A 2GJ2A 3IAS9 3N5BA 3NAIA 4OYMA 5C42B 4DR7F 2E1RA 2PEBA 2ZJPQ 2BABA 3N6NA 3JAMY 3CCWA 3AODA 4USVA 2FD2A 1Y5LB 1FNXH 2KFNA 1JKHB 1HBOA 1WJ9A 3ZZYA 3G71S 4B9NA 3R6GB 2DH9A 2CQ3A 2L9WA 1F2HA 1U6BA 3UWTA 4RW7A 1DHMA 2H54B 5A76A 1GX5A 4CH1A 2UXBF 1OYDA 4NLTA 3H2UB 3IAM9 1FF2A 5ETTA 2UUTA 4ZCLA 3TZZA 1U49A 3IWNC 2A2DA 4TQSA 2OTLS 1Z1ZA 2LEBA 2XLIA 4P2XA 3UVJA 3OTDA 2HHPA 4RUHA 2M52A 4EBDA 1TV6B 4BLGA 4K4TA 1NNDA 2M9KA 3MM6B 4Y2AA 5M2RA 3NXZA 1AYEA 4WFXA 3G6YA 4B17A 1TUVA 1EJ7L 2AWZA 1UFWA 2EEYA 3N28A 3UD5A 1VMBA 1VQMS 3DI6A 5KFCA 3P5TL 3PR4A 4OZLA 1TL1B 3KJVA 3IS9A 1HNXF 1FRMA 2FHOB 4DPTA 2DO0A 3GONA 5A0YA 2KH9A 2JLGA 1VI7A 2JC0A 4HR2A 1HPZB 2KI2A 3I0SB 4DV2J 1P6TA 2ATCB 4F0MA 2VL1A 4TY8A 2AX1A 2OPPB 2J0QD 1RABB 2FJAB 2X3GA 3LPYA 3PYGA 3CMQA 3PVXA 3W1YC 5ETLA 4KKOB 4Q0BA 2W01A 3M9NB 1U2CA 1VOMA 2XYHB 5AXMA 3EPIA 2KVQE 4NX9A 2HQGA 4GO5X 2MDAA 2Y3YA 3W66A 5IV4A 1DJ0A 1WI6A 4GVBB 1S1WA 5LJ3Y 4DF8A 3DM2A 2DPJA 1EAYC 1FKPB 1WD6A 2VPYB 4A8XA 3KLFB 3DLGB 3DRYA 4OYXA 4Y28C 3DXSX 1H72C 2EBEA 4FF3A 3KLHB 3CCSS 2PGCA 3F44A 3TVKA 5M2UA 1X5SA 1YITS 2GCFA 1RXOB 4NZ0A 1UVLA 1NH8A 2PC6A 2W25A 3HHKA 4ED5A 3N6LA 4QIEA 1EP4B 1QAYA 4EU0A 1HR0J 1NJYA 2BE2B 2WBRA 3SXLA 1ROFA 2ZH1A 4CYUB 2VKZG 3SEOA 3GR1A 1RLCL 1RT4A 2RAQA 4YB6A 4PQUB 1APSA 3M32B 1WHWA 1X4AA 2E44A 2QO3A 1HL6A 4DN9A 2X1FA 4Y3CA 1N34F 3MR6A 3DLKB 3BGRB 1NB2A 2HG4A 3MMJA 3OXFA 4OHZA 5THWA 2OPSB 2ZH4A 5EWFA 4RX6A 3MOJB 1AFIA 2DIUA 1F5AA 2RB7A 1VQYA 1DFDA 5F3TA 3AT1B 2OEJA 4Q7AA 4QIWD 1TUGB 5F8NA 4ZHRB 1PAEX 3HLUA 3HFVA 3T1HJ 2YWGA 5IT9U 1G1XA 2E1CA 4JYAJ 2HFVA 2V6AA 1D8YA 3D7SB 4LBPA 1K73T 1YBUA 3TX8A 4Z2XA 2BJ1A 2HHHJ 1A6LA 3IC1A 3FCWA 1B7YB 2KHCA 1ZA1B 2CZ9A 2V69A 1M5SA 3EUNA 3KK3A 2E7VA 4HT5A 1QE1B 5FDLA 4TYBA 2ZHOA 1YJ7A 4MAKA 3HM9A 3C6UB 1SL1A 3DFEA 5K14B 1S4EA 2A6OA 2HQDA 2AV5A 2Q43A 2B9YA 4I7FB 2LCWA 2CQPA 1DZ5A 2R8GA 2CPJA 2ZM6F 1IKWB 3RAQA 1TKXA 4P75A 2XBPA 3G8SA 2HVHA 4TU7A 4PKDB 1FESA 1FTRA 4EYHB 3DRRA 4K0KF 1R31A 4P72A 5KOXA 4LF2A 4YMEA 5B08A 4IQXA 4CM2A 2LXFA 1CULA 4Y34A 3BEGB 3BGUA 3TA2A 4C11A 4ER8A 2ZVSA 3LP0B 4XO0A 2WW4A 1ZPWX 3Q83A 1GFWB 1VYAA 2ROEA 3FSXA 2AJ0A 1RWOB 4WXOA 4U96A 5F0UA 5IM0B 3DN9A 4QWCA 3H40A 1KOOA 5E3PA 3C66A 4LQ9A 4DQQA 2YH1A 2HMIB 3PY8A 3R1LA 3R7SB 2VODA 3A4TA 3I96A 3Q89A 5F8HA 4L75A 5ETRA 2J76E 5KFBA 3UW1A 1FA0A 4CO3A 3NGRA 5H9EJ 2XZDB 1Q82T 2CPDA 2R8HA 1U26A 4C3LA 1BWVA 3DRPB 1NXIA 3FNNA 2EI5A 4PUOA 5A0YB 2AT1B 4MKVA 2CG4A 2DNHA 4TU9A 2C22A 2DB1A 2G13A 2RU9A 3ONQA 3SSRA 2HIYA 3QGGA 4HACA 3K58A 4ED3A 1VC6A 2PMHA 1YIJS 2QLJB 2Z8QA 4LIWA 3IM9A 4IO1A 2HZAA 1K9MT 2A10A 1HW9A 3DYAA 5CA5A 4JV1A 1R6YA 