1FX7A

Crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRON-DEPENDENT REPRESSOR IDER
publication title Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1fx7A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1fx7A03
4Y13A 4HAMA 1HW2A 2XUBA 4HYEA 1OMIA 3IKVA 4MQVA 5D6EA 3F3XA 3ZQ7A 3FMQA 1U5TA 1XMAA 4BAYA 2HFHA 1O3RA 2L4MA 4LFUA 3F8BA 1W7PA 3DV8A 4IVNA 2O6GE 1TQPA 5D5WB 1IUYA 3CUQC 1FBUA 3ZN1A 1LEAA 3SXYA 2STWA 1YW9A 2GQQA 1QW1A 2PEXA 4CYDA 2VXZA 3FXUA 4YG2F 2VONA 4GGGA 2CO5A 5LBQA 3FF5A 3K9TA 1FBSA 2QWWA 5D5VB 5LHIA 2H09A 4OIRF 2RGVA 4HX7A 4M6XA 5L3BA 4BNCA 3JW4A 4LG0B 4EM0B 3T0YA 2FU4A 2EFQA 2HQNA 1QVPA 5LRSA 2P7CB 4CICA 3R60A 2P5LC 3SFZA 3ZMUA 1I1GA 2O0YA 2CWEA 1XCBA 1ZYRF 4BH9A 3HRMA 1O7LA 2CW0F 2RKHA 4I01A 3WE2A 4ESFA 1ODDA 3MZYA 4HF1A 1FP2A 4UHTA 3G3ZA 2ZNYA 2YPRA 2MLKA 5BS6A 3IL2A 3REOA 2EFOA 2G7UA 3RJPA 2K5IA 1R23A 1LVAA 1OYWA 4KMFA 4O6JA 2PLYA 3JSOA 3ZMDA 4RGXA 1K79A 1E17A 3R0AA 4EQQA 1STZA 3H3ZA 3JSPA 3TKYA 2NRAC 4Z2YA 3IHUA 3BY6A 1EH8A 4UVAA 5HLIA 3ZP5A 3RPQA 2A6HF 2EWNA 2YR2A 5K5RA 4I09A 2OQRA 2M8EA 3V4GA 2Y75A 4IHTA 4KUMA 3I53A 4IJAA 4RGSA 1BJAA 4MEXF 4LLLA 3TO9A 2QZ8A 1I1SA 3N97A 4I2OA 3MCZA 2UZKA 3IC7A 1IW7F 2CQKA 3E5XA 2MA3A 1W7PD 3CJNA 1PDNC 4A0ZA 4ZYEA 1S29A 2B0LA 2FEZA 4GYGA 2D2WA 2VBZA 1RI7A 3IWZA 1GXPA 3Q9VA 1F1ZA 3BZ6A 2DW4A 2A6EF 4RB2C 2KJBA 4KN7X 1R1VA 3COAC 4O3MA 2VC1A 2WWYA 4EJOA 1NHAA 5DD4A 4M71A 2KIMA 3GFJA 4P55A 1USSA 1A04A 1W5SA 1QQIA 1ZREA 2V1XA 2QBYA 1ZGAA 2XROA 2IP2A 2UWMA 4HQMA 5LEKA 2AXLA 1BC8C 3GFMA 3CUOA 3WTYC 1PUEE 1IN8A 3WE3A 1Q1HA 1LJ9A 3KEQA 1ZLKA 3KZYA 4ZZDA 2ZMEA 2VN2A 2RC4A 3RYRA 2HKXA 2YX7A 2VE9A 3RDIA 2HR3A 1Z05A 4EJWA 2WV0A 5E1ZB 4RGUA 4ESBA 3BOQA 3I71A 2EA4A 3G73A 2ELHA 1E2XA 4M6YA 4KICA 4PGGA 3DEUA 2HDCA 3MFKA 1OKRA 5HOOA 3P7NA 1TQIA 1W4MA 1YW8A 5E8IA 1UHMA 5BPDA 1FP1D 2IT0A 2V9VA 4P9FA 3LSTA 2GIVA 4KT5C 4ZYGA 3FXRA 3SHFA 2O3FA 1U78A 5ILSA 4EM1A 3MHXA 3KFWX 4RAYA 1BYMA 5FO5A 1FZPB 1FY7A 3RTRA 4EMSA 5LLQA 3O6BB 4KFCA 2IVMA 3KCCA 1YYVA 1R5GA 1SAXA 1P4WA 4HA8A 3WTWC 2A68F 2QLZA 1Y0UA 2HTJA 3ISPA 1PP7U 3QAHA 5LRRA 1TNSA 2OQGA 1XN7A 3SQNA 5LGUA 3HSRA 3JTGA 4OU0A 2ESHA 4GCVA 1KGSA 3E6CC 3JAMK 4UV8A 2E7XA 1R22A 1REPC 5HDNA 5HLHA 1D3YA 3C18A 4AIJA 4CHUA 4I0AA 4EV0A 1ONVA 1TQMA 2NNYA 4GXOA 4MHGA 3KP2A 2QYOA 2L4AA 3QPHA 1XDSA 4BHBA 3CO6C 2M87A 4M9SA 2E1CA 2EFWA 3KETA 2Z33A 3GEZA 2IRFG 3HHGA 5HDGA 3FM3A 3MZHA 3LQRA 3GXOA 3QPTA 1HQCA 1KYZA 2K27A 4HQEA 3C7JA 4N9IA 2OBPA 4UXNA 3WU1B 3KP4A 3GF2A 3R61A 4RAZA 4R8HA 2FMLA 2O61A 1T0FA 3QP5A 2OZUA 4G7OF 2R7DA 5AIPA 2XAFA 2O8XA 1XSDA 1O57A 2HS5A 3BJAA 4L5JA 3LAPA 1KA8A 1J59A 4HX8A 1UHWA 1MGTA 1J5YA 5DCMB 2P5VA 3S2WA 3L09A 2QQ9A 2Q2EA 5HVQC 3V7SA 4Q5SF 1BM9A 1ZRFA 4YFXF 1SFEA 3F22A 2FNAA 2Q0OA 3DKWA 3HRTA 1P92A 3C3WA 5J8CA 4K2EA 3KE2A 5ILUA 2IPQX 2ZXJA 1HXDA 3HHHA 2MD5A 1DPRA 4B09A 3GVAA 2VOOA 2XAGA 3KEOA 3M8FA 3DPTA 3BDDA 4YIFA 3ZMZA 5FLXK 5IT9Z 4F7ZA 4FX0A 1XSVA 1IN7A 1TBXA 1IF1A 3QP6A 1ZAOA 4M74A 4JQFA 2EV6A 2JPBA 2VBWA 2P8TA 2GAUA 4G7ZF 3I58A 3H3UA 1OYYA 1KU3A 5DEQA 5A2QZ 4OINF 5L3DA 4WX9A 1WSUA 1P2FA 4BXUA 3FHZA 3Q5FA 3NEUA 4U0WA 3N4MA 4YIIA 2V79A 2P6TA 5AIQA 1BI3A 3TQNA 3IWFA 5KK1A 4AVPA 2BBYA 4R79A 3PQKA 2J5OA 1HKQA 1P4XA 1CF7A 2STTA 1HSJA 3I54A 4HZFA 3K69A 3AAFA 1KU2A 3J7AO 2A07F 2FNPA 1O3SA 3F72A 4HBLA 4XLPF 1SMTA 1J9IA 4G7HF 1DP7P 2MH9A 3VODA 3VFZA 2LDUA 4U7DA 1ZHFA 2FE3A 1P6RA 2V1UA 1BIBA 2CYYA 3IRQA 3I4PA 1GXQA 4S05A 4A0YA 1U6GA 4BHCA 1JXSA 5EEGA 4AWXB 3R4KA 1DPUA 1P4AA 3J80Z 2FQ3A 3TDZC 4KA4A 2DPUA 1QO0D 2PG4A 2QQBA 2M30A 3MWMA 1U8RA 3DPLC 4BHPA 5K5OA 1S3JA 1KU9A 2IA2A 2UXNA 4XLNF 3HTSB 4IXAA 5E1WA 4M9XA 1K6OA 2D1HA 5ICEA 4XSXF 3SZPA 4QLCU 2ETHA 3LWFA 4A6DA 1IAWA 4UUVA 2IW5A 5TJJA 2QM3A 3I64A 5LEJA 4EJTA 2CG4A 2IA0A 3V7RA 1TLHB 5D6FA 4BYYA 1XGOA 2K5FA 4RB0A 4M9ZA 4HLXA 3WTSC 4Q48A 1G6NA 3GZ6A 1QPMA 3P9CA 4B8XA 4CO8A 4E70A 2W24A 4ASNA 2OA4A 3O3KA 5BQTA 1YO5C 3FM5A 4U0YA 3BPVA 2XHKA 3WG9A 4YFNF 2RV8A 1MJBA 2NNNA 3ECHA 1ON1A 2PBIA 2HYGD 3CDHA 3J81Z 1K78B 3TOBA 5D5XB 1RUNA 2X0LA 3I59B 1SFXA 2P7VB 3ZMSA 3I5UA 4U0VA 2K4YA 3E5UA 1R1UA 3ZMVA 2H3JA 1IRGA 3MEXA 3T1BA 1R1TA 5K1YA 3KLNA 2HEOA 5KVRA 2ZO4A 1J0RA 4ENMA 1R5HA 1XDUA 1ZRDA 2MLGA 3J80K 1I27A 1QZZA 2H27A 3V7CA 1WRJA 1ZRCA 1R58A 2VC0A 2DTRA 3M8EA 2GWRA 1T2KA 4P96A 2L01A 4L9JA 1LDJA 1ON2A 4ZYDA 3KP5A 1O3QA 3V8LA 2FF4A 3GZ5A 2K7LA 5ERIA 1QGPA 3HYIA 3M1EA 4L5IA 5D5UB 4ZZLA 3FWEA 3T5XA 2HWVA 3FMSA 1G3SA 5EEHA 2VBXA 3HIFA 3BJOA 4MGRA 2IA1A 4RB1A 3E6DA 1MJAA 5DV5A 2QENA 3GUDA 1SD5A 1K7AA 5LHGA 2HZTA 2DQLA 5DDGA 2Z3YA 4G94A 3F8CA 2L02A 5DYMA 1O7FA 4MTDA 2XAJA 4A0XA 4LB5A 4G9YA 2EB7A 3HOSA 3R6SA 1MKMA 2DO7A 1YS6A 1R7JA 1HKTA 3H92A 3GFLA 1IN5A 2COMA 1J7KA 2JRTA 1Z6TA 1T98A 3K0LA 2A61A 3KP3A 3HSFA 4ENNA 4ENKA 3GYHX 1QNTA 2GZWA 3LFKA 4S04A 3BP8A 3W6KB 4CDGA 4LLGF 3HTUA 5E1XA 4O5VA 2DK5A 3T8TA 1LQ1A 4AIKA 2A3SA 5BOXA 4LG0A 5L3CA 2W25A 2PQ8A 3W6JB 2PN6A 3E19A 3CLOA 1EV7A 4G8XA 4EGZA 3RKYA 1B6AA 3GW2A 1ULYA 5FD5A 2EJRA 3WTTC 1ZG5A 1W5TA 4KNYA 2ADUA 1DDNA 