1FVVB

The structure of cdk2/cyclin a in complex with an oxindole inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Prevention of chemotherapy-induced alopecia in rats by CDK inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, cell cycle
total genus 93
structure length 260
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1fvvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1fvvB02
2WMAB 5HNBB 1H4LD 1H1QB 1P5EB 4BCQD 4BCMD 5LMKB 4EC9B 1JSTB 2BPMB 4G6LB 3TNHB 4BCMB 2UZBB 2PK9B 1GUXB 5HQ0B 1FINB 1W98B 4BCPB 3TNWB 4CFNB 4EC8B 2C4GB 3BHUB 3BLHB 4II5B 1OGUB 4EOOB 3TN8B 1GUXA 3BLRB 2EUFA 1PKDB 1JOWA 2UUEB 2WFYB 1OL2B 1OIUB 1H26B 2UZEB 1H1SB 5ICPB 4BCJB 3TNIB 1URCB 1H28B 4BCKB 1JKWA 5EFQB 4ELLA 5CYIB 1OKWB 2PMIB 2WEVB 4RODA 2C5NB 3H4CA 5I5ZB 4BCQB 2W9FA 2PK2A 2WPAB 4KRCB 1VOLA 4EOLB 1XO2A 3MI9B 3POMA 4F6UB 1QMZB 3EOCB 3LQ5B 3MY5B 3RGFB 2C5OB 1H1RB 2B9RA 4EORB 5IDNB 1AISB 5LQFB 1H1PB 1D3UB 2QDJA 2F2CA 2WMBB 1TFBA 4BCGB 4OGRB 3MIAB 5BNJB 1H25B 4EOKB 4EOPB 5CEIB 1N4MA 2W2HA 2C5VB 3QHWB 4FX3B 3O0GD 1GH6B 5ACBA 1ZP2A 2WXVB 1UNHD 4OR5B 1H24B 5L2WB 4F7LB 1O9KB 4EOIB 2I53A 2CCIB 4EONB 4EOMB 2IVXA 3MY1B 2G9XB 2JGZB 3K7AM 4BCOB 4BCFB 2IW8B 4CFUD 1O9KA 1FVVB 4ROEA 2UZDB 3QHRB 5HBJB 4BCND 3DDQB 4CFUB 5HBEB 1BU2A 4CXAB 4YOZA 2W9ZA 3F5XB 4BCNB 2PHGA 1H27B 1C9BA 4ELJA 2IW6B 2C5XB 2WIHB 1UNLD 4UN0A 4CFMB 4KRDB 1OIYB 3BHVB 4I3ZB 2BKZB 5HBHB 1E9HB 4F6SB 5IF1B 4Y72B 4F6WB 2C6TB 4TTHA 4CFVB 4EOSB 1KXUA 4CRLB 4EOJB 2W96A 1UNGD 1AD6A 5FGKB 4CFXB 2IW9B 1G3NC 2R7GA 4YOSA 4F7JB 3DOGB 4F7SB 1OL1B 4YOOA 1VINA 1VYWB 1GY3B 2WHBB 3M03A 4BCHB 2WIPB 1OI9B 3G33B 2UZLB 5HVYB 4CFWB 4NSTB 4F70B 3BLQB 2CJMB 2W99A 2V22B 4BCIB 4IMYB 4YC3B 4EOQB 2CCHB 4F7NB 2X1NB 4ROCA 3DDPB 3EIDB 5IDPB 3BHTB 3EJ1B 1JSUB 1OKVB 1F5QB 2I40B
chains in the Genus database with same CATH superfamily