1LNQA 1X4GA 2RIJA 4FNIA 5E3RA 3CSKA 1DTQA 2KT2A 1ZBTA 4J37A 3D2WA 5B0BA 4DS5A 4K4UA 3L95X 3RB6A 1KVKA 5KG4A 3OQ2A 1HBMA 2VG6A 7FDRA 1S97A 3CD0A 4PWWA 2DEJA 1DTQB 2XSJB 2W8LA 4U7CA 2CA9A 4ZCMA 4QBUA 1RACB 4RU2A 1H3DA 2DGXA 1S7HA 5HJYA 2QGFB 5L9NA 1J5EF 2ZC4A 3CO0P 2ZHAA 1D9DA 2DHSA 3PEHA 2CADA 5SZTA 2F40A 4KYZA 5GMKa 1B99A 2CQ4A 2W2PP 4Z7CA 5KAKA 1VQSA 5AJ3F 1NKBA 1PAUB 2WVEA 3K5NA 1NKCA 3S6EA 1KQKA 4K4YA 3EJMA 1S6QA 3IN5A 1S9EB 2QL9B 1UAWA 2MZRA 5KG3A 5GAHI 2W4PA 1GT8A 1EQMA 1UCNA 1NJXA 1OSDA 2N7YA 3HHLD 5CYQB 2ZH7A 2YWHA 2EFNA 1HHSA 4DPWA 4X65J 1F3FA 2ATLA 4WFZA 3OFGA 1W26A 5B0DA 3LANA 3NS7B 1SJRA 2CUYA 3W5XA 2CWKA 3CXCR 4NLPA 4OYZA 3OVAA 3CCRS 2DCLA 4DUZJ 3GLJA 4F26A 3CW2C 2F7VA 1BQXA 5E3CA 2L3MA 1RAHB 3WBZA 3HMJG 3R5CA 4KGZB 4P7VA 3KMSA 2HS4A 4A8SA 3Q8PB 1YRUA 5L1IA 1NLKL 2DHGA 2HGNA 2HNDB 2KL8A 8ATCB 2CIMA 1SPBP 3RAMA 2EK6A 2MKKA 1N5VA 1RT2B 1T02A 2J7KA 2PDAA 3BGOP 3CJ4A 2GVZB 3ENWA 4WYWA 3SI8A 3ZZOA 3EVOA 3M2RA 5LXYA 2A6MA 3A8KA 1PJ5A 4ZVTB 5GVQA 2ASJA 4ZJOA 2KFZA 1F3VA 1PC5A 1RBLA 2L41A 3MCSA 4FVMA 4LVNP 3ZZTA 5I3QA 3TA0A 5DZ7A 1FD2A 5JJBA 3HHLA 4ZPCA 1Q0NA 3RJMB 1XK8A 2CZVC 3C16A 1HR0F 4DV6J 2Y8WA 5F8JA 4ZVSB 1PYTA 5EWEA 1CS4B 5D0RA 2NXEA 3OXLA 1FKPA 3MGJA 4JI6J 1RWNB 1LWEA 1A9NB 1U24A 1UL3A 2VD3A 4OI0A 2J9DE 4YR2A 5FJ4A 3X1LB 2AEFA 2DKOB 2FUG9 2NSBA 4DV7J 3JXOA 3W8PA 3LWLA 3KFWX 5IZHA 3KJVB 3CCQS 1VHIA 2BW7A 4ECSA 2CQ0A 2KB2A 2P9CA 2R3VA 4ED6A 1RTDB 1OPZA 3QGHA 2MHNA 2X3DA 3K7RA 3MM8B 3HT3A 4DR7J 1N32F 5L46A 2HBYB 4AL6A 3PX4A 2OPPA 2AHOB 4U8YA 2GVZA 2C2OB 3ULHA 2MGZB 1WHXA 1SBRA 2XQCA 2B4OA 1RLDA 2QLXA 3ISNC 5LOQA 3W60A 1WSRA 4IFVB 1X4DA 1WKKA 2QN6B 2WBMA 4HVZA 4OYPA 3BO3A 1S1VA 3EDQB 4B02A 4M95A 1IBLF 2FZCB 2HVEA 4X62F 5AE1A 4WFBQ 3QGPA 1GMVA 4RBUA 2ALYB 2CQ2A 4I69A 1WUUA 1NK9A 2MHEA 3I4HX 3FGVA 2Z57B 1V3SA 3MM5A 5IQQA 5KFEA 1O51A 2KXHA 3BSCA 4RUBA 3MM9A 3K59A 1U45A 1JLGA 3KG4A 3LQVA 4M5MA 3UDLA 5CXTA 3DOKA 4U8VA 4FKXA 3GMGA 1YG0A 2EFVA 1YJUA 3KLGA 4JI2J 2DK2A 5B0CA 3I6PA 2ZZTA 2B9EA 5AE3A 1FJEB 2CPYA 4RW7B 1FJGJ 4KV8A 3J7ZT 4EUVA 1PJ6A 1VRTA 3BKFA 3ZTRA 2HGLA 1IVZA 1TKTB 4Q2LA 4N47A 3PG9A 1FWKA 1SC3B 1XWLA 3UDVA 2RE1A 2YPZA 2NPIA 3DRRB 5KFNA 4R0EA 5KFAA 3OL9A 3IWLA 3AD8C 4L6V3 5LMNJ 4DOZA 4C0HA 2XMUA 1TKXB 2FLNA 4C11B 4RNNA 2R2UA 4YR0A 1ZZFA 2RNEA 4I68A 2PT0A 3R8YA 1RT3B 3BREA 4L3KA 5D0GA 4NLDA 2XEXA 4OI3A 1Q8BA 2ZJQQ 3IGVA 3SDEB 3U1NA 4A8YA 4KIAA 3M30B 4FVCA 3LA0A 2IAJB 1VBKA 1RT1B 4LRCA 2VQFF 3W2VA 1HHQA 3K5LA 3NGUA 3G82B 4PG5A 3MMCB 2R7XA 4OZ1A 3I0RA 1VQPS 2KG1A 1JLQA 2CJXB 2YKNB 1IXKA 4QW9A 3Q2TC 3KUEA 2WOMB 3QWUA 1WOPA 2DNPA 2JFKA 1JB0C 2RDDA 3CJKB 