1WI9A 2K5LA 2LF8A 5D8LB 2DLLA 2RNJA 4OIQF 1J2XA 1XGMA 2XIGA 2LSOA 3L9FA 2UXXA 1U5TB 1QBJA 5JVTA 3RKWA 2L3DA 1HKSA 1OPCA 2FOKA 2ZCWA 2X4HA 5FGMA 1W7PB 3KLOA 2WTEA 1BBYA 5HS9A 3F8MA 1K78A 2VE8A 4EGYA 1SD6A 1JHFA 2F5FA 1TW3A 1H0MA 2CSOA 3I59A 1WKMA 1XB4A 4LGWA 2K86A 4LK1F 3HUGA 4P5OA 5J8FA 3DXJF 2Z9OA 3IRRA 4L0ZB 2FXAA 1FYLA 4HV5A 3RIRA 2ZBKA 2EK5A 5FB2A 2KRFA 4FT8A 3WTVC 4PCQA 3VOEA 2LNBA 3B02A 2CGPA 2RVCA 4RB3C 4ZH4F 1S7AA 5H6RA 1YFHA 4XRFA 1FSHA 5DD8A 1S6LA 1HSTA 2XASA 2ACJA 1BIAA 2FRHA 1HW5A 3KP6A 4ESJA 3F6VA 1ZH5A 1JHHA 2K02A 3U2RA 2JSCA 2VT3A 2CFXA 4IPAA 2VOPA 3HRUA 1EH7A 3P9KA 4DQ2A 1YS7A 4JBAA 3QU6A 3EYYA 4PDKA 3E6BA 1UCRA 3OOPA 2G7HA 1B1BA 1T6SA 4QWQA 4XSZF 2F5EA 5E18F 4IRHA 1KQ0A 3EUHA 3F8NA 3WU0A 1UB9A 2YX4A 2ZNZA 2H94A 1ZLJA 1O3TA 5F6FA 2DBBA 1F5TA 1KU7A 2KKOA 4KN4X 3DF8A 2XKPA 3CO7C 5FFZA 3F23A 1MZBA 2TDXA 4U88A 3NRVA 1B4AA 3GO5A 3L2CA 1R00A 2GCXA 1JE8A 2HYFA 5JR3A 4HDUA 2RDPA 4WWCA 5LGTA 4L18B 4UNOA 3E97A 1MD0A 2MC3A 2W84A 4LD5A 2P6SA 3K1PA 1D8JA 1IXSB 5LHHA 5H6QA 2RQPA 4WXCA 1FLIA 4BQAA 1DUXC 1F4KA 1B59A 1FC3A 1EH6A 2IJLA 3MQ0A 1BN5A 2FBIA 1LDDA 2XVCA 3DP7A 5HDKA 3RKXA 3ML6A 3TOAA 4KIGA 4HF2A 2DFIA 4A6EA 1ZG1A 3D0SA 2XRNA 1B9NA 4A2UA 5LGNA 2DAOA 4KMUX 2H6BA 4H0EA 1I6XA 1XCVA 5CJ9A 5F64A 2VODA 2MH2A 5E8GA 4MTEA 2ZMEB 4CZZA 5ILVA 4CGZA 2FBKA 4AIHA 3RI4A 2GXBA 2F2EA 2O03A 1QZYA 3HRSA 4HV6A 2H6CA 2HGCA 1H9GA 5AONA 4UV9A 3IKTA 2HOEA 3KP7A 2Q8KA 1FBQA 3E6MA 4KYWA 1VTNC 3EYIA 6PAXA 2A5YB 5IT9K 4M73A 2R3SA 2G9WA 2ESNA 2E7WA 2VBYA 2GA2A 2KIFA 5HLGA 3PFIA 3HOTA 4EM2A 2BE5F 3OV8A 4OIOF 4ETSA 3L00A 3O2PE 2D45A 3DFGA 2KJCA 2XAQA 5A2QK 1BC7C 1ZG3A 1XGSA 3QOPA 3ZN0A 3K1NA 4YFKF 4MEYF 2V1DA 1D5VA 4IF4A 3K2ZA 1Z1DA 1BI2A 4L9TA 2NAZA 1FNNA 5CVJA 1FX7A 4LJZF 5DCMA 2NYXA 3HSEA 2BYVE 1OR7A 1YIOA 3LA2A 5ICFA 3GWZA 2Z5UA 1G3YA 3FMRA 4LMYA 1RIOH 2DPDA 2XKOA 1S8NA 3EQLF 1F9NA 4OIPF 3U1DA 5E20A 5HS7A 3TDUC 5L3GA 4I98B 3BWGA 3SZTA 2BEOA 1MDMB 2WC2A 4NQWA 2EFPA 2K4JA 1HW1A 4LB6B 2C6YA 1YW7A 3WTZA 5CVRA 1U5TC 4MQ9F 4EJVA 4KIBA 2RN7A 1IXCA 3BPXA 4AD9A 1T38A 4PGHA 4WXHA 1IZ1A 5D4SA 1LDKB 1FYMA 1FPQA 4HX4A 1G4DA 4CXFA 2OU2A 1LNWA 5CVVA 5DCFA 2FBHA 4P9UA 2KIUA 1XMKA 2Z99A 4UVBA 1WWXA 1RNLA 1IN4A 5CLSA 4A5MA 4HDVA 3L7WA 3LAJA 3U9GA 5J6XA 2W85A 1L0OC 4Y15A 3GX4X 4N9HA 2ISZA 3JAMZ 1V3FA 1TW2A 5ED4A 5FD6A 3F8FA 1Z6RA 4TV7A 1FOKA 3CUQB 2ZKZA 1FT9A 5D4RA 4KDPA 2LX9A 4OMZA 3E5QA 1IXRC 2W57A 2JTVA 2LF7A 5L3FA 3C1DA 3GFIA 5K5QA 3J81K 4WCGA 1AOYA 3FXQA 1U3EM 5DUIA 4WF2A 4OOIA 4G6DA 1KQ8A 3LA3A 4ON0A 1H9TA 3KZZA 2PJPA 4HLYA 1G3WA 2QVOA 2OAZA 3M7GA 3R0JA 4GYIA 1Z7UA 1HBXG 1ZN2A 3TO6A 2YU3A 2BV6A 4NB5A 2M45A 4XBFA 5CYVA 4HOBA 3I0TA 5ICCA 3VB2A 4G6QA 1XGNA 1FSEA 1RZ4A 3B73A 3NQOA 1TNTA 2R7FA 1FWZA 2Y0MA 3CTAA 3T8RA 3ZMTA 1T39A 4Y17A 4HW0A 2PMHA 4LLNA 4KIFA 2XV4S 1CF7B 4FX4A 1D8KA 2ISYA 2QQAA 4EVIA 2MBFA 1PP8F 1SD7A 4DNCA 3F6OA 2L54A 3WGHA 1JGSA 3ROUA 4L9VA 1S7OA 3EETA 1XSXA 2DU9A 5BMZA 2PMUA 4GO1A 4I02A 2XAHA 3V8JA 3ERED 1GHCA 1OYIA 2Y48A 1G3TA 1BOAA 3ABUA 2JZYA 5FLXZ 1BI1A 4IRIA 3LQQA 2PI0A 2V6CA 5DUKA 2HKOA 3QRFF 3ZPLA 3V8KA 3GLXA 1MDMA 1XD7A 2HQRA 2EV5A 2AS5F 4ZYHA 3WTUC 5JHUA 1L3LA 5FFXA 2EV0A 1USTA 3P9IA 1IRFA 1V4RA 2D1VA 1KQ9A 1R36A 2ZJ2A 4HF0A 2K4BA 3TO7A 2EA2A 2GXGA 1WQ2A 5L3EA 4IHSA 4NHJA 1ZGJA 1YQAA 5BPIA 3WODF 3FZVA 2F5DA 3WGIA 1C0WA 3TGNA 3PQJA 2ZFWA 2FMYA 3RPUA 1FYKA 2J5PA 4RGRA 2DT5A 4OMYA 4JK1X 1UFMA 1J75A 4L9NA 2E1NA 1YLFA 2LKPA 2PFBA 2QUFA 4ENJA 3ELKA 1YTYA 3BROA 3QU3A 4RS8A 1CGPA 4D0PA 1MJ9A 4I0BA 4Q4ZF 1ZARA 5D8KB 5TRDA 2JPCA 3Q9SA 2DQRA 3CUQA 2P5KA 2BGCA 1LB2A 2XGXA 2FSWA 1GVJA 1BI0A 4WK8F 4A5NA 3JTHA 1Z91A 1Z9CA 2F5CA 3WGGA 5IT3A 4UVCA 1TTYA 5JFRA 3DQVC 1X3UA 4PZJA 1RUOA 5CVUA 3M9AA 1SMYF 1YG2A 5ICGA 4LK0F 2DK8A 1SD4A 3VEPA 4M72A 3E3VA 2M1BA 2A69F 1LEBA 3K1MA 4IRGA 1SFUA 3MAJA 1B9MA 3LA7A 5E17F 4R1HA 5HS8A 3EDPA 4L0YB 3ECOA 2FA5A 4FHTA 2EFNA 2OZ6A 1U2WA 2P4WA 4Q47A 3RYPA 4N0BA 2YSRA 4A12A 4I7HA 2OD5A 3WTXC 5H20A 5CVIA 4WXDA 3FX3A 4U7BA 1AWCA 3ABTA 4EJUA 5JI6A 1KYWA 2NS0A 2VT2A 2QBYB 3BJ6A 3F21A 2M5WA 5F1RA 2GA1A 2DI3A 3ULQB 1IN6A 2JT1A 4MNUA 2HTSA 3D5LA 1I5ZA
chains in the Genus database with same CATH superfamily
4Y13A 4HAMA 1GCQC 2ECCA 3KYCB 1HW2A 2XUBA 4HYEA 2A36A 2ESWA 3CC4T 1S72I 1E3OC 2DA6A 1Z0XA 3CF5F 2CT3A 2XSJC 1OMIA 2JVVA 4RTZA 3CEYA 4BDZA 3IKVA 5F0CA 3I35A 2OTLT 4MQVA 2BUDA 5D6EA 1BW6A 4M7AD 1UECA 3F3XA 3ZQ7A 2QSHX 2CZ1B 2PUOB 3FMQA 4KT0E 2DOAA 3C2HA 3VS2A 1U5TA 5DLQE 2DA1A 2QTXA 3M0UA 2LTPA 1XMAA 2IAIA 2VKHA 4BAYA 2CP6A 4CCKA 2V26A 4DGWB 1YX3A 1K0XA 4J9BA 2HFHA 2K5FA 4EMHA 3HPWA 1O3RA 4XRMA 3S2DJ 2L4MA 2LMJA 2ZPIB 1IUFA 5CKFA 4LFUA 5FKKA 2JMAA 1B72A 5CQYA 3BG3A 1Q82R 3F8BA 1Q82C 1QQJA 4L6V5 1UJ0A 4PFPA 1W7PA 3DV8A 4IVNA 2KRCA 2O6GE 3E0JB 1TQPA 5D5WB 1IUYA 3CUQC 3FKJA 1FBUA 3ZN1A 1R71A 2QKLB 2LFBA 3CCST 1LEAA 4L5GA 2IGKA 3SXYA 1JKQC 3K4CA 3PSIA 3OS5A 2YS9A 3HFOA 2STWA 2XK0A 1YW9A 2GQQA 1ZSGA 3CLQA 1JUPA 1AKHB 1WGSA 2DX1A 5GMKl 4ZYAA 3WU2C 1QW1A 2PEXA 4MDXA 4PJNA 4CYDA 2VXZA 2ZSHB 2FL7A 