4BCMD 1JSTB 1FKMA 2BPMB 4BCMB 3HO8A 4M6VA 2ZZDB 1OGUB 3TN8B 1JOWA 3A8LB 1QLBA 1H26B 3QXEB 4BCJB 3TNIB 1H28B 1AHJB 3HZJA 5EFQB 4BCQB 1VOLA 4EOLB 1XO2A 3MI9B 4HNVA 1QMZB 3EOCB 3MY5B 2CZ1B 3QYGB 4EORB 1H1PB 3BG3A 1TD6A 4BCGB 2WMBB 5BNJB 3MIAB 1H25B 2W2HA 2QDYB 5ACBA 2CZ7B 1H24B 1O9KB 2QQ8A 4EOIB 2IVXA 4CFUD 2DXBB 4BCND 3VYHB 3DDQB 4CFUB 5HBEB 4CXAB 3X25B 2IN3A 3B57A 4YOZA 2DD5B 4BCNB 2WIHB 4UN0A 1UGRB 3BHVB 2BKZB 4CFVB 2PJQA 3A8OB 2BS3A 4MFEA 4YOOA 4JX5A 1VYWB 3M03A 3DJBA 3KHIA 5HVYB 2UZLB 4BCIB 4EOQB 3QYEA 1JSUB 4OB1B 3QWLA 4AKIA 5HNBB 2ZPGB 4G6LB 2UZBB 5HQ0B 4JX6A 1W98B 4BBSM 4EC8B 1IREB 2ZPIB 3BLHB 2EUFA 2WFYB 1UGPB 1OL2B 3DTOA 1H1SB 4BCKB 3PO3S 1JKWA 4ELLA 5CYIB 2DD4B 4RODA 2C5NB 3H4CA 2W9FA 4BY7X 3QZ5B 2KR6A 1H1RB 5LQFB 1D3UB 2QDJA 4EOKB 4EOPB 5CEIB 4FM4B 3O0GD 1GH6B 2ZPBB 4F7LB 3WVDB 3HBLA 2CCIB 4ZGJB 2IW8B 2ZPHB 3NDQA 4ROEA 4JX4A 2DXCB 1BU2A 3F5XB 4ELJA 1UNLD 4HNTA 4F6WB 2C6TB 4EOSB 4CRLB 2W96A 5FGKB 2IW9B 4F7JB 1VINA 4BCHB 2WIPB 3G33B 3DL1A 4NSTB 2CJMB 4HLQA 2V22B 3X20B 2CCHB 4F7NB 4ROCA 3EIDB 5IDPB 3BHTB 4AKHA 3EJ1B 1F5QB 2I40B 2WMAB 4BBRM 1H4LD 1H1QB 5LMKB 3WVEB 4QSHA 2WJ9A 2PK9B 1FINB 3QZ9B 4II5B 4EOOB 1GUXA 3X28B 4ZGDB 2UUEB 2ZPFB 3QYBA 2CZ0B 3HHTB 4HNUA 5IHYA 2CYZB 1URCB 4MIMA 5I5ZB 2PK2A 2WPAB 3A8HB 3POMA 2DMEA 1E7PA 4OB0B 4MFDA 5IDNB 1ZP2A 4OR5B 5L2WB 3X24B 2I53A 4AKGA 3MY1B 3K7AM 4BY1X 3VYGB 4BCFB 2UZDB 3QHRB 3VKHA 3TW7A 2PHGA 1C9BA 2IW6B 2C5XB 3HB9A 5EJCA 4KRDB 4I3ZB 5HBHB 1E9HB 4F6SB 1V29B 4Y72B 2KMGA 2QFZA 1AD6A 3QYHB 2ZCFB 2R7GA 4YOSA 3BG5A 4F7SB 1OL1B 4HL4A 2WHBB 2LW4A 3BLQB 5DQVA 1P5EB 4BCQD 4EC9B 3A8MB 3TNHB 1GUXB 4Z6YA 4BCPB 3TNWB 1UGQB 4CFNB 2C4GB 3A8GB 3BHUB 1UGSB 4AI6A 3BLRB 1PKDB 2DPPB 2ZPEB 4OB2B 1OIUB 2UZEB 2QF7A 5ICPB 2G77A 1OKWB 3TW6A 2PMIB 2WEVB 5DQWA 4KRCB 4F6UB 3GTMS 3LQ5B 3RGFB 4LOCA 2C5OB 2B9RA 1AISB 2F2CA 1TFBA 4OGRB 1N4MA 2C5VB 3QHWB 4FX3B 2WXVB 1UNHD 2BS2A 4EONB 4EOMB 2G9XB 2JGZB 4BCOB 3X26B 4OB3B 1O9KA 1FVVB 5HBJB 4BXXX 4ZGEB 2W9ZA 4NC6A 1H27B 4CFMB 1OIYB 2QGSA 2CZ6B 5IF1B 2BS4A 2AHJB 4TTHA 1KXUA 4EOJB 2D0QB 1UNGD 4CFXB 1G3NC 3BG9A 1ENWA 3DOGB 1GY3B 1OI9B 4CFWB 4F70B 2W99A 3VKGA 4IMYB 4YC3B 2X1NB 3DDPB 1OKVB
chains in the Genus database with same CATH topology