3KK2A 3SZ2A 4WU2A 4DBQA 3C46A 3THVA 3T1YJ 1I3OB 1H6KX 2K2PA 2IBOA 3TA1A 1VRTB 2W4CA 3CO9A 1JXEA 2DNGA 2W2MP 4B3OA 5EN1A 1B0PA 3TRGA 3CJRA 4Y2MA 1HYSA 4F4KA 1F9EB 1GMUA 4LFBF 3A8EA 1Y11A 2NXNA 5HVGA 2DNZA 4OV1A 3JSYA 4PXCA 5BJRA 4LRFA 2HYIB 2RILA 1LW2B 2D3O1 1VBZA 3C6TA 1IR2A 2LXIA 4WTYA 1RWXB 2B51A 2ASDA 2I0XA 2W1BA 4JP8A 2RUGA 1XC9A 8AT1B 2VB6A 1S48A 1ULRA 2IM1A 2Y1RI 2FVRA 3C15A 2B9WA 1NSAA 4DX5A 3R3TA 1QAIA 1PSDA 1X4BA 3BB5A 3H5UA 1WI8A 3BKUA 5J2NA 3QT7A 1X0FA 4RBVA 2DISA 1FFSB 1KLMA 3VCDA 1SL2A 1FRKA 3HKZD 3NGDA 1C4CA 4DN0A 3DDNA 3BDPA 2X51A 2Y1LB 1X4FA 3QNWB 4HHJA 5HLFA 2RHQB 2EKNA 4X4PA 5DGBA 2ZBPA 4P52A 4FXDA 3B78A 3LGHA 2ACMA 2W7AA 4AXJA 1JLFB 4O3QA 4DV1F 3Q23A 1TFWA 2ZWPA 3J80U 3SIPB 3L3CA 2ZE2A 4LF1A 3GYXB 5LJ5Y 1NB7A 3FBFA 4IDKA 2ILZA 3OL6A 3MDFA 2ASLA 1DQ9A 1GTEA 1X5TA 1LW2A 1Y3JA 1REVA 3HVWA 3NBPA 4HEA9 4OJGA 3UN3A 5A8WB 3M6UA 2ZM6J 2BQUA 3HHNB 4ZDNA 3VAHA 3Q8QB 1Q1KA 2GGPA 4PG4A 4WK3A 1WG5A 2MZ1A 3KLVA 3PO5A 3IA0A 1NK7A 3VHQA 1FT8A 2FHMA 2VPXB 2W9CB 4HH0A 2C28A 4QU6A 2OAUA 2HVIA 4DL6A 4DQIA 4RU9A 3RW6A 3I9V9 3FEZA 3TAQA 1VLYA 3DRSA 1G3OA 1G7CB 2AP6A 2DJWA 2H51B 3GG0A 4OI4A 6AT1B 3K8VA 5IS2A 2Q6CA 3MM9B 4FXVA 4GO7X 3P49B 3VVUA 4C48A 2DRBA 4TLQA 2HNDA 4DV6F 5AE2A 4Y0FA 2DR7A 4ELTA 2GVDA 5E0OA 3ENQA 3CTRA 3PTWA 4YB7A 2W9BB 4B9SA 4JUZA 1M1HA 2QSWA 2ASYA 1RT4B 5H9FK 1Y5IB 2YNGA 2KG0A 1UEKA 3DM2B 1OY6A 1RWMB 2PA8D 4DZDA 2R7RA 1VIOA 3Q2SC 3ZZZA 2ZJRQ 3U7JA 3CMES 1T95A 2NXUA 3B82A 2V8HA 2RVJA 4F3OA 5H9FJ 4DR4J 2R7OA 1EX8A 2NXJA 2MKSA 1JJHA 1R8PA 3UI3A 4QR2A 3W61A 2YNFB 2FLOA 4IG0B 4AQYJ 1J5OB 2AJQA 1PJ7A 3MECB 3TVZA 4CP5A 3D0IE 3HCXA 4RW9B 4O44A 1RBOB 2I6WA 3DGPB 3IMQJ 3AOCA 1QSYA 1ZAVA 4O4GB 3MPWA 5IOLA 1UWBB 2KYXA 3TO8A 1PG5B 2RKIA 3V81B 2R7VA 2E5JA 3X3UA 1UVIA 2DNQA 5EX3A 5IWAJ 1NK0A 4I64A 3BR8A 4LRBA 4TNOA 3RTVA 1LOUA 2VDIA 1UETA 4X62J 4LF7F 3R2CJ 2XMVA 2IRXA 4LF6J 4CO5A 2J6UA 3BPDA 1K1QA 4QIVA 1C1CB 4I6WA 2AF6A 2V2VA 4PG8A 1WWHA 2BKNA 4URSA 3JTPA 4ZA1A 2M7SA 1SVDA 4NYZA 2ZOGA 2ZH9A 4C8YA 4DMZA 4DR5F 1UVJA 1UJ5A 1SQFA 2WSEC 2YBVA 2R2TA 2F8MA 4RW6A 3MWBA 2VG7A 4EZ9A 3WX4A 1JLAA 1RQ0A 3M2RB 1Q5VA 4B9TA 1OO0B 3PACA 4KGMA 4RPFA 4IFVA 3TR5A 2AEJA 3N01A 2C3UA 2RQ4A 3BSNA 1Y10A 3M1VB 4I56A 1OWXA 3E01A 1F5BA 3KLIA 1WF0A 4I2QA 3ZZ0A 2GQQA 2GO9A 4DX6A 3ZNJ1 3MMCA 2RT3A 4DF4A 3ET6A 1DQ8A 2XMWA 4CIOA 1LWCB 1CJVB 1JKHA 1S0NA 3TX0A 3CGIA 2LXUA 3HKWA 3HF5A 3MPYA 3LW5C 5HSPA 2XM3A 1PIEA 1TFYA 2LYVA 2ZOFA 3BS9A 1JNZB 1D9AA 2C3MA 2G2OA 2J9CA 4KGVB 3RBXA 3TARA 2HWTA 2QLFB 4M5DA 5D4OA 2ROGA 2Q79A 3U27A 3S8SA 1I94F 2MTLA 4PUOB 1T9XA 4N5SA 4WP3A 3T5KA 4J91A 1E6VB 2JDJA 1SI9A 