2A28A 2BY2A 1U06A 1A0NB 1JJ8C 2VXFA 4Y92A 1Q7YU 5IXFA 2RQVA 3FKIJ 3FXUA 4YG2F 2VONA 2LY1A 1MV0B 4J7FA 4GGGA 3BT9A 4A3EJ 2CO5A 1HLVA 2J6FA 5LJ5h 3QZ5B 3MN2A 3P8HA 3CPWA 1YI2I 5LBQA 3CMEI 3FF5A 3LSPA 3K9TA 3CCUI 2DL4A 1I39A 2J06A 2P0QA 4A4EA 1M90C 1FBSA 1M1FA 2QWWA 2MWPA 5D5VB 5CO7A 5LHIA 3CC7T 2LNHB 2H09A 1HC8A 3M59A 4LDVA 1HJDA 1AZEA 2OJED 4OIRF 2RGVA 1H8AC 5HK0A 1A5JA 3CCYA 2ZJQF 4HX7A 1AWJA 4PJOD 2DTZA 3AKZA 3QWYA 4M6XA 4NC8A 1RAFB 1PM3A 3DLLA 3K70D 5L3BA 1LNXA 3SWNB 4BNCA 1QVFP 3ZQFA 2LJ3A 3S17J 4LD6A 4FYXB 4M7DB 3JW4A 4LG0B 3DPUA 1NG2A 4EM0B 4LITA 4XKCA 3T0YA 3LH0A 4IUVA 5GAOp 3H3VK 2F1LA 3NARA 3I5SA 1X3WB 2NVTJ 2EH3A 2FU4A 2Y31A 2EFQA 1BKBA 3MZ8A 2HQNA 3WVDB 1QVPA 2BTTA 3H0GJ 4C2UA 3VS6A 2E2HJ 5FRMA 1QMCA 2BY0A 4N0AC 3L2VA 5FU7C 1MW7A 3CCRQ 5LRSA 2P7CB 4CICA 3VS1A 3I55Q 2R0QC 3OY9A 1UGSB 5HY6A 3R60A 2VYTA 4K11A 2P5LC 3SFZA 3ZMUA 4B1RA 4GFBA 2CQXA 1I1GA 3VSKA 2CV0A 3EFOB 3EH1A 4N4IA 4BUGA 2O0YA 1VQLI 2AZVA 2CWEA 2PQWA 3OBWA 5KHDA 1XCBA 5KYXA 4M7AG 4MMLA 2OX7A 1MMDA 2E65A 3DLAA 4A4KA 3GIBA 3QXEB 2LG4A 1ZYRF 1IDZA 1HD3A 3NPFA 4BH9A 3HRMA 4FIBA 1O7LA 2CW0F 4B3AA 1M3AA 1D09B 1WJQA 3CCEA 3BG7A 4GLMA 1K0SA 2RKHA 3KXTA 5GMKh 4I01A 3WE2A 2DA3A 2HKQB 4ESFA 3DU5A 4QT7A 4BXFA 1ODDA 2COBA 2K57A 3MZYA 4HF1A 1SFOJ 2HSEB 4GY5A 2JUFA 3BC8A 2LBFB 4YELA 5BNGA 1FP2A 1F36A 3E7LA 3BG5A 4RMNA 4UHTA 3HL2A 2C06A 3LSIA 3GTJJ 3G3ZA 2ZNYA 3SDBA 2YPRA 2MLKA 1VQ6I 2CS3A 2HZYA 3X24B 1BW5A 3AHUA 2VASA 5BS6A 4UUSA 3REOA 3IL2A 2BKDN 2YDLA 4KULA 5DM7F 4M78B 2EFOA 1IGUA 3A98A 4HNTA 2G7UA 2LD5A 3RJPA 4NL2A 4DOWA 5DLOA 1Z9ZA 2K5IA 3CC4Q 2PNIA 1R23A 1LVAA 1OYWA 3LSKA 1ETXA 4KMFA 4O6JA 2PLYA 3JSOA 4IIMA 4AIDA 3ZMDA 4RGXA 5KCHA 1NJIU 4NC7A 1VIEA 4C30A 1K79A 2WV1A 1K6YA 3JRFA 1E17A 2EIFA 2KAFA 4QVZA 5A0DA 3R0AA 4XM3A 2DJNA 1RLPC 2ELJA 3QYFA 2X4YA 3Q0UA 5KE2A 2RJCA 3HUGB 1STZA 4EQQA 2BZYA 2L3PA 2O4XB 1NLPC 3H3ZA 4PLIA 1MNMC 2VB6A 4DEYA 3JSPA 3TKYA 2NRAC 1R8OB 4Z2YA 3C2BA 3IHUA 1RQ6A 4IHXA 3BY6A 3EFSA 1EH8A 4UVAA 3WHCA 3FB9A 5HLIA 3DB3A 4HVWA 3VYHB 3PTAA 5GPAA 3ZP5A 2NVUB 2A6HF 3RPQA 2BW3B 2ZXWH 2CGHA 2KT8A 2EWNA 2YR2A 2KRHA 2L7KA 3L2RA 5K5RA 3JB9D 4I09A 1R9TJ 3CCSQ 2OQRA 2M8EA 2DTOA 3V4GA 2Y75A 1X69A 5DS9A 2LVSA 4IHTA 4KUMA 1B34B 3I53A 2COWA 3A8GB 3VU3C 4IJAA 3I56A 1S5LC 4RGSA 1BJAA 2QDLA 4OVAA 2Y4XA 2DYBA 1MH4A 3A52A 1G5VA 4MEXF 4LLLA 4M7AF 2VWFA 5GANj 5GMKm 2V7FA 3TO9A 2NUPB 2QZ8A 2HMAA 1I1SA 3N97A 4I2OA 4LIUA 3MCZA 2UZKA 3L42A 3IC7A 1NG7A 1OFCX 1LVKA 1K1ZA 1SRMA 2NWMA 1IW7F 2CQKA 2E41A 3E5XA 2MA3A 3G4SA 4BKXA 1TOVA 4QW2A 4BQOA 5A0LA 1W7PD 3CJNA 2AHJB 2BZXA 4X9CA 1PDNC 1EF4A 5IP7J 1IGQA 2M1HA 4A0ZA 2E5ZA 4ZYEA 2R58A 5DY9A 2XF6A 4A4FA 1S29A 2B0LA 2FEZA 4GYGA 1QWEA 1YE9A 2D2WA 4FSXA 5HCKA 3LOCA 3MP6A 2CREA 1X4OA 2VBZA 2N8GA 5LJ5e 1RI7A 4RA2A 3OYLA 3IWZA 3JRCA 1GXPA 3Q9VA 1F1ZA 3BZ6A 1VQ7T 2DW4A 2A6EF 1QP3A 4LN2A 4RB2C 2KJBA 4KN7X 5FU6C 1R1VA 2K85A 3COAC 1D0YA 4O3MA 1KHCA 4A3KJ 2YHTA 2KRSA 2VC1A 2XHCA 2LC4A 1RR7A 2WWYA 1M27C 2FJ1A 1K4US 2DYRH 2PJRB 1RLQC 2K7AA 2R7WA 4J7IA 4EJOA 3PNYA 1NHAA 2PVDB 1QVUA 5DD4A 1VQ5I 2GTJA 3AT1B 3JCMQ 4M71A 5GTHC 1VQ9I 2AXTC 5KYWB 1TU0B 5HLTA 3NWTA 1VNDA 1WH5A 4F52A 2KIMA 4DBRA 3GFJA 4P55A 3VYSB 1USSA 3MKWB 2EYQA 2IVWA 2JTEA 1RAHB 1A04A 1W5SA 4PK4A 4M3EA 4D7MA 1MBKA 2K2VA 2OAUA 1QQIA 2DEQA 4VUBA 1O75A 1ZREA 2EAYA 4F7UG 2V1XA 2QBYA 1GV2A 1ZGAA 3CCJA 4GRIA 2XROA 2IP2A 2UWMA 2F2XA 2FRWA 1QKWA 4KISA 2QEXQ 4HQMA 1S72A 5LEKA 2AXLA 4DIQA 4XRSA 1BC8C 3GFMA 3HHTB 3PUFA 2O88A 3CUOA 1TSFA 3MKZA 3WTYC 1ARKA 2EBIA 3PO3J 1PUEE 1KD1R 1KD1C 2F2WA 4CCOA 2KIQA 1PVEA 2M9HA 2A5WA 1IN8A 1W36D 2HVRA 1GDTA 5FKMA 4BE1A 1D3BB 3WE3A 1WLPB 2EZLA 2XDDA 3PJRA 1Q1HA 4J6WA 1LJ9A 1QZEA 2K3YA 3KEQA 4XN3A 5E79C 1ZLKA 4M75E 3KZYA 3BFMA 1YFNA 3CMMA 2EGCA 5IHKA 2EFIA 4DZJA 4ZZDA 4V19K 2ZMEA 2XRLA 2EZIA 2R7VA 3MMYB 2ROLA 3C94A 2VQCA 2VN2A 1Y57A 2RC4A 3RYRA 3JCMf 1UELB 1YCYA 2HKXA 5GMKe 1WZOA 2YX7A 5L23A 2VE9A 1QU3A 2LQ8A 3BR6A 3RDIA 2HR3A 1Z05A 2M4GA 2M7BA 2EQUA 2VKNA 1TUDA 4EJWA 2WV0A 5I2SA 4V2GA 1B8IB 1FXXA 5E1ZB 5HNFA 4LUEA 4EMKA 4RGUA 4C3IJ 2ZGWA 4CC4B 1APLC 4ESBA 4M78E 2E35A 3BOQA 3A03A 3I71A 2ZJRF 1IGNA 2RJEA 2EA4A 3IV5A 3M1CA 3G73A 1A31A 2ELHA 1I1JA 1E2XA 4M6YA 1T0JA 5KE3A 3DEWA 3A01B 4KICA 4PGGA 4CRIA 3DEUA 4OF1A 4UY8I 3EFRA 1LKXA 2HDCA 5TISC 5FU7B 3ZFJA 3CF2A 3H8ZA 3MFKA 2O9VA 1OKRA 2R5AA 2RQUA 3VV0A 2HOAA 5HOOA 4A3BJ 3NMZC 2LY9A 1AKHA 1I07A 4C5HA 5F1JA 2VL8A 4JX4A 1TL8A 2X4JA 2R7QA 3VS5A 3CMEA 3P7NA 4NS5A 3HOYJ 1YI2A 3IAS2 1TQIA 1W4MA 1YW8A 2E4HA 2ZSIB 5E8IA 2EQMA 2RHIA 1UHMA 1UHFA 4F7UF 5LJ5d 4DBQA 5BPDA 1FP1D 1IV8A 2IT0A 2V9VA 4P9FA 1B07A 3LSTA 1MSEC 2GIVA 4KT5C 4ZGJB 2HVSA 4HG2A 1V5FA 3FXRA 4ZYGA 3A8MB 3SHFA 1NEGA 2O3FA 3JRAA 1U78A 1Z77A 5ILSA 4EM1A 2WACA 2YUNA 3MHXA 1X1PA 3KFWX 3K4BA 2L0KA 2DT7B 2QI2A 4RAYA 3BR3A 1BYMA 2LR8A 3VRYA 3G6ET 4DYQA 3RZOJ 2XMFA 2E5KA 5FO5A 1FZPB 1FY7A 3RTRA 4EMSA 5LLQA 3O6BB 5JHFA 4KFCA 3DU6A 1LOJA 2EBPA 3SWNA 3JCMc 4OAZA 2IVMA 1T8IA 1X19A 3KCCA 5GAMf 4M7DA 1OYXA 4Z8AA 4MMKA 1YYVA 1R5GA 3IAM2 