2WMAB 5HNBB 1H4LD 1H1QB 1P5EB 4BCQD 4BCMD 5LMKB 4EC9B 1JSTB 2BPMB 4G6LB 3TNHB 4BCMB 2UZBB 2PK9B 1GUXB 5HQ0B 1FINB 1W98B 4BCPB 3TNWB 4CFNB 4EC8B 2C4GB 3BHUB 3BLHB 4II5B 1OGUB 4EOOB 3TN8B 1GUXA 3BLRB 2EUFA 1PKDB 1JOWA 2UUEB 2WFYB 1OL2B 1OIUB 1H26B 2UZEB 1H1SB 5ICPB 4BCJB 3TNIB 1URCB 1H28B 4BCKB 1JKWA 5EFQB 4ELLA 5CYIB 1OKWB 2PMIB 2WEVB 4RODA 2C5NB 3H4CA 5I5ZB 4BCQB 2W9FA 2PK2A 2WPAB 4KRCB 1VOLA 4EOLB 1XO2A 3MI9B 3POMA 4F6UB 1QMZB 3EOCB 3LQ5B 3MY5B 3RGFB 2C5OB 1H1RB 2B9RA 4EORB 5IDNB 1AISB 5LQFB 1H1PB 1D3UB 2QDJA 2F2CA 2WMBB 1TFBA 4BCGB 4OGRB 3MIAB 5BNJB 1H25B 4EOKB 4EOPB 5CEIB 1N4MA 2W2HA 2C5VB 3QHWB 4FX3B 3O0GD 1GH6B 5ACBA 1ZP2A 2WXVB 1UNHD 4OR5B 1H24B 5L2WB 4F7LB 1O9KB 4EOIB 2I53A 2CCIB 4EONB 4EOMB 2IVXA 3MY1B 2G9XB 2JGZB 3K7AM 4BCOB 4BCFB 2IW8B 4CFUD 1O9KA 1FVVB 4ROEA 2UZDB 3QHRB 5HBJB 4BCND 3DDQB 4CFUB 5HBEB 1BU2A 4CXAB 4YOZA 2W9ZA 3F5XB 4BCNB 2PHGA 1H27B 1C9BA 4ELJA 2IW6B 2C5XB 2WIHB 1UNLD 4UN0A 4CFMB 4KRDB 1OIYB 3BHVB 4I3ZB 2BKZB 5HBHB 1E9HB 4F6SB 5IF1B 4Y72B 4F6WB 2C6TB 4TTHA 4CFVB 4EOSB 1KXUA 4CRLB 4EOJB 2W96A 1UNGD 1AD6A 5FGKB 4CFXB 2IW9B 1G3NC 2R7GA 4YOSA 4F7JB 3DOGB 4F7SB 1OL1B 4YOOA 1VINA 1VYWB 1GY3B 2WHBB 3M03A 4BCHB 2WIPB 1OI9B 3G33B 2UZLB 5HVYB 4CFWB 4NSTB 4F70B 3BLQB 2CJMB 2W99A 2V22B 4BCIB 4IMYB 4YC3B 4EOQB 2CCHB 4F7NB 2X1NB 4ROCA 3DDPB 3EIDB 5IDPB 3BHTB 3EJ1B 1JSUB 1OKVB 1F5QB 2I40B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMA B;  5HNB B;  1H4L D;  1H1Q B;  1P5E B;  4BCQ D;  4BCM D;  5LMK B;  4EC9 B;  1JST B;  2BPM B;  4G6L B;  3TNH B;  4BCM B;  2UZB B;  2PK9 B;  1GUX B;  5HQ0 B;  1FIN B;  1W98 B;  4BCP B;  3TNW B;  4CFN B;  4EC8 B;  2C4G B;  3BHU B;  3BLH B;  4II5 B;  1OGU B;  4EOO B;  3TN8 B;  1GUX A;  3BLR B;  2EUF A;  1PKD B;  1JOW A;  2UUE B;  2WFY B;  1OL2 B;  1OIU B;  1H26 B;  2UZE B;  1H1S B;  5ICP B;  4BCJ B;  3TNI B;  1URC B;  1H28 B;  4BCK B;  1JKW A;  5EFQ B;  4ELL A;  5CYI B;  1OKW B;  2PMI B;  2WEV B;  4ROD A;  2C5N B;  3H4C A;  5I5Z B;  4BCQ B;  2W9F A;  2PK2 A;  2WPA B;  4KRC B;  1VOL A;  4EOL B;  1XO2 A;  3MI9 B;  3POM A;  4F6U B;  1QMZ B;  3EOC B;  3LQ5 B;  3MY5 B;  3RGF B;  2C5O B;  1H1R B;  2B9R A;  4EOR B;  5IDN B;  1AIS B;  5LQF B;  1H1P B;  1D3U B;  2QDJ A;  2F2C A;  2WMB B;  1TFB A;  4BCG B;  4OGR B;  3MIA B;  5BNJ B;  1H25 B;  4EOK B;  4EOP B;  5CEI B;  1N4M A;  2W2H A;  2C5V B;  3QHW B;  4FX3 B;  3O0G D;  1GH6 B;  5ACB A;  1ZP2 A;  2WXV B;  1UNH D;  4OR5 B;  