1HBNA 1KTVA 2HNYA 3ZZPA 4YY3J 4H4OB 5LSRA 4G1PA 1OSCA 3NNHA 2VG7B 1FXRA 1QTNB 1XR5A 3LTOA 2GA7A 4WIIA 5E5NA 3US5A 4USUA 4N76A 1EB0A 4GVLA 5CH7B 4A47A 1YRTA 3UCZP 3L4BC 5CCMA 4Q8EA 1IR0A 2RS8A 3POTA 2Y0BB 1V5VA 3CD5A 5HAOA 4G65A 4F4WA 2IM0A 2Q66A 4U95A 1PYOB 1P8GA 2CJ9A 4DX8H 7FD1A 1FFWB 3KK1A 1RAEB 1R8HA 2FJDB 2X1AA 5HATA 4JI7J 3SCKE 1GMWD 1CQNA 1R6VA 2Z0GA 2RRAA 5HQMA 1HD0A 1Q7YT 2OTJS 4KO0A 1GX6A 3OLAA 5D3GB 1UW4A 3BBCA 2HNZB 3DHXA 5I4MA 4LVOP 4B08A 2M5YA 3PDNA 1IKXA 3KNGA 1RGVA 1SJ3P 2QEXS 3UO0A 4QOTA 3KHLA 2NREA 2PSZA 3C3LA 3CD6S 1FE4A 1QE1A 4RJVA 2BQRA 2MZTA 2M8DB 1Z4UA 2J9DA 5JVGQ 4ZS6A 5L1JA 1RHMB 2H5IB 4W92B 3GFXA 3NEKA 3VAFA 3MAQA 5D4LA 5K9FA 4LMZA 2V34A 3BQ1A 2AMCB 1S72S 1NHVA 4CO0A 5J2QA 3NMRA 4G1IA 1V3ZA 2AJ2A 3HSDA 1L3TA 4J9UE 2KU7A 2CQHA 1MU2A 3HT0A 4C8MA 3RU0A 2G9OA 1TKZB 4IO9Q 2LDIA 2MQMA 1UA1A 4LF6F 3OJUA 4FYYB 4JOUA 1TL4A 4XDDA 5KFYA 3FFIA 3J80Y 1S57A 2RDJA 2OD4A 4NEZA 3VWSA 1WTBA 1DY3A 1WHVA 3M05A 5A6PA 5HMWA 1EQ0A 1RCOB 1B0TA 1UPMB 2B7CB 1SKRA 4NZ6A 1T03A 2WCXA 4OJ1A 1D0EA 4C8KA 4LF9J 2HRTA 5GMDA 2XLJA 1YI2S 2VF3A 3D5MA 3ZTSA 2BDPA 4FN5A 4RUAA 2D74B 3KHGA 4R5PB 1QLNA 4UZCA 3I5AA 1NCLA 3UN5A 2KVIA 4PWDB 2OGUA 4UOGA 4R25A 1O6XA 3NKYA 3DMJA 2WONA 2MQQA 3H5SA 4USTA 5T14A 5J2QB 2YX7A 1U2RA 3A3NB 1ITPA 2VV5A 5FD1A 4CRJA 2A18A 3BR9A 3GV5B 2HW3A 5KFVA 1EETB 3D1OA 4W90B 1RTIA 1QM9A 2BJ9A 3M6VA 3TZWA 4F36A 1BGXT 2CAJA 2EW9A 1S5ZA 3DLGA 3ZC4A 1R0AB 1CG2A 1MG7A 3DLKA 5LMNF 2VQEF 2H9ZA 2OFHX 4USIA 1EETA 2DITA 3R5DA 1LEOA 1VHFA 1Y4ZB 2B43A 3DHWC 4DR3F 3I82A 2BE7D 3MPUB 3QPIA 2NQPA 3ZFVA 1OPIA 3BH7B 4OZ3A 1U1KA 1M5PC 1IQZA 3CIZA 3VGVA 4ZHRA 3ETOA 4Q44A 4DZ6A 2C2EA 5HP1B 1NKEA 2ZBIA 2YKQA 3JSRA 4LFAJ 3W9HA 5CABA 1QTMA 2NCKL 2DNNA 4RW8A 2R7QA 3AA8A 1N0UA 2B9XA 1FRHA 1XIQA 3RB0A 2AYBA 4ECUA 3M8YA 4HI1A 3J7Z5 3CCES 1U1NA 2MPUA 3AB4B 3SQGB 1H98A 2BE9B 4BBYA 2OH2A 3BGRA 2E1MC 4DCOB 3HVRA 1JLBA 4ED0A 4DL0C 2MZQA 1CPZA 1EZZB 2BRKA 1HNWF 2WVDA 1QVFR 3BF4A 3NG8A 4CH0S 3H4DA 1RWVB 4ICLA 4C0BA 5HP1A 3QRRA 4M94A 3BBFA 5H9EK 2HBRB 1X9MA 2UU9J 4JV0A 5DGAA 2IA0A 4CH7A 1YBAA 1AZSA 3FSIA 3QJJA 1C1BA 1T94A 2GQCA 3CJKA 4DR5J 4YB1P 1K0VA 3TEGA 4B3SJ 1WSVA 1TP7A 3AFGA 2MLXA 1KLNA 4LF8F 1XNQF 3FVYA 4YDXA 2DEIA 4XAKA 3PZPA 4OZJA 4RL1A 2RSQA 3R7BB 2EBGA 2J7WA 2GO8A 3MCMA 2VU5A 3TW0A 2IM2A 8RUCA 5KG5A 1BD6A 2W9AA 3HVAA 1HPZA 3ZZUA 1Y5NB 2CPIA 1RCXB 2PMZD 2BV3A 1WF1A 2YKPA 4LR9A 2E1AA 3GIRA 3QZ8A 2ZBRA 1W25A 5BYSA 2DHHA 2ZC3A 4B3TJ 5CYJA 2V8GA 4QWEA 1UVMA 4ILLA 1QAXA 1S1TB 4X4OA 1FJCA 2YVSA 5LSLA 4A8KA 5HN0A 2B5JB 1ZM9A 1L5UA 3NGSA 3GPAA 1RTIB 1HI8A 4OI6A 2UV8G 5ETMA 3RBZA 4NZ7A 1WC4A 