1SAXA 3UPUA 1P4WA 1MMSA 3AG3H 4HA8A 4D7NA 3WTWC 1NBEB 2A68F 2QLZA 1PSFA 2OTJT 1Y0UA 3Q3SA 3BDLA 2HTJA 3ISPA 1CQTA 1PP7U 1E7OA 2EQKA 1VQ7Q 1MBEA 1VQLA 3QAHA 4FCYA 5LRRA 1TNSA 2OQGA 4N4HA 1XN7A 3SQNA 5LGUA 1ZUUA 2ME6A 3HSRA 3JTGA 1YP5A 1TUGB 4OU0A 2CP0A 2ESHA 2CUDA 2RREA 2JXBA 4XK8E 4GCVA 1YWOA 2F5TX 2XGDA 2MOXA 1BB9A 3M58A 1KGSA 2M0MA 3E6CC 1FMWA 2NOGA 3JAMK 2HQXA 3CD6T 1CSKA 3EGDB 4UV8A 2E7XA 2E2JJ 1R22A 1REPC 2K40A 3VSLA 4ANJA 5HDNA 1HYOA 1YJ9I 3O8GA 4P5NA 5HLHA 5C6SA 1FOYA 2DFEA 4JJDA 1XC5A 3CBMA 2XICA 3JAME 1D3YA 1I8FA 1U9OA 1P9QC 1N6AA 4MDWA 3C18A 4TVRA 5KYUA 4AIJA 1FJLA 4CHUA 3WG7H 2P0TA 3FDYA 1C6VX 2DTIA 2DDBA 2DT6A 4I0AA 1ONVA 4EV0A 1ABOA 1TQMA 1NYFA 4WCIA 3H1CA 4XORA 2LKXA 3LMMA 2R57A 3PVQA 5J3BA 1VQ6A 2IIMA 3LFUA 2NNYA 2YRDA 3ZQQA 3FIWA 4NNJA 4FU6A 4GXOA 4MHGA 2LBFA 3KP2A 2L0AA 3J7ZI 1RAEB 4C9YA 1ZTRA 5DM6F 4LIVA 2IS2A 3VS3A 4LDXA 1G2HA 3HTRA 2QYOA 3H35A 3QWXX 2L4AA 4OB2B 3QPHA 1H3ZA 3H5NA 1XDSA 2DFFA 3D5RC 4BHBA 3CO6C 2M87A 4M9SA 4BEHB 2EFWA 2E1CA 3KETA 1Y7XA 2GNCA 1JJ6C 1YJNQ 1AWOA 2DZ9A 3W2WA 3BZCA 1OX8A 2BHZA 2X1DA 1VA7A 2KI7A 2LCSA 4IEJA 1RKWA 2DD4A 2Z33A 1TWHJ 1ETVA 2X98A 2NS7A 2ME0A 5HK3A 3MEUA 3GEZA 3CBPA 2IRFG 5KH6A 3HHGA 3OR2C 2JMWA 2O4XA 3GNGA 3MD2A 5HDGA 4KH1B 3FM3A 3UA6A 4ZTFA 3E9FA 1VQ4I 4BUPA 1LUJB 3THKA 1NPRA 3MZHA 3LQRA 2GTOA 2A37A 3OWTA 3G71I 2QGGA 2RPNA 3GXOA 2M34A 1HQCA 3QPTA 1KYZA 2K27A 1UJYA 2DIQA 2BW3A 4AMCA 4HQEA 3C7JA 3ESWB 5HODA 4N9IA 5KCMA 3JCMh 3GTMJ 1B34A 2GF7A 3A0HC 1JB0E 1V5GA 5IYBJ 3D7SB 3Q1JA 2OBPA 3A02A 4M3GA 4UXNA 4A63B 3WU1B 2I5UA 3KP4A 2WB1N 3GF2A 3LLRA 3R61A 1HCRA 2RH2A 3K4LA 1VQ8T 1MHNA 1WPKA 4RAZA 2DK3A 1KJWA 1FEXA 4M77E 4R8HA 2NUPA 3HM5A 4J9GA 2PX9A 2FMLA 3R6NA 3CMAQ 4X1VA 3SB2A 3CC2A 2O61A 1EIFA 1T0FA 3QP5A 2DMUA 2IS6A 1QKXA 2GQIA 4XQ3A 2XDBA 2Q1ZB 2OZUA 1A36A 4G7OF 1VYUA 3QOEA 2LCLA 3MEWA 1GCQA 1B3QA 3S6WA 1MBGA 2R7DA 1WHMA 4XN0A 2V8JA 4AG1C 3CCLT 2R7UA 2CQNA 1OU9A 1M2OA 5AIPA 2XAFA 3GLLA 1GFCA 2O8XA 2MI6A 4BI3A 1YIJI 1XSDA 1KC8U 4RLQA 1FOXA 1O57A 4LDUA 4D6WA 2HS5A 3PO2J 1K61A 3BJAA 1ORKA 4L5JA 1SPKA 3QKJA 3LAPA 1KA8A 3CCVT 4AUXA 1J59A 4C92G 1IO2A 4HX8A 1UHWA 1MGTA 2X6OA 5GAHJ 4XTYA 3G6EQ 2LMDA 3EH2A 7AT1B 1J5YA 5DCMB 1VQ5A 2P5VA 3S2WA 1KK7A 1QVFA 1M30A 3L09A 1V55H 2QQ9A 2Q2EA 5HVQC 4DBFA 3V7SA 2KLOA 5F0FA 2L3QA 4C2MJ 1Y0MA 2XU8A 1LCKA 4M7DC 1KG1A 5J4YA 4Q5SF 1BM9A 4RG8A 1PC0A 3AFHA 1ZRFA 1RRJA 4Z89A 4YFXF 1WJDA 1SFEA 3BCAA 4NUBA 1YITT 3F22A 3VUZA 5KYWA 4LXCA 3RMQA 2FNAA 2XB5A 3H36A 2Q0OA 1BBZA 3G1OA 3DKWA 4IOAF 3EFOA 3HRTA 2P0WA 3S32A 1M8MA 1P92A 1PNJA 3C3WA 2HBWA 2O31A 4C8QB 1VQMT 1Y0NA 1IO6A 4DYCA 5J8CA 4K2EA 4U87A 3W6VA 3A8LB 3CCMQ 4F91B 2W48A 3KE2A 1M2VA 5ILUA 2ZPFB 2EKOA 4JZ3A 1VQ8A 5GAMh 1UGRB 2IPQX 1T0HA 1DQUA 5FRNA 1OCTC 5J26A 3QYBA 3PMTA 3QYHB 2KROA 2H8WA 5GTIC 1M9SA 2ZXJA 1AWXA 1I3AA 1VYTA 3L1PA 4LD9K 2FUG2 2QK0A 2V1RA 2CS7A 1D3BA 1HXDA 3HHHA 2MD5A 2EYZA 2CSIA 1DPRA 1D1CA 5GAN3 4IURA 4B09A 3DLMA 3GVAA 5C44J 2VOOA 2XAGA 5GAN6 4RCBA 1SFKA 3KEOA 1UAAA 1OV3A 3M8FA 4J6XA 1I50J 3HOXJ 2NVYJ 3DPTA 2DMQA 3BDDA 2LQKA 4YIFA 3BTIA 2JW4A 1YJWT 1WA7A 3ZMZA 5FLXK 3KEYA 5IT9Z 4A4HA 2KXDA 5LJ5j 2KFDA 4F7ZA 4FX0A 2ROTA 4C3JJ 3LNQA 1XSVA 4X9DA 4J19A 1RAIB 1IN7A 2YLCA 3CXCS 4A3DJ 4M78C 4BQQA 2P4TA 2QA4I 4XU2A 5FLXE 1B8IA 1TBXA 1IF1A 3RMSA 1JT0A 3INZA 1AT1B 1Q81R 1ZSZC 2HI3A 1Q81C 1OOTA 2XIDA 3QP6A 3TVTA 1ZAOA 4M74A 5FJ8J 3HB9A 2QEXI 4JQFA 1JI8A 3H0DA 2VUBA 2EV6A 1POGA 2JPBA 3BG9A 3DCFA 2D9TA 4J9EA 4E7KA 1LPLA 2VBWA 3A01A 3SD4A 2P8TA 1X6BA 5GAMg 1UHCA 2E70A 2YWWA 1J09A 2LYCA 2CV2A 2GAUA 4II2A 3I58A 4XLFA 4QTRA 4G7ZF 2DXTA 3O5ZA 4N0AA 4LDYA 3H3UA 2QAZA 2HYJA 1OYYA 1KU3A 2EQRA 2WAQA 5DEQA 1N27A 4QPQA 5LJ3f 2CV1A 2EILH 5A2QZ 4OINF 5EYRA 3ZBDA 4F7UA 5L3DA 4WX9A 2O01E 3IP4B 2E64A 2RB6A 3TQ7P 1WSUA 2HNHA 1P2FA 4BXUA 3GF5A 2RQQA 1O4XA 3FHZA 4E6KG 1GBQA 4J9CA 2MSYA 3Q5FA 3NEUA 3META 2E3IA 2EGEA 3ASKA 3P5JA 4U0WA 3SJMA 3N4MA 4YIIA 2V79A 2P6TA 3ZQCA 3KUFA 5AIQA 5IYCJ 4KITB 1I81A 2YLBA 3JCMe 2KSSA 2IPOB 1BI3A 3TQNA 1N8RU 4CUGA 2CH4A 2NOJB 2Z2SB 2RO0A 2DOFA 3LSGA 4FASD 3TEDA 3OB9A 3QG1A 1Q95G 3IWFA 5KK1A 2HSPA 2GLOA 4AVPA 1VQPI 2BBYA 4R79A 2VKVA 3ZQHA 2X9DA 3ZXSA 1X6OA 2R5ZB 1U5SA 2FEIA 2L89A 4ZDLA 3REAB 2BVLA 3PQKA 2E36A 3BZKA 1QLYA 1ZA1B 5GMKj 2J5OA 1YBYA 1HKQA 1XTAA 3CCLQ 1P4XA 1YOVB 1CF7A 5CKHA 3HEFA 2STTA 1HSJA 3I54A 2Y9YA 3ERMA 2V9PA 1VFCA 2A08A 2DPPB 3IH3A 4HZFA 1WX6A 5CIUA 2FPDA 3K69A 3AAFA 2FZCB 1KU2A 1IRXA 1G59A 3J7AO 2W4SA 2A07F 2EYXA 2NUZA 3ME9A 4X1EA 2FNPA 5HNHA 1O3SA 3F72A 4HBLA 1YJ9A 4DBHA 4XLPF 3L2QA 3EHQA 1SMTA 4QVDA 2EINH 4M7DG 3MO8A 3RPUD 1J9IA 4G7HF 1DP7P 4IIOA 1JUSA 1WQ7A 2XPVA 4E2FB 1K9MR 1K9MC 5KYYB 2MH9A 3VODA 2DDAA 2JVGA 4RAFA 3X2QH 3VFZA 3JAMR 2KRNA 2LDUA 5E3LA 4U7DA 4KUIA 5ECAA 3SZGA 4A4GA 1YITQ 5F0HA 4XONA 2P0PA 1ZHFA 1GUUA 3SFMA 2VPLA 2G3RA 2FE3A 1VQOI 1P6RA 2V1UA 1BIBA 2CYYA 3IRQA 2GOXB 1YHQI 2KXCA 1VQMQ 1SG5A 3RR6A 4ZGEB 3I4PA 1GXQA 1GLNA 2VQGA 4A0YA 1GVDA 4S05A 3OMGA 4UC4A 1FMVA 1U6GA 3B6AA 1MMAA 1JKOC 4BHCA 1JXSA 5EEGA 1VF9A 