1FX7A

Crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords IRON-DEPENDENT REPRESSOR IDER
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1fx7A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1fx7A03
1O3TA 2YR2A 3WGGA 4ENMA 2IRFG 4E70A 1USTA 4UXNA 5KK1A 2ZMEB 2RDPA 4O3MA 3E97A 2L54A 3FX3A 3DP7A 3CLOA 5BOXA 2DFIA 5A2QK 1FBQA 1JHFA 1U5TB 3FXUA 4G9YA 4I09A 1B59A 2HR3A 1MJ9A 4A2UA 1YQAA 3ERED 3G73A 3KZYA 3MEXA 1KQ0A 1B6AA 5K5QA 3KLOA 4MQVA 3F22A 1OPCA 2H94A 5CJ9A 4HLYA 1U3EM 3F21A 1BIBA 4HQMA 5F64A 3KLNA 2P5LC 4LK1F 2CGPA 2PLYA 2DLLA 1HKQA 5HS9A 4R79A 3HSEA 1Z6RA 3RKYA 5CVJA 2DU9A 5HLGA 4Y15A 4KIFA 4A0XA 4EMSA 4OIOF 2HQNA 5DUIA 1YW9A 3ZMDA 3CUQC 5DYMA 1S8NA 3BJ6A 2D1HA 5FO5A 5F1RA 5K1YA 3KEQA 3GXOA 3GFLA 3F8NA 3ZN1A 1OKRA 4U7BA 1J0RA 4CYDA 4N9IA 2W24A 3LQQA 1SD5A 3TKYA 2VN2A 2QUFA 1H9TA 3DXJF 5DCFA 1Q1HA 1TTYA 2E7XA 3C18A 3CDHA 2F5EA 1TQPA 3L7WA 4NB5A 2EFOA 2EFPA 3GFMA 2ZBKA 1OR7A 3JTGA 1FSHA 2FBIA 1IXCA 2DAOA 5LLQA 5LRRA 1G4DA 2CSOA 4LK0F 4LD5A 5ED4A 4Q4ZF 3COAC 2O03A 2PBIA 1I5ZA 2QYOA 2QBYA 3L00A 2GWRA 4L9TA 2P8TA 1BYMA 2FE3A 1K6OA 3DF8A 3BWGA 5BMZA 4RB0A 2K5IA 4OIPF 1IUYA 2DT5A 3KEOA 3FMSA 1KYZA 2MA3A 2CFXA 2Q2EA 3WODF 1MJBA 1I27A 4IRGA 2VOOA 4I7HA 3LQRA 1BI0A 2DK5A 1XN7A 2RNJA 1J59A 2Z33A 2W84A 4BQAA 3ABTA 1K79A 3V8KA 3F8CA 2K27A 2XV4S 2IA2A 2XAHA 1SMTA 1PUEE 2K5LA 5EEHA 1G3WA 2P7VB 5BPDA 2XHKA 3D0SA 2ZNYA 5JR3A 1FC3A 4WF2A 5HDNA 2HS5A 2GIVA 4P55A 4RB2C 3LFKA 3JSOA 4WWCA 3I58A 3FM5A 3H3UA 2W25A 5ICGA 1TW2A 1R58A 4LJZF 3J7AO 2H09A 2HOEA 3NEUA 4LLLA 1PP8F 1U5TA 1WQ2A 2H6BA 3KP4A 5FFXA 3R6SA 1S6LA 4JK1X 5TJJA 1JXSA 1FP1D 1K7AA 4KDPA 4XLPF 3RTRA 1YYVA 4L9JA 2LF7A 2DPDA 1C0WA 2V6CA 1OYIA 3HTSB 4I0BA 4ENKA 2DPUA 1KGSA 3KP7A 1I6XA 2F2EA 5CVVA 4RGSA 3IKTA 5DCMA 2OD5A 3EQLF 4U0WA 2A6EF 2M30A 4G7ZF 3CUQA 