1NRKA 1HNIB 1SH2A 2YNIA 3MCOA 3V2UC 5JUMA 2KM8C 1IKYA 2JLFA 5D4PA 4NMLA 5F8MA 2QSFA 3Q8UA 4LIRA 4BDPA 3SCJE 2W2NP 1UVNA 1WC6A 3IO1A 3MR2A 1VRUA 4CLSA 3C2PA 3OUYB 2DGOA 2GJIA 4YY3F 1HQUA 4WPAA 3GYNA 4X4NA 2ZH2A 2HAFA 5KFRA 3B4DA 2GW8A 3E2EA 4IRCA 1IKYB 1FDDA 4DPXA 3I0RB 4URQU 3J7YU 4JI0J 2J0SD 2CJBA 1MWZA 4DLGA 2HHTA 4EMDA 1X4EA 1VK8A 2PIIA 4H4MB 4PR6A 2R7UA 3GJQB 1T05B 3VQSA 4OYWA 2DVIA 3O5TB 1UEVA 1QSSA 2HFZA 4XIUA 1VQ7S 1HBNB 5C25B 2ZUGA 3TJAA 4OYIA 3UPFA 3SBMA 3AHPA 4GKKF 4DV0F 2V63A 1S7IA 4HKQA 3MMAB 2CQDA 4QYZK 1WG1A 4DV3F 2FHJA 2MQLA 2YX1A 1N5TA 4V1Ak 2RS2A 3A12A 1A0OB 2JJ4D 3DMJB 3FC9A 3RGIA 3RRKA 3PYFA 3RZAA 3TVYA 1IBMF 1YQHA 4IUFA 2FJBB 1R8BA 3CJ3A 3D0GE 4J5OA 1VBXA 4DJBA 3LP2A 2UUBF 1S1UA 2EFQA 3LP1A 3GIIA 3HHEA 1X9WA 1C0UA 2CRLA 1NSKL 5KFIA 4ETXA 5HO4A 3TJ8A 5J2MB 3DRSB 2B4VA 3OL8A 2G2YA 4NYOA 3KOAA 1NDKA 4KHPJ 4DFKA 4E8UA 4JV2A 3R97A 1RAIB 2U1AA 2XY6A 4NASA 3AAWB 4DR6F 3LAMA 2XS2A 3M8PA 2AGPA 3I5BA 4B3RF 2UV8A 2HNZA 2VFSA 5GAEU 2R4FA 4G1QA 2WRMA 2UUAF 1K1SA 2HSEB 1RBAA 1IQTA 3PRVA 3MMBA 1F9HA 3N9UC 1X8DA 4B9MA 2G4BA 3T5HA 4N77A 4YS2A 1VQ5S 3JAMU 2W24A 4K2JA 3NCQA 3VAIA 2M4MA 4K4VA 3PO4A 4M5GA 4DS4A 2IJNA 5ETOA 2MKYA 3D66A 4TKTA 4DL7A 1Q86T 4FBTA 1NZ8A 4C6AA 1G4CA 3AOAA 3QIPA 1S1VB 1JXLA 2XLKA 1WC1A 3V6JA 3HJFA 1XMOF 1W7WA 1IBKF 3KJQB 1MWYA 2B8PA 5IWAF 1J5OA 3AQPA 2KN4A 1F2GA 3NL0A 2BJ3A 4L74A 5HMYA 1LWXA 2UXBJ 1KDNA 3VF0B 2IYIA 5EWGA 4OHWA 4IOCQ 3PW4A 3NGTA 2V4RA 4DR1J 2VIHA 3M9OB 4Q8FA 1UP1A 3TQEA 4GMKA 2DHAA 3I9ZA 3CCLS 2FC8A 2C42A 2UVUA 1T03B 1N4LA 5K14A 2XCPA 3U02A 1BMQB 3DDKA 4DUZF 4QW8A 1LQ9A 3DOLA 3QSIA 2AGQA 4ELUA 2WW8A 4USKA 3LH2S 1N5YB 2FY8A 1JQGA 3NLCA 4KR0B 3IFEA 4LJMA 1KQFB 2AQ4A 1SCJB 4PWDA 2XG8A 3N5FA 1CBKA 2W7OA 3LUYA 1YZ7A 1FRXA 2OUGA 4DR3J 3R5GA 4BC7A 2HHUA 2HHHF 1CJKA 4NCGB 7AT1B 1W2BR 1T8EA 1M1KT 1FXDA 4NYPA 3AOBA 2OMOA 4NA2A 4ZVUB 4ED8A 4ZVGA 4NE9C 2HQIA 5IQ6A 4CTAA 1M5KC 3HJVA 1FX2A 1YJVA 4F7VA 4ZVFA 1C0UB 2C2RA 2J6TA 4B9LA 5LT5A 3MECA 5J1PA 2X1BA 1B4SA 3I31A 1UPPA 2KRBA 1CC7A 3DLJA 3UE2A 5DQHA 5I3PA 1WNEA 2BUNA 3MM7A 5BR8J 3HK2A 3DU5A 1X60A 5ETNA 4FP9A 1CLFA 4O23A 1E6YB 1HBUB 2IRYA 5A8RA 2GHVC 1KWMA 2H48B 1SQGA 5AXLA 4CI0B 3VAJA 4ZPBA 2CQBA 2V4QA 2J0WA 3C6UA 1PC4A 3HHDA 3BGFA 3D4JA 1MMLA 3W63A 4C3KA 5AXNA 3KMQA 2YNFA 2ZUAA 4I2PA 2WONB 2XTJP 2GFFA 3MF5A 4ZKAA 2XO6A 3QJLA 3T19A 3G96A 1RDRA 4B3RJ 1T9VA 2VHGA 1GK8A 1QDUB 1X0PA 4XTTA 5HBMA 3K8WA 1MSWD 3CC7S 1CULB 1XN9A 3OXGA 3UDCA 3TUPA 4ILRA 3NP5A 3NS5A 4L73A 4BCAA 1R8CA 2OPQA 1BQNB 3LOUA 2DH7A 2HPUA 1S9FA 3KJFB 1BQMB 4WP8A 2DPIA 1S49A 3K0JA 1FKAF 4B3TF 1T9TA 4NL5A 1JX4A 2WB1D 3PHEA 