4AWXB 1PUFA 2OCEA 5K7ZA 9ANTA 1UE9A 1WJFA 3QUIA 4C8QE 4S0HB 3R4KA 1AOJA 2FHDA 1DPUA 1XTDA 1ZBJA 3QYGB 1P4AA 3J80Z 2DODA 2FQ3A 2KISA 3TDZC 4KA4A 2JA2A 1QO0D 2DPUA 3BDUA 4JRIA 2PG4A 2QQBA 2DMNA 3S16J 5GAMe 1D0ZA 2M30A 3MWMA 3RKQA 3CESA 1U8RA 3DPLC 4BHPA 3CZ6A 5K5OA 1S3JA 1KU9A 2IA2A 2X1CA 2UXNA 4XLNF 2D1XA 3HTSB 4IXAA 4BEHA 4E7IA 3JRZA 1M1KR 1M1KC 3CCET 5E1WA 5IHIA 4M9XA 4F17A 1K6OA 3MJXA 3LSJA 1R77A 2AKLA 3MEAA 1RPWA 1VQ4A 3OS0A 2D1HA 2PU9B 4Y28E 1PCXA 4C5IA 3G71A 2CQ7A 1BR2A 1R0BG 2JM8A 5ICEA 4CYCA 1FTZA 1EX4A 1Q1VA 2QDYB 4M78G 1X3ZB 3OSVA 4XSXF 1K9AA 3SZPA 4QLCU 2ETHA 3M4GA 3LWFA 4A6DA 1IAWA 4B9XA 3DTEA 3VKIA 4KGVB 1KQSS 4UB8C 4UUVA 5IH2A 2IW5A 4W1UA 2RD1A 5TJJA 2QM3A 2ED1A 2HL5C 3I64A 4JLGA 5LEJA 2R7RA 4C0DB 1XJWB 4EJTA 3F0CA 4M7DF 2CG4A 1NE8A 1E3PA 2D0NA 1VZ0A 2IA0A 3V7RA 1SC7A 1TLHB 5D6FA 4Y3OA 4BYYA 3J7YJ 2RHUA 5CR2A 5CKEA 2WA0A 2K9QA 1XGOA 3ASNH 1AD5A 2E6ZA 2L2OA 2DA4A 4RB0A 4M9ZA 4HLXA 5E3MA 4Q48A 3WTSC 3GTLJ 5FKOA 3HOWJ 1I0CA 1G6NA 2FX0A 3GZ6A 1I5OB 3OW2P 1GCPA 1QPMA 3M55A 1YJNI 1TH7A 1OCRH 3P9CA 4ZNXA 3P8DA 1YNZA 5D6WA 3UR3C 2DFHA 3SEMA 4B8XA 4KJZA 2RI3A 2XGEA 2W0ZA 4MZTA 4CO8A 5LJ5g 5KYYA 1YIJA 3I9QA 4E70A 4IUQA 4E47A 1AHJB 2CMPA 2W24A 2W1OA 2WSEE 3BR2A 2M0CA 4M75B 2WADA 4ASNA 2OA4A 2QGUA 2JA8J 4Q5WA 4MZMA 4XTWA 1VQKT 3I56T 2M4KA 4ITVA 4AU7A 2KQRA 3FRNA 4BY7J 4ESRA 1VQNI 2K3BA 2TRTA 3O3KA 5BQTA 2MCNA 1YO5C 4N4OB 3FM5A 4XQFA 3RQIA 3BPVA 3ZRGA 4U0YA 2XHKA 3S2HJ 3T9NA 2YUQA 4RTTA 1W5CC 3S93A 3WG9A 4JRQA 2NVQJ 3D5SC 1TT0A 3DTKA 4YFNF 2RV8A 3L2WA 1MJBA 2DA7A 4DYRA 2RHXA 5GJVB 2NNNA 5FLVA 2DL5A 3GTQJ 1EFNA 3UATA 3CCQT 2JNGA 3ECHA 2E1HA 3HOUJ 1OX9A 4QQDA 2KE9A 2IGNA 3G4ST 1H8KA 2LJ0A 1ON1A 2PBIA 1X2NA 3A0BC 2BIVA 2HYGD 3BY7A 3CDHA 3OMYA 3J81Z 1D5YA 3PSFA 1K78B 1ZSZB 2OUMA 2F2VA 2FQ4A 4M78F 4E7JA 2GQVA 3TOBA 2OTLQ 2WY8Q 5D5XB 4ME7A 4C92B 4PUSA 1RUNA 2X0LA 3CMAI 3I59B 2IEKA 1AZGB 1SFXA 1X58A 2P7VB 4C8QA 3ZMSA 2ZCFB 1QP2A 5GAMd 3I5UA 5FW9A 1SANA 2EIMH 1DJ7B 4PJJA 4U0VA 1T33A 2K4YA 2MWOA 2DA2A 3SDGA 4QQGA 1WGXA 3HJEA 3E5UA 2AO9A 1R1UA 3KFVA 3ZMVA 2HNIA 3GMEA 2EQJA 2QYZA 2H3JA 5B3SH 4IO9F 3I9V2 3C12A 1IRGA 4FTHA 2DA9A 3MEXA 1TWFJ 5GANf 3T1BA 1QCOA 1R1TA 5K1YA 2GBQA 3DKMA 2WBMA 3KLNA 2HEOA 3D1NI 1UEBA 5KVRA 2BE7D 2SEMA 3CCJT 1QHHD 1YRNB 1OEBA 2ZO4A 4IKFA 1J0RA 2QA4A 1WIEA 4AFUC 4ENMA 2J6KA 1R5HA 1XDUA 1ZRDA 2J7IA 1E3HA 1YX5A 2MLGA 3L2UA 1Y07A 1A6QA 4D5CA 3OS2A 1S72T 1QRYA 3FBNB 3J80K 1WXUA 2DXBA 1I27A 3IUOA 2XI9A 1BCMA 4C0ZA 2QXFA 1QZZA 3C2GA 4II3A 3CCQA 2DO3A 2H27A 3V7CA 1WRJA 1ZRCA 2Y90A 3CCEQ 1R58A 3CCMI 2K3PA 2ZJPF 4LUDA 2A3LA 3H9NA 3OYBA 1Q86U 2VC0A 1JJ2S 2KGTA 2MAMA 4Y4RA 3S14J 2LK2A 2DTRA 1SHFA 4X34A 3M8EA 2GWRA 1Y8RB 1C0MA 3FXMA 3TU4K 1HDDC 3G1JA 1T2KA 2HZDA 4P96A 3J7AY 2L01A 4L9JA 1LDJA 1ON2A 2D6FA 4ZYDA 1WHJA 1QVGS 1N78A 5K7HA 3KP5A 3S1NJ 1ZK8A 1O3QA 3V8LA 2ABLA 2FF4A 3GZ5A 2K7LA 5ERIA 4IUUA 3U23A 4ATOA 2K6DA 4MZPA 1QGPA 3HYIA 3M1EA 3OMCA 3FK7A 3GBQA 4FISA 4L5IA 2JOYA 5D5UB 4ZZLA 1SVOA 1N77A 2B7EA 3FWEA 3I56Q 3T5XA 2NYSA 2HWVA 3FMSA 2VIXA 4LG3A 1G3SA 2COZA 5EEHA 2QSFX 2QG9B 3BQZA 1ZUYA 3HBLA 4M3DA 2CFOA 2IS4A 2VBXA 3HIFA 3BJOA 1NLOC 2EW3A 3M9QA 3JRGA 3QYEA 4MGRA 2IA1A 4ZJZA 1BL0A 2HBPA 3AG4H 4II1A 3E1SA 4OB1B 1X1BA 4BU2A 4RB1A 1IC8A 2XSDC 2VXEA 3W3CA 4AVZA 3E6DA 2RM4A 1X1DA 2AZSA 1MJAA 4C8QD 4NOYA 3WXMB 3HDDA 1YI2T 3CMET 2KR3A 2ZPGB 3CCUT 4W97A 3RQ4A 5DV5A 2F48A 3UT1A 2R5ZA 1IREB 2QENA 2CDTA 3M8JA 2ENMA 2MYSA 3GUDA 1SD5A 1K7AA 2E2IJ 3EGXB 4IOCF 4OMQA 1K73U 5LHGA 1VQKQ 2LJ1A 1LE8A 8AT1B 5M5XJ 2IGOA 2HZTA 1NH3A 2DQLA 2K5CA 5DDGA 1SF9A 1UGPB 3H41A 2ID3A 2OF7A 2Z3YA 4G94A 3F8CA 1RR8C 5EZHA 2QTVA 2L7FP 2L02A 5DYMA 1Z3XA 3CXCP 1JXMA 1O7FA 1MUZA 1VOMA 4PJOB 1PWTA 3MCAB 4QQ6A 3X20B 4MTDA 3BTJA 2CH0A 2DJIA 2XAJA 2MIOA 3KPHA 1TUCA 3OQ5A 2YUPA 2EQIA 2DTHA 2VGMA 1KIKA 1RADB 4A0XA 1VQOA 2EPFA 1Z21A 1KONA 4BJ5C 1IJWC 1MGQA 3NGPA 3REBB 3G4SQ 1I5LA 4LB5A 1YHQA 4G9YA 1XMXA 1JU5C 1OR7C 4Y7NJ 3VJPA 4F04B 4ZGDB 2EB7A 1OI1A 3HOSA 5CQXA 3R6SA 3FDRA 2ZZDA 1MKMA 2E1MB 2I8DA 3O8HA 2EJGA 1EA3A 2DO7A 1ACIA 1YS6A 4ZC3A 1R7JA 3GTOJ 5HKCA 3LWHA 1VQLT 3K4NA 5IYDJ 3NHNA 5CQGA 4J83A 4ORZA 4C92E 4C8QC 2XKOC 1HKTA 1X75C 4PL6A 1NEBA 1M4ZA 4C0FA 4M77B 3CCLI 3HP9A 3VS4A 2DF6A 4OP0A 3H92A 1YCSB 3GFLA 2M51A 1IN5A 4AFZC 2COMA 2CUZA 1J7KA 1FIAA 3CCUA 2ZAEA 3F9KA 2JRTA 1Z6TA 2JWTA 1T98A 2LVMA 3K0LA 2A61A 1U0JA 3HSFA 3KP3A 1R0CB 1AHDP 4ENNA 2EYWA 2M35A 4ENKA 2DIGA 3GYHX 3ULRB 3OYNA 1QNTA 5J3LA 1T3LA 2GZWA 2KYMA 4CC7A 3CCJQ 4A93J 1VQ6T 2J05A 3LFKA 2DMTA 4S04A 3BP8A 3M57A 2HQAA 1OCOH 3W6KB 1S72Q 4MIMA 3U21A 4CDGA 2KNBB 4LLGF 4F16A 3HTUA 5E1XA 2M7AA 2RJFA 2JK3A 1EKEA 4BACA 3S3MA 3OYMA 2IXSA 2LT4A 4CZCA 4E4HA 4O5VA 4PFZA 5GAN7 4MFDA 2DK5A 4ZN1A 5GANh 1RABB 3T8TA 5I21A 1LQ1A 2MMPA 3TEEA 4AIKA 3G1MA 2RAEA 2A3SA 3CQTA 5BOXA 2OPTA 1W70A 4LG0A 1M1KU 1FYNA 4XLCA 5L3CA 2W25A 2PQ8A 2ZXHA 2PN6A 3W6JB 1XX5A 3CLOA 3BLYA 1DU6A 1EV7A 2O7OA 1PG5B 2JN0A 2X9HA 3IQLA 3ASOH 3ZOBA 4G8XA 2F6CA 4CSWA 1W0TA 1K4SA 4EGZA 4M7AE 3A8HB 3RKYA 2VLAA 