1H24 B;  5L2W B;  4F7L B;  1O9K B;  4EOI B;  2I53 A;  2CCI B;  4EON B;  4EOM B;  2IVX A;  3MY1 B;  2G9X B;  2JGZ B;  3K7A M;  4BCO B;  4BCF B;  2IW8 B;  4CFU D;  1O9K A;  1FVV B;  4ROE A;  2UZD B;  3QHR B;  5HBJ B;  4BCN D;  3DDQ B;  4CFU B;  5HBE B;  1BU2 A;  4CXA B;  4YOZ A;  2W9Z A;  3F5X B;  4BCN B;  2PHG A;  1H27 B;  1C9B A;  4ELJ A;  2IW6 B;  2C5X B;  2WIH B;  1UNL D;  4UN0 A;  4CFM B;  4KRD B;  1OIY B;  3BHV B;  4I3Z B;  2BKZ B;  5HBH B;  1E9H B;  4F6S B;  5IF1 B;  4Y72 B;  4F6W B;  2C6T B;  4TTH A;  4CFV B;  4EOS B;  1KXU A;  4CRL B;  4EOJ B;  2W96 A;  1UNG D;  1AD6 A;  5FGK B;  4CFX B;  2IW9 B;  1G3N C;  2R7G A;  4YOS A;  4F7J B;  3DOG B;  4F7S B;  1OL1 B;  4YOO A;  1VIN A;  1VYW B;  1GY3 B;  2WHB B;  3M03 A;  4BCH B;  2WIP B;  1OI9 B;  3G33 B;  2UZL B;  5HVY B;  4CFW B;  4NST B;  4F70 B;  3BLQ B;  2CJM B;  2W99 A;  2V22 B;  4BCI B;  4IMY B;  4YC3 B;  4EOQ B;  2CCH B;  4F7N B;  2X1N B;  4ROC A;  3DDP B;  3EID B;  5IDP B;  3BHT B;  3EJ1 B;  1JSU B;  1OKV B;  1F5Q B;  2I40 B; 
#chains in the Genus database with same CATH topology
 4BCM D;  1JST B;  1FKM A;  2BPM B;  4BCM B;  3HO8 A;  4M6V A;  2ZZD B;  1OGU B;  3TN8 B;  1JOW A;  3A8L B;  1QLB A;  1H26 B;  3QXE B;  4BCJ B;  3TNI B;  1H28 B;  1AHJ B;  3HZJ A;  5EFQ B;  4BCQ B;  1VOL A;  4EOL B;  1XO2 A;  3MI9 B;  4HNV A;  1QMZ B;  3EOC B;  3MY5 B;  2CZ1 B;  3QYG B;  4EOR B;  1H1P B;  3BG3 A;  1TD6 A;  4BCG B;  2WMB B;  5BNJ B;  3MIA B;  1H25 B;  2W2H A;  2QDY B;  5ACB A;  2CZ7 B;  1H24 B;  1O9K B;  2QQ8 A;  4EOI B;  2IVX A;  4CFU D;  2DXB B;  4BCN D;  3VYH B;  3DDQ B;  4CFU B;  5HBE B;  4CXA B;  3X25 B;  2IN3 A;  3B57 A;  4YOZ A;  2DD5 B;  4BCN B;  2WIH B;  4UN0 A;  1UGR B;  3BHV B;  2BKZ B;  4CFV B;  2PJQ A;  3A8O B;  2BS3 A;  4MFE A;  4YOO A;  4JX5 A;  1VYW B;  3M03 A;  3DJB A;  3KHI A;  5HVY B;  2UZL B;  4BCI B;  4EOQ B;  3QYE A;  1JSU B;  4OB1 B;  3QWL A;  4AKI A;  5HNB B;  2ZPG B;  4G6L B;  2UZB B;  5HQ0 B;  4JX6 A;  1W98 B;  4BBS M;  4EC8 B;  1IRE B;  2ZPI B;  3BLH B;  2EUF A;  2WFY B;  1UGP B;  1OL2 B;  3DTO A;  1H1S B;  4BCK B;  3PO3 S;  1JKW A;  4ELL A;  5CYI B;  2DD4 B;  4ROD A;  2C5N B;  