2FGCA 5K20B 2DR9A 2QRRA 1N5QA 2CYYA 3DRPA 2DY9A 3O44A 4FKYA 2ADBA 4IYQA 3MEDA 1IBKJ 1TL3A 1UEUA 2HFNA 3NWRA 2V8DA 1HMVA 3OFEA 4NLQA 1S10A 3CJTA 1LW0A 1VFJA 3K17A 1AUDA 2BEFA 2CXEA 4LF9F 2W4DA 2VFVA 1OJ4A 3OR2B 3CMAS 4B9UA 4DSKA 1DAXA 4K4ZA 3AJ1A 3T1HF 2CJAA 2DBBA 2VBZA 1T3NA 4J9LA 3CCTA 3RB3A 4DR1F 2PI4A 1CQMA 2B8QA 4EK2A 3CDBA 2JVRA 2DGTA 4ZN1A 1GAOA 4ECZA 5HK4A 4LF5J 5D4NA 4DCJB 1X4CA 3EGWB 1TKDA 1SKUB 3UQSA 2AZ3A 2VG5B 4NLSA 1NDCA 5ETVA 1S6OA 2ZZMA 4I1TA 4WFNQ 5RUBA 2IVMA 2E5GA 4IG3A 3OFFA 3W2VB 3E8OA 4O3OA 2VOPA 5B0EA 1J27A 1VQNS 2ZH5A 3DKDA 4PXBA 2DNYA 4M8LA 2QA4G 2FYXA 1P9QC 4P74A 1HARA 3OBIA 5EX0A 1OY8A 1X5OA 2C1EB 2R2RA 4DV3J 4MTPA 1SUQB 1S12A 2XMKA 1RTHB 3AQOA 1Y3KA 4PQAA 1FVQA 1FTCA 1F9FA 5J2PA 1RT5B 1RHJB 3G87A 5L1LA 1S0OA 2V5HG 4HT7A 2VKRA 2C2KB 4LT6A 5J2NB 4F4AA 4NLXA
chains in the Genus database with same CATH topology
2ZFHA 2MKCA 3FMBA 5A8WA 4KTQA 2XNRA 1L3UA 3TYTA 2O5DA 1RT5A 3G4SS 2O01C 4CZCA 3GQCA 1G6BA 3MTJA 1M0SA 4PXDA 3OR1A 3RW7A 2OPRB 3TUJC 4A4JA 2JZ5A 1Q79A 3SDEA 4NRTA 2QA4S 1UMJA 1XEZA 2PA3A 5DM6Q 4N41A 5KG0A 4K4SA 3HVTA 1S0MA 1RT1A 4Y2KA 1SL0A 3G6VA 3PR5B 3GILA 4O44B 3G8TA 4FS2A 4MIWA 4TLRA 1JK9B 5HQ8A 4XPCA 3V4MA 3TQ1A 3PKYA 4ZVEA 3IGNA 4QR0A 3H25A 5KG2A 4J9OA 5F9NA 4EYIB 2ROPA 1SKSA 5B7WA 3MEGA 1AW0A 1QJHA 3PW5A 2DH8A 2WAQD 3RYLA 2VUGA 5KOWA 2R9LA 3MMBB 1FO1A 2QMXA 4UQTA 4CCHA 4DV7F 4PCQA 4MJKA 1HW8A 5KFSA 2UU9F 2NZ4A 4LSNA 2FB0A 2OPRA 4NLVA 1ZTTA 5KFKA 3V6KA 4Q5VA 3RR7A 1XR7A 1SKWA 4JI5F 3TP2A 2HVZA 3V6HA 2YH0A 3C8YA 1Q53A 1R27B 4IQMA 4G3IA 1GH8A 2I5JB 2VASA 1KQGB 2BBEA 3N4WA 3F73A 2DNMA 1MROB 3BSOA 4IKAA 3S1TA 5A8KA 3EXYA 1RP5A 1WF2A 2AW0A 4RW9A 3GR0A 4DSFA 1JJ2R 4OX7A 4RKUC 1HI1A 2AYEA 1KRPA 1Y00A 2IA6A 5DQGA 2RDIA 3JB9k 2D1CA 4I7FA 3CC4S 3CWJA 4PPZA 4LUBA 1R0AA 3AB2B 2Z2LA 2OFGX 3T9NA 2LQ5A 2L48A 1V3RA 2KRRA 2B3TB 3QJPA 1FJGF 4X4UA 3ITHB 3HZEA 2CVEA 4KC5A 3QIDA 4BHQA 4U67Q 2ZBCA 1NU4A 3I87A 4QWAA 1YHQS 4KE5A 1Q16B 2W9CA 1ZETA 2MY7A 4UQGA 2AJ1A 3OV7A 1NHUA 4WFAQ 4WFYA 4EBCA 1JLGB 3RRHA 3SCLE 2B4UA 5DG8A 3OTBA 3M8SA 4OX6A 1Q81T 2YNHA 2FLLA 1JWWA 4PG7A 5M2PA 4RW4A 3CB4A 3SFGA 3GIKA 2VFTA 1VBYA 3H2LA 3W3SA 2E5IA 4KGKA 2BA9A 4UW2A 5KFXA 4IH6A 5C24A 1CVJA 3OSNA 4RBTA 2IMWP 1QUVA 2GC8A 4LSLB 3GWCA 4FBUA 3BM7A 2EFPA 3TAMB 3Q8RB 5KFQA 4XK8C 3LWMA 1NK5A 1DURA 3QAEA 4P2SA 1KC8T 4NXMF 2Z2MA 4C0OC 1Q8IA 2COLA 3LP2B 2W7PA 1M5VC 4JI3F 2P9EA 1ZZNA 2LU1A 4ECVA 2IAJA 1XERA 2GNKA 1HQUB 3H2VE 1BQMA 1FVSA 1YGYA 2XI2A 3T6BA 4OZ0A 4LF5F 3OTCA 4M5DB 1S76D 3E3XA 1TAUA 5KFUA 2RMLA 3M6WA 4H54A 4WYLA 1T05A 2DR5A 2DGVA 2B5JA 2B4PA 3OTEA 4DSEA 5GADI 2VZ9A 3M4XA 