1K73R 4AFSC 3LWIA 3BW1A 3FHNA 4HRIA 1B6AA 3GW2A 3JSCA 1ULYA 2X51A 5FD5A 1W2BS 3VYUB 1WJCA 5GADJ 4RTWA 2VKEA 3M0RA 2XB0X 5GAGJ 2EJRA 3WTTC 1ZG5A 2HOTA 3HOVJ 3PL8A 1W5TA 2HQ5A 1MMNA 4KNYA 1VQNA 4J00A 1ABQA 2VQHA 2ADUA 3P8BB 3FBIB 1B7TA 1WQWA 3VS0A 5J1RA 3RERA 1DDNA 1SKUB 1WI9A 2K5LA 4Z6YA 3FISA 1HDPA 2LF8A 3HGGA 2DLLA 5D8LB 4M75A 4V2SA 2RNJA 4OIQF 1J2XA 2P4RA 1XGMA 2DYIA 1UTIA 4RTVA 3RDVA 2X3WD 2RHZA 3OSSC 5GAMj 2XIGA 2LSOA 3L9FA 2UXXA 5E3NA 1I4K1 2JJ9A 1U5TB 1QBJA 4KGZB 5JVTA 3S15J 3JCMP 1ZQ3P 2JZ2A 2Z16A 3RKWA 3PIOF 4JS5A 1WNLA 1RI0A 1Z9QA 2EIKH 1YI2Q 2DJZA 2L3DA 2YSQA 3CMEQ 1HKSA 1OPCA 2FOKA 2ZCWA 4J9DA 4HXJA 3PVLA 2M3AA 2X4HA 3CC2T 5FGMA 1I6HJ 2PVGB 1MSFC 2D8HA 3JCMb 1W7PB 2E34A 3KLOA 2CRGA 2WTEA 2Y69H 2ZC2A 3VYTB 1PKTA 1BBYA 1BA5A 3HG9A 3CMAA 3CCRI 2RJDA 5HS9A 4A3CJ 3QZ9B 4M78A 1JEGA 3I55I 2KEAA 2XG8D 3F8MA 1H3HA 2LP5A 1K78A 2VE8A 4D1QA 4EGYA 1ZSZA 1SD6A 1TTHB 2MF2A 1JHFA 3PIPF 5GAOl 2F5FA 3MP8A 1TW3A 3MKDA 3LGLA 4AFQC 2MC4A 2YRCA 4XLAA 1H0MA 2CSOA 3I59A 2FB7A 1KQSP 1WKMA 4B44A 4V2FA 4BGDA 4JLIA 3H0FA 1XB4A 3OR1C 4LGWA 2TCTA 2K86A 4PJLA 1S1NA 4JS4A 1VQ5T 4PJOE 1RETA 4LK1F 3HUGA 2LT1A 2W82A 2KMTA 3VRZA 2V8KA 1JUMA 1C1AA 5LD2C 4P5OA 3AG2H 5J8FA 3DXJF 1WVRA 1ITYA 5FLMJ 2Z9OA 2UUZA 4A3JJ 3TCJA 4IHVA 3A8OB 2R7TA 5F27A 3K10A 1MIJA 3IRRA 2W7NA 2Z0WA 4L59A 5J40A 1X2MA 3OYEA 4L0ZB 2X4WA 5EF6A 4C8QG 2FXAA 3BR0A 1FYLA 4HV5A 1PYVA 1SVMA 3FK6A 2H8RA 3RIRA 4XICA 4J9IA 2ZBKA 4J01A 1BK2A 2EK5A 5FB2A 5JVGF 3R6OA 4BJTA 3ZGKA 2F5VA 2KRFA 4FT8A 4OMPA 1YRNA 2F69A 3ZQGA 3CC4I 5IPAA 4PJMA 3WTVC 3C95A 3NTKA 3CCMA 2XGCA 3CP2A 4PCQA 3VOEA 1QCFA 2LNBA 2CYZB 4BBRJ 2OTLI 3B02A 4DOVA 4F92B 1EZZB 2ED0A 4FE7A 2CGPA 3RBBB 2GBYA 4PJOA 2RVCA 4RB3C 4ZH4F 5J1YA 1S7AA 1ZUKA 2DE0X 2DXIA 2C0IA 5H6RA 4B43A 2B9SA 2OV7A 1YFHA 4CC3A 4RMOA 2E5QA 1VQ6Q 4XRFA 2O5RA 4A3FJ 1FSHA 3QSUA 4FYYB 5DD8A 2JQ7A 1S6LA 2WAEA 3HKZN 1HSTA 2XASA 4Y33A 2NVXJ 2DNUA 2DRKA 5GAN2 2ACJA 1BIAA 2K3FA 4M3FA 3JB9H 2FRHA 2OJ2A 3EPZA 3H9QA 4IZZA 1HW5A 3KP6A 4OGCA 4DW6A 4KT6A 2JS0A 4ESJA 3H0IA 2IBDA 1R5ID 2MW8A 3F6VA 3CCSI 4Z88A 1ZH5A 3GPLA 1VQ9A 3DTIA 5B66C 1JHHA 1FIPA 5KYXB 2K02A 5M3MJ 8ATCB 3U2RA 2M0OA 2JSCA 2JTFA 2VT3A 3KX2A 3JCMg 5GAOq 1KFZA 2CFXA 3OYJA 2PJRA 2DN0A 2VPRA 1BU1A 4OGEA 3JRHA 5LL6S 1JKPC 1W0UA 4RTUA 4C0DC 5GANe 2DAQA 2OTJQ 4IPAA 2VOPA 3HRUA 2KP6A 4X6AJ 1EH7A 3P9KA 4BL0B 1YS7A 4JBAA 4DQ2A 3QU6A 2KK4A 4XAXB 3OW2A 4QPOA 3VS7A 1RKTA 3EYYA 4PDKA 2K9MA 3E6BA 1UCRA 3OOPA 1YWPA 4JX5A 2FG0A 2DEUA 2G7HA 1B1BA 2FVUA 3N5BB 1T6SA 3SYTA 2QGFB 3C0CA 2RK1A 3PE0A 4C8QF 4QWQA 3G1LA 2F5EA 3OL4A 4XSZF 5E18F 4X0GA 4IRHA 4J9HA 2Z1DA 3W2AA 3GTGJ 2QKMB 3CD6Q 1KQ0A 4B6MA 3CC7I 2M9UA 2BZTA 3EUHA 3F8NA 3PM1A 1UB9A 3WU0A 2ATCB 1JXOA 5H2FC 4FW2A 3IH4A 2AQEA 4HCZA 3ZQLA 2YX4A 2K79A 4OMLA 4OMOA 4MO7A 1LFUP 3GBGA 4NQWB 4M7DD 4M75C 2ZNZA 2H94A 1X4PA 4XNFA 1ZLJA 3JREA 1IDYA 1JO8A 2LQNA 1PKSA 1O3TA 2M8GX 5F6FA 2DBBA 5GJWB 2EYYA 1P7IA 1GXIE 2I2LA 5I11A 3HKSA 2G6FX 4KH0B 2LY2A 4A3IJ 1F5TA 1KU7A 2KKOA 3L1AA 3J7AF 2BOLA 2CU7A 3DF8A 4KN4X 3JRBA 3CMYA 2CT4A 2XKPA 2LQWA 3HSBA 3CC2Q 4KRTA 3CO7C 5FFZA 1JJ2P 1E6HA 2K9SA 5B1AH 2FPEA 3HPHA 4MLOA 3CDLA 3F23A 3EGUA 1MZBA 2K2MA 2KL4A 4EDUA 1ETKA 4B47A 1Y96B 2TDXA 4U88A 3LYIA 3VYGA 3NRVA 1B4AA 1GRIA 4J5YA 1QVGP 1OCPA 3GO5A 2CUJA 3L2CA 1ZLMA 2KRMA 3QODA 4FT2A 1R00A 4C92C 3RCOA 2WB1A 2GCXA 1JE8A 2HYFA 5JR3A 4H4KC 5CPRB 4HDUA 1N9RA 4C3HJ 2B86A 1DU0A 1YJ9T 1VQ5Q 2RDPA 2XDPA 3OA6A 4M77A 5DM7R 2K3XA 2HEQA 2LRDA 3A4CA 4WWCA 5LGTA 1V29B 2R7SA 4L18B 3I4NJ 4UNOA 2HCKA 4XU3A 3E97A 5CKBA 3CPWS 1ETWA 1MD0A 5IHNA 1KC8R 2MC3A 1KC8C 4BB7A 2W84A 2WY7Q 4DZPA 1KZHA 3VYRB 2BE9B 3GOXA 1G83A 4FYVB 2RI2A 5I2MA 4LD5A 4NBQA 1WJEA 2P6SA 2VJ5A 4M78D 3HKZA 1N5ZA 4R55A 2KMUA 1N75A 3TW7A 3K1PA 4A3GJ 2HDWA 3G2BA 2EZKA 1D8JA 1TXQA 1IXSB 1QCNA 5LHHA 5H6QA 4IQ4A 3BR1A 2RQPA 1VQ8Q 4WXCA 3TP0A 1FLIA 1H641 4BQAA 1LPQA 1DUXC 3K4JA 2HXIA 1F4KA 3GTKJ 1SAUA 1B59A 2NUTB 4BE2A 1M90U 4FQGA 1FC3A 2BY1A 2W00A 1ETOA 1EH6A 2IJLA 4LDWA 2RNAA 1X1CA 2EPDA 2L3RA 3I3LA 3LSMA 2M2EA 1BN5A 3MQ0A 3PNTA 1VI0A 3OOUA 2FBIA 1OCCH 3A1PA 2FO0A 1LDDA 3KBGA 2XVCA 5IP6A 1HOMA 2M02A 2BZ8A 3DP7A 3RUXA 5HDKA 3RKXA 3ML6A 3TOAA 4KIGA 4HF2A 5CKTA 1R49A 4Y91A 1VQ4T 1BCOA 2PZ1A 1CKAA 3VUBA 3CCVQ 2DFIA 4A6EA 3OIPA 1ZG1A 2FPFA 3G71T 2ZPEB 4PSWA 1AWWA 1RAAB 3JR9A 3CC7Q 2ICWG 2EKHA 3K4MA 1H89C 4BS9A 1X27A 3TP3A 4OB0B 3D0SA 1H92A 2BXZA 2XRNA 1B9NA 4A2UA 4OMMA 5LGNA 3FJPA 2EVRA 2KZGA 3LGFA 2DAOA 4KMUX 1TP4A 2H6BA 1OCZH 4B4CA 4HCKA 4H0EA 3EGDA 1I6XA 2F5KA 1V76A 1UG2A 1S9HA 2R4GA 4BE0A 1XCVA 1M3BA 2FYKA 2DZCA 5CJ9A 5F64A 1JGGA 2VODA 1ENHA 2MH2A 5E8GA 4HCBA 4MTEA 2ZMEB 3A5ZB 3H5RA 4CZZA 1ZHIA 3LH5A 4ZN3A 2YXYA 4E7HA 5ILVA 4WTOB 3PIOA 2ECBA 4CGZA 1LFPA 1IZ6A 2FBKA 4AIHA 4JJBA 2KDZA 3RI4A 3L2ZA 2LNVA 1G8XA 1K8AU 3JCMJ 4CI0C 5EG0B 3OIQA 4AC0A 2F2EA 1T56A 5KNLA 2GXBA 3CCRA 2MVTA 3I55A 4HT8A 5EJCA 1S7EA 2YUOA 1JJ2A 3OYDA 2O03A 2E12A 1QZYA 3HRSA 1V1CA 4M75G 3EUHC 4HV6A 1X1AA 1ACMB 2DYSH 4EMKB 4F55A 1YIJT 1M8VA 2H6CA 2HGCA 1M1EB 