3H4C A;  2W9F A;  4BY7 X;  3QZ5 B;  2KR6 A;  1H1R B;  5LQF B;  1D3U B;  2QDJ A;  4EOK B;  4EOP B;  5CEI B;  4FM4 B;  3O0G D;  1GH6 B;  2ZPB B;  4F7L B;  3WVD B;  3HBL A;  2CCI B;  4ZGJ B;  2IW8 B;  2ZPH B;  3NDQ A;  4ROE A;  4JX4 A;  2DXC B;  1BU2 A;  3F5X B;  4ELJ A;  1UNL D;  4HNT A;  4F6W B;  2C6T B;  4EOS B;  4CRL B;  2W96 A;  5FGK B;  2IW9 B;  4F7J B;  1VIN A;  4BCH B;  2WIP B;  3G33 B;  3DL1 A;  4NST B;  2CJM B;  4HLQ A;  2V22 B;  3X20 B;  2CCH B;  4F7N B;  4ROC A;  3EID B;  5IDP B;  3BHT B;  4AKH A;  3EJ1 B;  1F5Q B;  2I40 B;  2WMA B;  4BBR M;  1H4L D;  1H1Q B;  5LMK B;  3WVE B;  4QSH A;  2WJ9 A;  2PK9 B;  1FIN B;  3QZ9 B;  4II5 B;  4EOO B;  1GUX A;  3X28 B;  4ZGD B;  2UUE B;  2ZPF B;  3QYB A;  2CZ0 B;  3HHT B;  4HNU A;  5IHY A;  2CYZ B;  1URC B;  4MIM A;  5I5Z B;  2PK2 A;  2WPA B;  3A8H B;  3POM A;  2DME A;  1E7P A;  4OB0 B;  4MFD A;  5IDN B;  1ZP2 A;  4OR5 B;  5L2W B;  3X24 B;  2I53 A;  4AKG A;  3MY1 B;  3K7A M;  4BY1 X;  3VYG B;  4BCF B;  2UZD B;  3QHR B;  3VKH A;  3TW7 A;  2PHG A;  1C9B A;  2IW6 B;  2C5X B;  3HB9 A;  5EJC A;  4KRD B;  4I3Z B;  5HBH B;  1E9H B;  4F6S B;  1V29 B;  4Y72 B;  2KMG A;  2QFZ A;  1AD6 A;  3QYH B;  2ZCF B;  2R7G A;  4YOS A;  3BG5 A;  4F7S B;  1OL1 B;  4HL4 A;  2WHB B;  2LW4 A;  3BLQ B;  5DQV A;  1P5E B;  4BCQ D;  4EC9 B;  3A8M B;  3TNH B;  1GUX B;  4Z6Y A;  4BCP B;  3TNW B;  1UGQ B;  4CFN B;  2C4G B;  3A8G B;  3BHU B;  1UGS B;  4AI6 A;  3BLR B;  1PKD B;  2DPP B;  2ZPE B;  4OB2 B;  1OIU B;  2UZE B;  2QF7 A;  5ICP B;  2G77 A;  1OKW B;  3TW6 A;  2PMI B;  2WEV B;  5DQW A;  4KRC B;  4F6U B;  3GTM S;  3LQ5 B;  3RGF B;  4LOC A;  2C5O B;  2B9R A;  1AIS B;  2F2C A;  1TFB A;  4OGR B;  1N4M A;  2C5V B;  3QHW B;  4FX3 B;  2WXV B;  1UNH D;  2BS2 A;  4EON B;  4EOM B;  2G9X B;  2JGZ B;  4BCO B;  3X26 B;  4OB3 B;  1O9K A;  1FVV B;  5HBJ B;  4BXX X;  4ZGE B;  2W9Z A;  4NC6 A;  1H27 B;  4CFM B;  1OIY B;  2QGS A;  2CZ6 B;  5IF1 B;  2BS4 A;  2AHJ B;  4TTH A;  1KXU A;  4EOJ B;  2D0Q B;  1UNG D;  4CFX B;  1G3N C;  3BG9 A;  1ENW A;  3DOG B;  1GY3 B;  1OI9 B;  4CFW B;  4F70 B;  2W99 A;  3VKG A;  4IMY B;  4YC3 B;  2X1N B;  3DDP B;  1OKV B; 