2R2SA 1XNRF 2BR0A 3OVBA 2V94A 5L38A 3H4BA 4EZ6A 4DFPA 5CQGA 1C0TB 1P1LA 3PRBA 4NCBA 2V4JA 2MQOA 2OSQA 1FRJA 2CPZA 3JSMA 2C2DA 2BANA 3PKMA 2CKWA 1GXLA 3NAHA 3FJ2A 2E7XA 5A2QY 3MEEA 1C0TA 1EP4A 1SJ1A 5J1EA 1O0PA 1LWFB 4OLPA 2ERRA 2KT3A 4IG0A 3ICLA 1SJQA 2OSRA 5KTQA 2PI5A 1DBDA 5T41A 1WTFA 1ZAWA 2F8EX 5E41A 4MK9A 1U1MA 3EZUA 1RTDA 2D9PA 4FYDA 1HD1A 1X7VA 3PRDA 4NA3A 5MLCV 2BM1A 2DGUA 3RW6A 3MMAA 5FDLB 3TOQA 1FEHA 1AXQA 3FMWA 1WACA 1RA7A 2IRUA 2EC0A 4C4WA 4PPDA 5CYMB 1KS2A 4OIXA 3L7PA 3S7RA 5IXUA 5LMUF 3PXGa 1ZM2A 3O8WA 1R7IA 4DL5A 3EGNA 2LU2A 1IN0A 3HI9A 3MD3A 4K5SA 1RYRA 2LQJA 3F41A 3LP0A 4QZVB 3T1YF 2F8HA 3QYYA 4O3PA 1IJEB 1LK7A 1FDBA 4ECWA 3MUTP 2ALZA 2OPSA 2H5EA 5J1NA 4X4RA 5KFJA 2EG2A 3SMZA 1P27B 3OTOF 4H4KC 5F0WA 3SV3A 2GV1A 2DGWA 4K59A 2UVRA 5F8GA 1HYSB 2XZWA 2JSXA 4O3NA 3FZBA 4QYZJ 3P96A 2VC0A 2L9NA 2D3OR 3AH6A 1N48A 2IBKA 3Q24A 4F50A 1HI0P 3F56A 3CJ2A 1RI7A 2LDYA 1KONA 4MYUA 4XDCA 1YRXA 3H5YA 5HROA 4MKYA 5C24B 3BQ2A 4X2BA 3M8RA 1SH0A 2K3IA 4MFBA 4E98A 1AROP 1S1XB 1NAQA 3OHAA 4LSLA 5D6GA 2JLEA 1D3WA 2HFOA 1JNRB 5DLGA 4ZPTR 2YX4A 3G6XA 2HQ3A 3HHLC 1S6PB 3UFCX 4ICLB 1KFDA 1GNKA 4EO6A 2FC9A 2ZD1A 2QV6A 4TXSA 4JI1F 3WC2A 2BZ2A 1KR4A 2O1PA 2OD6A 1H7WA 1KTQA 1OS5A 1MMDA 2XWXA 3FDSA 4L72B 2N3LA 4KV8B 2YTCA 3T6JA 2BW2A 4C3MA 2FIUA 2VFRA 4WKYA 4ETZA 1U6FA 3TNVA 2GIQA 2RF2B 2QZ8A 4K4WA 2JH3A 4YHHF 2Y1JA 4RLEA 2RQKA 3SFUA 3MM5B 1FEEA 5KT4A 1RKJA 1SB6A 4NRUA 3KHHA 3UD3P 4UOCA 1NK4A 4QU7A 3IS9B 2P5VA 4DSJA 2K1RA 4D3HA 2ZNZA 2BQ3A 2KXNB 5DQIA 4OL8A 3W2WB 1TL5A 2XMJA 1D8ZA 3IXQA 1KOHA 5EGYA 6FDRA 2HHXA 2NR0A 2FTRA 3JTOA 4DR4F 5A8KB 1CEZA 4RUCA 2ILYA 3MM8A 1TL3B 1YJNS 3BZQA 4EEYA 2JEGA 2OP5A 2MXYA 3GFZA 1C4AA 1C1CA 3VZIA 5CCLA 2KFYA 2WSFC 1O8BA 5DDQC 2MQPA 1GXUA 2J0XA 4V19J 4X64F 4DDFA 1FRLA 3M32A 4NLRA 2CJQA 2XGQA 3N79A 2B56A 3OR1B 5T7LA 4QIGA 2DD8S 2XWYA 3LAKA 1S9GB 2HS3A 2UUWA 3ISND 4NPOA 1SV5A 2XY5A 3MURP 1TV6A 2LEPA 3LF0A 4ZCIA 2R8KA 3LGMA 1S99A 4YOEA 4OHVA 3PX6A 4FZVA 2VONA 4C8LA 1N0VC 4ZPVR 3I32A 3IRWP 2XSJA 2Z4PA 4DV5F 1ZAXA 1LWCA 5E33A 5IT0A 4TY8B 4CQ1A 1FNMA 1KLMB 2LQ9A 4J9RA 1PO6A 1WHYA 1WG4A 3OJSA 4Y2IA 4HH1A 4J9PA 4JYAF 5A8RB 1IKVA 4WU3A 3QMQA 4JI0F 2YNGB 2C3OA 4ID5A 1DQAA 4A8MP 1U1QA 4ZP8A 4LQ3A 4IH7A 1BLUA 2W9BA 2AYGA 3G8QA 2MZJA 2V9KA 4NLWA 2E5HA 1L3VA 2C3YA 4WF9Q 4Y65A 4OI1A 2K7KA 2MSSA 4IH5A 4J9SA 2DNLA 2J6SA 4FF2A 3POTB 3R1HA 1VK3A 1U48A 3OUYA 3T5LA 1PILA 2XNQA 5SUHA 1FCAA 4O4GA 4K50A 1URRA 5J2PB 4A46A 1H2UX 4CNZA 2V2KA 3CCVS 4HLBA 3ISZA 3IBWA 1LFPA 1E6YA 1HBUA 2ZE2B 1R43A 4H4OA 5CYMA 5E2QA 1RT2A 1TQLA 4IOAQ 2M2BA 4JI7F 2OO4A 4EBEA 4O3SA 5HMXA 4KJIA 4PXEA 