4XR6A 1VQ7I 4I6ZA 1H9GA 5AONA 3TW6A 4R0KA 4UV9A 2VGNA 3PIPA 3IKTA 2HOEA 1Y56A 2DL3A 2WSCE 1T95A 2EZHA 5I22A 3KP7A 3CXCA 2Q8KA 2R5MA 4B48A 1FBQA 3ZCOA 3E6MA 2KVQG 3MEVA 4KYWA 1VTNC 3GTPJ 3QPSA 2ID6A 3A2KA 1QWFA 2HKNA 2CP5A 3RNJA 4PJOC 1YJWQ 3EYIA 1XG1A 4JRKA 3M4OJ 3K70C 6PAXA 2FZGB 2CW7A 2L2PA 3EG1A 2A5YB 1RACB 2DXCA 4ABZA 5IT9K 4M73A 1RAGB 2LRQA 4BI4A 3X28B 1RESA 2X85A 5J39A 2CH4W 3H9GA 1SSHA 1TWAJ 2R3SA 3NAUA 2G9WA 2KT1A 2ESNA 1D0XA 2E7WA 5IT9E 3MVPA 2MD0A 1Z67A 2LLKA 2VBYA 1R6RA 2V1QA 3I4MJ 2GA2A 4LE9A 1N8RR 1MNEA 4CA0A 2KIFA 5HLGA 3PFIA 3HOTA 3EHRA 5CAIA 4EM2A 1N8RC 3CC4A 1W2BP 2E1MC 3GZNB 3JCMd 1M90R 5IN1A 2BE5F 2JVHA 1TWGJ 3PGGA 3OV8A 1PD1A 3QJYA 3EG0A 4OIOF 4M6VA 4ETSA 3CP8A 3TBIA 1YJ9Q 2OTLA 3L00A 5EC7A 3O2PE 1WJAA 3OYYA 2D45A 5C4XJ 1GL5A 2DJQA 3OYHA 3DFGA 2IG0A 4EIKA 4M77C 3BCBA 1KQ2A 2KJCA 3BTLA 2H8HA 3HFNA 3DBHB 2X4XA 2CQQA 3FXJA 2HD0A 4XK4A 2XAQA 1Y71A 5A2QK 3NFCA 1MNDA 1BC7C 1IXDA 2LZ6B 1ZX6A 1ZG3A 4ZDOA 4OAYA 3M07A 1XGSA 3QOPA 3ZN0A 3SFIA 2QQ8A 3K1NA 1TZLA 4YFKF 2JA6J 2I0NA 3M5AA 3MKLA 1N25A 2E5NA 4MEYF 2ZB9A 5A2QE 4HT9A 4XLEA 1OZ3A 2V1DA 2LOOA 1D5VA 3H0HA 1KSWA 4XU0A 2QQRA 5GAN4 5EGOB 4IF4A 4M75F 2Y2ZA 3CCSA 3K2ZA 2H1LA 1Z1DA 1BI2A 1WJRA 2M0YA 2W10A 2X3XD 5GAOn 5LJ3h 2QA4T 3HPGA 2L8DA 4L9TA 3U1KA 2NAZA 2O9LA 4BY6C 4JYKA 4M77D 5B5EC 1FNNA 5CVJA 3RZDJ 1FX7A 1UGQB 2B8AA 3JV3A 4IHWA 4OMNA 2QEXT 4HEA2 1GFDA 4LJZF 5DCMA 2GM4A 4FW1A 2NYXA 3HSEA 4D8KA 4HSTA 3FXLA 2AK5A 2VC8A 4D8DA 1OLTA 2GGRA 2BYVE 5IOYA 5KYUB 1OR7A 1JKRC 3KYDB 1YIOA 3LA2A 5ICFA 2GOMA 5L8RE 3GWZA 1UG1A 2XF5A 4RCCA 3LSRA 2Z5UA 1G3YA 1VQ4Q 4I99C 3ZR8X 3QDRB 4GLKA 3FMRA 1NPPA 4LMYA 3G71Q 2COYA 1RIOH 3CC7A 3E2UA 4YTLA 1O9SA 4B9WA 4C92F 4ELYC 4XKWA 2CUEA 5GP9A 2MPXC 2DPDA 2XKOA 1S8NA 3EQLF 1BR1A 3FLGA 1F9NA 4OIPF 1R4MB 3U1DA 3TL4X 3A1YA 4I76A 4G12A 4IL6C 5E20A 5HS7A 3TDUC 2HL3A 2NS8A 5L3GA 3RESA 3UWNA 4I98B 2VI6A 1IRZA 1PRMC 3BWGA 3SZTA 2BEOA 1IHVA 1PD0A 2MZ4A 2CP3A 2MABA 2WAFA 1MDMB 2WC2A 3G6EI 1SSFA 4BY1J 3UDCA 2KZVA 4NQWA 2EFPA 2K4JA 3EG9B 2L9VA 5LJ3g 4UUTA 1HW1A 2RQRA 4LB6B 2C6YA 1YW7A 4FYWB 1VQPT 1GV5A 3WTZA 4EEFG 5CVRA 4ELZC 1U5TC 4PNOA 1PJRA 3M54A 4MQ9F 4J9FA 4EJVA 1KD1U 2C0TA 5GAN5 3H6ZA 1TWCJ 1Y1VJ 2L7ZA 3OYGA 1TC3C 1XPXA 2VVKA 2VQLA 2DL7A 4KIBA 2K9LA 2R7ZJ 3AL0C 3M3YJ 2DBKA 1JTYA 1YIJQ 2OTJI 2RN7A 4JX6A 1UDLA 5GAEJ 1MBFA 1LJOA 2VJ4A 5FLXR 2QEXA 3UNGC 2RQWA 3FIFA 1IXCA 4RG2A 1UHSA 3BPXA 4E6RA 1WI3A 1Y96A 3BQYA 3J80E 4FETA 1BOBA 4F14A 1FTTA 6AT1B 2UV1A 3SEQA 1OJLA 4AD9A 1K4TA 4PJOG 1W6XA 3VDXA 4B3XA 1T38A 3TREA 3CD6I 2JUGA 1HSQA 4M7AB 1TWBA 1PSEA 1KQSA 4HPQA 4AYBN 1H88C 2L7MP 1Y8QB 4PGHA 4WXHA 1IZ1A 5F04A 5D4SA 1LDKB 4OMFB 1FYMA 5J1UA 1FPQA 1IB8A 2BXYA 2CW8A 1A35A 3ABMH 4HX4A 4DJAA 1G4DA 1VQOT 4CXFA 1WYXA 2OAWA 3ABKH 2OU2A 1BR4A 3FXKA 1LNWA 3KZIC 3NWSA 5CVVA 3I5RA 2V1NA 2FBHA 5DCFA 2KDOA 4P9UA 3SHWA 1YHQT 4AT1B 2KIUA 1XMKA 1ZKGA 2XPWA 2O8KA 4A69C 2Z99A 1MV3A 4RTYA 5KAIC 4UVBA 3N05A 5B1BH 1FOWA 4XKBA 1WI7A 1WWXA 5FROA 4AM3A 4XTZA 1NK3P 1V54H 3CC2I 4QIWN 1RNLA 4M77G 1IN4A 5CLSA 4A5MA 3QBYA 2DCEA 1FMKA 1MBHA 4HDVA 1NYGA 1TS9A 3M0QA 2O9SA 3L7WA 1WHKA 4NDLA 3LAJA 3ABLH 1HF0A 1UGVA 3U9GA 5J6XA 2Q2EB 2ZXIA 2W85A 4OWRB 4AG2C 5EG2A 1L0OC 3DEEA 4JP0A 2VJJA 4N9HA 4Y15A 3GX4X 1NG6A 2KPMA 2V4JC 3JAMZ 2ISZA 1JQQA 4PKCC 5D6XA 1W36C 1XNIA 2BVMA 2E19A 1V3FA 1TW2A 1WFXA 5ED4A 1U8BA 2YUSA 1LFBA 4M7DE 4CCJA 5FD6A 3F8FA 1Z6RA 4TV7A 4MFEA 1FOKA 3Q0WA 1WFWA 3CUQB 3OSGA 2ZKZA 1SHGA 2QCOA 1FT9A 2O2OA 2RMOA 3E19A 4C5EA 4QVCA 2F4OB 5D4RA 2L9RA 1JTXA 3EUKL 4F93B 1ZR4A 4KDPA 2HAXA 2QA4Q 1IHWA 3E9GA 3O8VA 4N4GA 3JCMW 5D7UA 5FWBA 4R56A 1M2VB 4BQNA 1ZA2B 2E1OA 2LX9A 1M3CA 4OMZA 1QA6A 1K76A 3E5QA 3KYLA 3J7AW 3FXOA 3K4KA 2K9GA 1YN8A 1IXRC 2W57A 4PJOF 3PNWC 5LJ3e 3CCQQ 2FZKB 5JLXA 1E0EA 2JTVA 2LF7A 4RLFA 5L3FA 2MK5A 3C1DA 4BXXJ 3GFIA 2Y9ZA 4YIRX 4A53A 3PMIA 5K5QA 3J81K 1VQ8I 1UJ8A 1UFFA 2AQFA 3S8PA 4WCGA 4IHYA 3FXQA 1U3EM 1AOYA 1I3QJ 5DUIA 3UF4A 2R5YB 1YJNT 4WF2A 4BD3A 4OOIA 2F4MB 3BTCA 3J81E 2CUFA 3CPWP 4G6DA 1KQ8A 3LA3A 4UB6C 3B6CA 4ON0A 2DMOA 2XDVA 2LREA 1H9TA 3KZZA 4HNUA 4XOTA 2PJPA 3MPUB 5C0MA 1Y6IA 1G3WA 2EIJH 4HLYA 3GP8A 2QVOA 2E10A 2LDMA 1VQ7A 1M1GA 3GNFB 1Q86R 5EG0A 2OAZA 3JB9G 3QPLA 1Q86C 3QHSA 3M7GA 3BE3A 2ELKA 2Y0SN 2YRVA 2QF7A 4D9JA 4M77F 5EZGA 4RTXA 1Z7LA 1VQNT 5GAN8 3R0JA 4GYIA 3CCVI 1Z7UA 1HBXG 2V9KA 1ZN2A 3TO6A 2YU3A 4RUGA 2BV6A 3DB4A 4NB5A 3V42A 4CCLA 5LFAA 5M9OA 5IAYA 2M45A 2EJ9A 2JS2A 4AYBA 1M5Q1 1KHIA 5EEAA 1A6IA 1RC9A 1VQPQ 4HNVA 4XBFA 2X1EA 1NTCA 5M5YJ 1RUWA 1OQYA 3W2VA 3M0TA 4HKEA 2CP2A 5CYVA 2HU9A 4HOBA 1F43A 3PFYA 4QKUA 2E71A 2CJJA 4RAGA 1ETQA 1YITI 3I0TA 1Y1WJ 2D8JA 5ICCA 3VB2A 5CQEA 2E3HA 4G6QA 4BY6B 1XGNA 2JJ7A 3SDZA 4F7UB 1FSEA 5IT9R 2CP7A 3URGA 1RZ4A 1WCMJ 1W4SA 1TG0A 2LP0A 3B73A 5KCOA 3CMAT 1VQMI 3NQOA 1TNTA 2R7FA 3G7ZA 1FWZA 1WJ5A 2Y0MA 4G6TB 3CTAA 3T8RA 3OYIA 1QVGA 2H1KA 1XOVA 4D5FA 3ZMTA 1OPKA 2JN6A 1T39A 1K8AR 1K8AC 1DGWY 1WJBA 1YJNA 2XD0A 3H5AA 4XKVA 4EPCA 4NL3A 3PFSA 3PT9A 4Y17A 2R7XA 1K73C 4HW0A 3S1QJ 2HOSA 