2L4MA 2A07F 2GA2A 2NNYA 3EDPA 2M8EA 4U0VA 3RPUA 1LVAA 4Q5SF 2HYFA 2QWWA 3V4GA 1O7FA 3SXYA 5J8CA 1OMIA 2CQKA 3SZTA 4EM2A 2ZMEA 3GZ5A 1W7PA 3QPHA 4BH9A 2HZTA 1REPC 2X4HA 3G3ZA 3HIFA 1EV7A 4CICA 2EFNA 2LDUA 3K1MA 4ESJA 2UZKA 5IT9K 1IN7A 3B73A 5L3FA 2Z5UA 4YFKF 4UUVA 1QW1A 3K1PA 4AVPA 1ZH5A 1FNNA 2GAUA 2EFQA 4R8HA 1WKMA 3VFZA 3TQNA 3F6OA 2TDXA 3LWFA 2R7FA 3M8EA 4NQWA 5HLHA 1MDMA 1YO5C 3D5LA 1HBXG 5JHUA 4BNCA 4L18B 1YFHA 2EV6A 2EJRA 4EVIA 4XLNF 4ESBA 2IP2A 5LGTA 1KU9A 4BXUA 5HDKA 1BBYA 1BN5A 5L3DA 3BDDA 2OQRA 3KE2A 4M74A 4GO1A 1XGOA 3EYIA 5E8GA 1XGSA 2YPRA 5JVTA 2NAZA 6PAXA 2VC1A 1LEBA 3E5QA 1FSEA 3ZMSA 3PQKA 1G3TA 5FB2A 2LKPA 1XSXA 1RUNA 2GXBA 3JW4A 3BROA 4WXDA 2MBFA 1HW1A 4R1HA 3GEZA 1QNTA 1HW5A 3VB2A 4M9ZA 2NS0A 3E5UA 3RYRA 2Q0OA 1B9MA 3V8JA 3QAHA 2K4BA 4OOIA 3SZPA 1XDUA 4MQ9F 2AS5F 2HWVA 2XGXA 4YG2F 3KP6A 2CW0F 4UVAA 1SMYF 5TRDA 4P96A 1B4AA 4KNYA 4AD9A 1T38A 4LMYA 1NHAA 3HSFA 5H20A 4EQQA 2Z3YA 5CYVA 2DW4A 5E17F 1U6GA 5J6XA 2M5WA 1I1SA 1O3QA 1ODDA 2FA5A 1BI1A 2ZO4A 1HXDA 2FEZA 3GFIA 4N9HA 1I1GA 2DBBA 4M6XA 1IRFA 1WSUA 5A2QZ 1ZLKA 4EV0A 3KP5A 2EB7A 5DDGA 4KN7X 1V3FA 3RIRA 3K0LA 3KP3A 3P9CA 4FHTA 2QBYB 1FPQA 2Y48A 3S2WA 4HAMA 5ERIA 1GVJA 4S04A 1LDJA 3WTTC 2ZXJA 1ON1A 2VODA 1T98A 3MQ0A 2FXAA 4MNUA 5H6RA 4L5JA 4L0ZB 1R1UA 1DUXC 2MLKA 1GXPA 4AWXB 4ZYEA 2IW5A 3ML6A 3RYPA 2DI3A 3FXQA 3BZ6A 1R36A 2ESHA 3QU6A 4HV5A 1XCVA 4HZFA 2OU2A 4GGGA 2KKOA 1P4AA 5LEJA 1ZN2A 3I4PA 4OIQF 4XBFA 3BPXA 3L9FA 4EJWA 1S29A 4ASNA 3JAMZ 1ZREA 2RN7A 4G7HF 1MKMA 5D5XB 4MTEA 4ON0A 5EEGA 3HHGA 4KIGA 2D45A 3ZMZA 3TOBA 3IRQA 2EV0A 3K2ZA 2GXGA 3ELKA 3P9IA 2O0YA 5ILSA 3F72A 2ISYA 3WE2A 2FNAA 4AIHA 3F23A 4LLNA 3BJAA 2HGCA 1FX7A 1ONVA 2QQBA 5LHIA 4FX0A 2VT3A 2STWA 3O2PE 5D5VB 3U2RA 1W5SA 3KETA 4G6DA 1XSVA 2DO7A 3GLXA 1ZG5A 1ZYRF 1IRGA 2UXNA 3CUQB 3HSRA 