4ES1A 2GHWA 3CCJS 2QA2A 3NNCA 3HFKA 5I42B 3AJ2A 4KHRA 2D7SA 4MKBA 1ZTWA 5CZXA 2BOPA 2M0GB 1KHWA 2JL9A 5KFLA 3CPWR 3CDUA 4FNHA 1ZPVA 1DLOB 2JWNA 1C1BB 4I6AA 4ZPDA 3D1QA 4C7QA 1LFWA 2NYIA 1R89A 3NNAA 2JEFA 4KB7A 2O3DA 4ERDA 3MAHA 1LK5A 5C42A 2Y1IA 1KVJA 2HLTA 2Q3PA 1VRUB 2V0NA 3UNGC 1SUQA 4F2RA 4FS1A 3W2WA 3NWGA 2ZNYA 4RNMA 2QMWA 3DOKB 1KSPA 2NS1B 5F8LA 2ZH3A 4FF4A 1FHTA 5GAGU 1RA6A 5C5JA 5GAGI 1UVKA 4X4TA 2FDNA 2B7BB 4FF1A 2KZZA 2IC3B 3DRXA 3FRZA 5GAEI 1SJFA 2FY1A 4K4XA 2MJUA 4DL2A 1VQ4S 3DXBA 3T1AA 4J9NA 3CIMA 1T3OA 4IOBA 2IYGA 1DLOA 1RKIA 2R8JA 4F67A 2AX0A 1L3KA 2VFUA 3MHYA 2J7UA 5E3QA 3V5RA 3CCMS 2CJKA 1BC6A 2UUCF 2ZZNA 5I3UB 2V9WA 2ZOMA 2QIFA 5KFMA 3VAMA 1HA1A 4DSIA 2PFFB 2MZSA 4X65F 5LSOA 1N5SA 2KDOA 3PW7A 3SCIE 2MKIA 1QAJA 4B3MF 1HNVB 4UUWA 3IR6B 3ENVA 4UUXA 3P6YC 4DSLA 2MSTA 3DLEB 4F8RA 2IM3A 1S0VA 1Y0HA 3QO9A 2HHVA 4A8QA 4YB5A 5B09A 1U1OA 2XMTA 4FPRA 1Y7PA 1S9EA 1VQKS 4OQJA 2JOQA 1RAJA 4F4XA 5K8PA 3JSMB 2XO7A 5IT9Y 4J9MA 1WELA 3RBDA 1SIWB 1YJRA 1U25A 3J7YI 4LFAF 3RR8A 4ED1A 2HHSA 5KT5A 1LXJA 1XBWA 4YFUA 2JX2A 2YKMA 4R8UB 2E29A 3D1HA 3C6TB 3PFEA 4KAIA 5IM0A 2LA4A 4OX8A 3ZZRA 4CT9A 2ZKTA 4QPTA 1I1GA 3UR0A 4L3NA 3CJ0A 2N82B 3PJXA 3PFOA 2ACYA 2YKOA 2FJEB 4G1QB 3J7A1 2DNOA 2FVCA 4HI2A 2BYCA 1H0HB 4WK1A 2BE2A 5KG7A 3RRGA 2UXDF 1UJ4A 5K5MA 2CPEA 4QWBA 4KPYA 4WE1B 2M88A 1F5CA 3CJ5A 1VIXA 2IC3A 3WZ0A 3MUVP 2HZCA 2CQ1A 2DR8A 4O3RA 2WK4A 1WEZA 2EFOA 1S6QB 1DARA 1LV5A 2FJWA 2WB4A 3D0HE 3M30A 3JYTB 1WEYA 4KO0B 5KT6A 5T7LB 4QQBA 4NCAA 2YQ3A 3NBPB 2KO1A 2HAIA 2B0GA 2OPQB 3M2VB 4JI8F 4N8NA 2ZD1B 4ZPAA 2JVOA 5EHHA 2ZDOA 5B0AA 1TAQA 1CC8A 5DDPC 3PX0A 3V6DB 5B0FA 2RKIB 3IRXA 2ADCA 4NLYA 4O4RA 2OMLA 4ES2A 5DG9A 2XGPA 3MTKA 4CT8A 4KKOA 4IFYA 2ZDPA 3H8YA 1IKVB 2C3PA 5HLFB 2DT9A 2UZAA 4B3OB 4QCLA 2BJEA 2MKHA 1R8AA 5IFMA 1FJ7A 5F8IA 5KFFA 1E6VA 4ZOSA 4WJBA 1KNZA 1FDAA 3QLHB 1TR0A 3SSSA 4C97A 4X4SA 2BXJA 4DFJA 2X1GA 5LL6d 3MR5A 4I67A 2WTFA 2I5JA 1JLAB 4DLEA 4ZP9A 4ECYA 2BVZA 2LMIA 1DTTA 2YWKA 3CDWA 4I6YA 2AJ4A 1MNEA 4BWJA 5HI7A 1T7PA 1KEKA 1FNOA 1SV5B 2M3DA 2RU3A 4WKRA 3BN7A 1O5JA 4F3MA 4ED7A 2IJFA 3PJWA 4USHA 1UA0A 2GX8A 4YR3A 5DM7Q 1YWXA 2F4VF 3KWMA 1XTZA 3LALA 5MAOA 1TKTA 1UWBA 4N56A 3V81A 5KFTA 5BYRA 3AY0A 4RW6B 3PW0A 1X9WA 2YY3A 3DOMA 4RNOA 2DGSA 4IRKA 1JMTA 4J9KA 4HDHA 3SV4A 1URNA 5DLFA 3BO2A 3ITHA 2QYCA 3FCHA 1NK6A 3PV8A 1HNIA 2YNIB 3K5OA 4RZRA 3GZ7A 1RT7A 1FKOA 4H4KA 2XMMA 3HZGA 5CD4H 2LLZA 2FVQA 3NRBA 5I42A 4KFBB 4PQUB 1VC5A 3FRYA 3NCPA 4KT0C 3UR3C 3NCRA 3E51A 3WC0A 3CCUS 4QR1A 1KHVA 3QZ7A 4GC7A 5I3UA 1U1RA 1RT7B 4ECTA 3DGPA 2D3ZA 3N0VA 4P7TA 1ZM3A 5F9LA 1MROA 4MK8A 3R27A