#chains in the Genus database with same CATH homology
 2WMA B;  5HNB B;  1H4L D;  1H1Q B;  1P5E B;  4BCQ D;  4BCM D;  5LMK B;  4EC9 B;  1JST B;  2BPM B;  4G6L B;  3TNH B;  4BCM B;  2UZB B;  2PK9 B;  1GUX B;  5HQ0 B;  1FIN B;  1W98 B;  4BCP B;  3TNW B;  4CFN B;  4EC8 B;  2C4G B;  3BHU B;  3BLH B;  4II5 B;  1OGU B;  4EOO B;  3TN8 B;  1GUX A;  3BLR B;  2EUF A;  1PKD B;  1JOW A;  2UUE B;  2WFY B;  1OL2 B;  1OIU B;  1H26 B;  2UZE B;  1H1S B;  5ICP B;  4BCJ B;  3TNI B;  1URC B;  1H28 B;  4BCK B;  1JKW A;  5EFQ B;  4ELL A;  5CYI B;  1OKW B;  2PMI B;  2WEV B;  4ROD A;  2C5N B;  3H4C A;  5I5Z B;  4BCQ B;  2W9F A;  2PK2 A;  2WPA B;  4KRC B;  1VOL A;  4EOL B;  1XO2 A;  3MI9 B;  3POM A;  4F6U B;  1QMZ B;  3EOC B;  3LQ5 B;  3MY5 B;  3RGF B;  2C5O B;  1H1R B;  2B9R A;  4EOR B;  5IDN B;  1AIS B;  5LQF B;  1H1P B;  1D3U B;  2QDJ A;  2F2C A;  2WMB B;  1TFB A;  4BCG B;  4OGR B;  3MIA B;  5BNJ B;  1H25 B;  4EOK B;  4EOP B;  5CEI B;  1N4M A;  2W2H A;  2C5V B;  3QHW B;  4FX3 B;  3O0G D;  1GH6 B;  5ACB A;  1ZP2 A;  2WXV B;  1UNH D;  4OR5 B;  1H24 B;  5L2W B;  4F7L B;  1O9K B;  4EOI B;  2I53 A;  2CCI B;  4EON B;  4EOM B;  2IVX A;  3MY1 B;  2G9X B;  2JGZ B;  3K7A M;  4BCO B;  4BCF B;  2IW8 B;  4CFU D;  1O9K A;  1FVV B;  4ROE A;  2UZD B;  3QHR B;  5HBJ B;  4BCN D;  3DDQ B;  4CFU B;  5HBE B;  1BU2 A;  4CXA B;  4YOZ A;  2W9Z A;  3F5X B;  4BCN B;  2PHG A;  1H27 B;  1C9B A;  4ELJ A;  2IW6 B;  2C5X B;  2WIH B;  1UNL D;  4UN0 A;  4CFM B;  4KRD B;  1OIY B;  3BHV B;  4I3Z B;  2BKZ B;  5HBH B;  1E9H B;  4F6S B;  5IF1 B;  4Y72 B;  4F6W B;  2C6T B;  4TTH A;  4CFV B;  4EOS B;  1KXU A;  4CRL B;  4EOJ B;  2W96 A;  1UNG D;  1AD6 A;  5FGK B;  4CFX B;  2IW9 B;  1G3N C;  2R7G A;  4YOS A;  4F7J B;  3DOG B;  4F7S B;  1OL1 B;  4YOO A;  1VIN A;  1VYW B;  1GY3 B;  2WHB B;  3M03 A;  4BCH B;  2WIP B;  1OI9 B;  3G33 B;  2UZL B;  5HVY B;  4CFW B;  4NST B;  4F70 B;  3BLQ B;  2CJM B;  2W99 A;  2V22 B;  4BCI B;  4IMY B;  4YC3 B;  4EOQ B;  2CCH B;  4F7N B;  2X1N B;  4ROC A;  3DDP B;  3EID B;  5IDP B;  3BHT B;  3EJ1 B;  1JSU B;  1OKV B;  1F5Q B;  2I40 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...