1VQOQ 2YU9J 1U1SA 1U1TA 1SEUA 4BBSJ 5TGTA 3JCMX 4JDSA 2DKGA 2PMHA 4LLNA 2DRMA 1YHQQ 2K9NA 4KIFA 1SVLA 1MBJA 2XV4S 3MKYB 1DGRM 1CKBA 4JJCA 1HK9A 2KQWA 5A2QR 1CF7B 1VIFA 4FX4A 3FEOA 3HGYA 1D8KA 1E6GA 2AT1B 2Y4YA 2ZPBB 2ISYA 1F1BB 2L3SA 1YJWI 3QIIA 1TT5B 4DOZA 5M5WJ 1WHLA 2MG4A 2LKSA 3DKXA 3JB9F 1R4NB 2QQAA 4EVIA 4E7LA 2GXAA 1WZ2A 1OPLA 2MBFA 1PP8F 4J8OA 1SD7A 2R92J 1QVFS 3IH2A 2FOWA 4DNCA 5EGOA 3UKGA 5LJ3d 1VQKA 4JOMA 1GBRA 1X43A 3LSHA 2CKKA 2DILA 1WXBA 2NXNB 4P1WA 1W1WE 2F4IA 3JB9I 5CK9A 2L5QA 3F6OA 2L54A 2IGMA 1JGSA 2E60A 3WGHA 3CCMT 5E3OA 5GANg 3CCUQ 1X2QA 1WDXA 3ROUA 3AL0B 4A3LJ 5M3FJ 4L9VA 3JRDA 1B72B 2DFUA 2CZ0B 4F3QA 1S7OA 3EETA 2DD5A 1XSXA 2IS1A 1JBMA 4FE4A 1NM7A 2DU9A 3JCMV 3HZJA 3OYCA 2V6EA 5BMZA 3C4SA 4C0GA 4PJ0C 2PMUA 4GO1A 4XL9A 1OULA 1Z3YA 4I02A 5C4JJ 1WPYA 2XAHA 3V8JA 3OYAA 3OSFA 3CQZJ 3ERED 3RSNA 3EG3A 4DA4A 3X25B 1GHCA 1OYIA 3CPFA 3FC3A 3OS1A 3LX7A 2Y48A 4C92A 1PUFB 3HL8A 1G3TA 1BOAA 2Y0SA 3ABUA 2JZYA 3HOZJ 1U9NA 2A7YA 1RI9A 1XQHA 5FLXZ 1UG0A 2X48A 1NK2P 4GDFA 2ECZA 3G6EA 1VQ9T 1BI1A 2X6WA 4XU1A 3AG1H 1X01A 4IRIA 1JRIA 4HVUA 2X6XA 3LQQA 1V5EA 2R7OA 2PI0A 5F08A 4OB3B 2V6CA 4PFOA 3TSZA 2RK2A 5DUKA 4JPBW 2HKOA 1WHUA 3QRFF 2RHYA 3EUAA 1ZGWA 3ZPLA 3V8KA 3GLXA 1MDMA 1XD7A 3OW2S 1AA7A 2JSPA 1T08B 2HQRA 3EG9A 5FKLA 2ZMEC 1VQLQ 2EV5A 2AS5F 2PMZN 5AYFA 2OTJA 3PUBA 3PNVA 3HXLA 1JT6A 4ZYHA 3WTUC 2MUNA 2EJFA 4Z02A 4CYCB 5IXBA 4QSHA 4EATA 5JHUA 2DETA 4JUVA 5GPCA 1WH7A 5FFXA 2EV0A 1USTA 1L3LA 3P9IA 2XAUA 5FU6B 4IUTA 1IRFA 1AVZC 2LTOA 1V4RA 2D1VA 2LCCA 1KQ9A 3QJ6A 1NJIR 1VQNQ 1R36A 4CC2A 2ZJ2A 3DLLF 1NJIC 2JT4A 2D0QB 4HF0A 4CH7A 2CZ7B 2M16A 3DBRB 2K4BA 5IP9J 4EMKC 3CD6A 2JA7J 3GCMA 3TO7A 3J80R 2KT0A 2EA2A 3CJTB 2GXGA 1WQ2A 3K7AJ 5L3EA 2SRCA 4IHSA 3M4YA 4KBMB 4BDYA 2PUKB 2PVOB 4NHJA 1ZGJA 4J6YA 2L9SA 1YQAA 2HXOA 5BPIA 4HSRA 5AT1B 3WODF 3VPRA 1W1FA 3FZVA 2V8IA 4M7AA 4KUDK 1MMGA 4YRVA 2DL8A 2F5DA 3WGIA 1C0WA 4FL6A 3TGNA 2YT6A 2P84A 3M53A 3PQJA 1Q81U 2ZFWA 2FMYA 2MFZA 2JRMA 5KAFC 1UB4A 2ZPHB 1ETYA 3RPUA 1FYKA 2J5PA 3M0PA 4HCCA 1EJ9A 4RGRA 4KGXB 2DT5A 2XC7A 3K6GA 4L5EA 4OMYA 3S1MJ 3DWLE 2D5VA 3CBOA 3QWLA 3SEZA 2WAQN 4JK1X 1P7JA 3M56A 1UFMA 4F7UE 2DA5A 5CCAA 1SRLA 2E6NA 2B63J 2JTMA 1J75A 4L9NA 4IX7A 3ZEHA 9ATCB 1W2BA 2E1NA 1YLFA 1MH3A 2CUBA 1ZBXA 2GFUA 4A54A 2QQSA 2LKPA 2HQEA 4JRPA 2BY3A 2L9NA 3HC7A 4IUPA 2PFBA 2QUFA 3OL3A 3S1RJ 4BJ6C 4ENJA 3ELKA 2DVJA 4XTUA 1YTYA 3BROA 2KDSA 3JB9J 3QU3A 4RM3A 4NC6A 2X35A 4M4ZA 1G2BA 4RS8A 2P81A 1CGPA 2RNGA 3CCEI 4A3MJ 4D0PA 2LX7A 5DTDA 4RM2A 1BJZA 1MJ9A 3SWNC 4I0BA 4Q4ZF 2KBTA 1VQPA 5A0GA 1QVTA 4UUSB 2KY9A 3UA7A 2ZFUA 3X26B 3WVEB 2JA5J 1K83J 1ZARA 2RQTA 4HVVA 3CJRB 5D8KB 4PSXA 3ZQIA 2DM1A 2X6YA 4M3BA 5TRDA 3OIOA 4ZTJA 2KYBA 1WHGA 2P0KA 2RN8A 2Y30A 3M0SA 3EGXA 2JPCA 2A0FB 3ONQA 1AU7A 3Q9SA 5IOZA 3CUQA 2DQRA 2P5KA 1ZELA 2BGCA 2LH9A 4XLHA 3MP1A 2JMCA 4CCMA 2AHQA 2XGXA 1LB2A 1SEMA 4C5GA 2FSWA 1GVJA 1BI0A 4E7SA 2G0EA 4WK8F 4XIDA 2HQHA 5LJ5f 2HDDA 3NTHA 4CCNA 4A5NA 3S3NA 2GFAA 3WHBA 3JTHA 1Z91A 1Z9CA 1OU8A 4EMGA 2F5CA 3BR5A 3WGGA 2DBMA 1OQKA 3TMOA 5J4VA 1GT0C 1KQ1A 4FT4A 5KYNA 2OCCH 5IT3A 1OISA 5IY5H 4UVCA 2HDAA 1QHGA 2DMPA 1TTYA 2DOEA 4E7ZA 3NTIA 4XTXA 5JFRA 3DQVC 1X3UA 4PZJA 1RUOA 3QQAA 2OI3A 1UZCA 2OC6A 4ZDPA 2J6OA 3F70A 2VJIA 3M9AA 5CVUA 1SMYF 4BI8B 1N9SA 1ZR2A 1T3SA 2PMZA 2MGQA 2VUMJ 3J81R 1WXTA 2RI5A 1UMQA 4FSSA 3Q0VA 3CCLA 2KHMA 1YG2A 2VXDA 4M75D 2R5YA 3DBLB 2PTKA 5ICGA 4LK0F 2DK8A 1HA8A 1NZ9A 1VUBA 5GAOm 1SD4A 3VEPA 4M72A 1VYVA 5D6YA 4XRSG 5GAOr 1K9MU 3E3VA 2M1BA 5FKNA 2AIRB 2A69F 1XS9A 1LEBA 1X2KA 1UUEA 2QASA 3K1MA 3EAEA 1D1BA 2DLPA 3EG2A 3CCVA 1Q82U 1J3TA 3H9JA 2HPMA 4JZ4A 1VQ9Q 4IRGA 2GIZA 1VQKI 3CDIA 3I56I 1SFUA 2FD5A 3FJ5A 3OBYA 5GMKi 3MAJA 3CJQB 1WHHA 3BG6A 2HVQA 2CSQA 1B9MA 1ZQ1A 4FM4B 3LA7A 2A6TA 3KIOA 1ERDA 3OYKA 1PHTA 5E17F 3LW5E 2VV5A 1IG7A 2R93J 3TSWA 4R1HA 5HS8A 1YITA 2A05A 3EDPA 4L0YB 3ECOA 2FRYA 3K2AA 3CCQI 2VKDA 2JUCA 3G4SI 2DXUA 2FA5A 3LL7A 1RL2A 4PLLA 4C92D 4FHTA 4RDUA 2XF7A 2EGAA 1VQMA 3CCRT 1Y39A 2EFNA 2I10A 1Q7YR 3I55T 2BHYA 1U2WA 2OZ6A 2P4WA 4Q47A 2LC2A 3RYPA 2NUTA 1Q7YC 2DERA 4N0BA 2DVEA 2YSRA 4A12A 2QSGX 4XTVA 4JJNK 5GANd 2NLUA 3DKYA 4I7HA 1IV6A 2OD5A 3WTXC 4IQJA 1OZ2A 2RA2A 3QDFA 4LNPA 2AKKA 5H20A 3S3OA 2HPIA 1WJSA 1D1AA 5CVIA 1U3OA 5FWCA 5LJ3j 4N4NB 4WXDA 3FX3A 4U7BA 5EDNA 4XMYA 5C3EJ 1AWCA 3ABTA 4EJUA 4M7AC 5JI6A 2XPUA 4C2TA 4GBQA 1KYWA 2NS0A 2VT2A 5J47A 5K7FA 3OYFA 2QBYB 3JCUC 2JM9A 4DEXA 3BJ6A 3F21A 2M5WA 4XOPA 3ER0A 3ZL7C 5F1RA 2C0OA 4RKUE 3VWBA 2RF0A 2GA1A 4YEJA 2DI3A 1QPIA 1X6GA 1YJWA 5CKDA 3ULQB 2WSFE 1AEYA 1T0FC 1IN6A 3QO3A 4Y52J 3JRIA 2CZ6B 2JT1A 4MNUA 1PRLC 5JLWA 2HTSA 4LOCA 3CCJI 3D5LA 2H3EB 1I5ZA 4RBOA 1LE8B 1DP3A
chains in the Genus database with same CATH topology
4Y13A 4HAMA 1HW2A 2XUBA 4HYEA 3CC4T 2JVVA 1OMIA 3CEYA 4BDZA 3IKVA 2OTLT 4MQVA 2BUDA 5D6EA 4M7AD 3F3XA 3ZQ7A 2CZ1B 2PUOB 4KT0E 3FMQA 1U5TA 5DLQE 2QTXA 1XMAA 4BAYA 2HFHA 4EMHA 3HPWA 1O3RA 2L4MA 2ZPIB 5CKFA 4LFUA 5CQYA 3F8BA 1Q82C 4L6V5 1W7PA 3DV8A 4IVNA 2O6GE