3E5XA 2WV0A 1IAWA 2LNBA 1ZG1A 4O5VA 1HW2A 2GCXA 4IHTA 4P9UA 3M9AA 2CYYA 1KQ9A 3FXRA 1Y0UA 3I59B 5JFRA 1RUOA 1E17A 1MJAA 1ZRDA 1UCRA 1XMKA 2R3SA 1CGPA 2ADUA 2JPCA 3HRMA 2C6YA 3VEPA 4B8XA 1QGPA 2L01A 4UNOA 2F5CA 3H92A 3M1EA 2Z9OA 3SQNA 4EGYA 4LB6B 3H3ZA 3IL2A 4UHTA 5CLSA 4HDVA 2K02A 2HQRA 2PFBA 5IT9Z 1P6RA 4AIJA 4WXHA 4UV9A 3OV8A 2AXLA 3BY6A 3V8LA 4HQEA 4IVNA 1LB2A 2PMHA 3MZHA 1K78A 4CGZA 5K5RA 1MDMB 4YFXF 3T8TA 2DTRA 1SAXA 1L0OC 1UHWA 2MH9A 2M1BA 1RI7A 1LDKB 4PDKA 2P5KA 2IA0A 5JI6A 4KMUX 2O3FA 4I2OA 1USSA 5HDGA 1HSJA 2VOPA 3MFKA 1RIOH 1BM9A 2HKXA 4XRFA 3GZ6A 2JZYA 4PZJA 3DQVC 1MZBA 4ESFA 1DP7P 2PG4A 3E6DA 4Q47A 4PGGA 3LA2A 1ZHFA 1DDNA 2PEXA 2FMYA 3IWZA 2KIMA 2OA4A 3KZZA 4OIRF 1BIAA 4EM1A 1E2XA 1BI3A 1OYWA 1FT9A 3U9GA 1FBUA 2OAZA 3I5UA 1YTYA 1MD0A 2B0LA 4PCQA 4WK8F 3WTWC 1WRJA 1T39A 1D5VA 2RV8A 3O3KA 3V7SA 4YFNF 2K86A 3HRUA 4CO8A 2OZ6A 2RC4A 2ETHA 3NQOA 2K4YA 1P92A 3HUGA 1T0FA 5E1ZB 1CF7A 3F8FA 2VE8A 4GXOA 4K2EA 4RGUA 4BHCA 4CXFA 3KP2A 4QLCU 4BHPA 4I98B 3B02A 2KRFA 2XVCA 5J8FA 5E1XA 2K4JA 1W5TA 2XASA 3WU1B 2P6SA 3TO9A 3VODA 2QLZA 5FLXK 4XSXF 2OZUA 1F5TA 1YLFA 2MD5A 2MLGA 4WXCA 5LHHA 3E6CC 4HX4A 3DPTA 3MHXA 1P4XA 2BGCA 4ETSA 2RGVA 4HDUA 3CUOA 4KICA 1YW8A 3HRSA 2NYXA 2DK8A 2XKPA 5BS6A 2QQAA 2LX9A 1Z1DA 3ZPLA 2IJLA 5E18F 1HSTA 4P5OA 5IT3A 3JAMK 1GHCA 5ICFA 2A5YB 1STZA 3ULQB 4KT5C 4BAYA 2QENA 2ESNA 2VBYA 4MEYF 5HLIA 3TDZC 1W7PB 3LAPA 3PQJA 2UXXA 1UB9A 2H3JA 4A0ZA 3GO5A 4H0EA 1IN8A 4N0BA 2ZFWA 1EH7A 3W6KB 4L9VA 5ILUA 2VBXA 4RGRA 4U0YA 2K7LA 3R4KA 4WX9A 1BC7C 2NRAC 3QU3A 2YX7A 2J5OA 1QZYA 5D4RA 3J81Z 2HTJA 2IVMA 1K78B 1O57A 3RI4A 2A6HF 3CO7C 2KJBA 1IF1A 1FWZA 2W57A 2HEOA 1DPUA 5E1WA 1J75A 2E1CA 3ZMVA 3TO6A 4G7OF 2EV5A 4JQFA 3FWEA 1H9GA 2GA1A 5HVQC 3WTSC 3DKWA 4ZYDA 3REOA 4RAZA 1JGSA 1KA8A 4U7DA 4HA8A 4A5MA 1XGNA 3DV8A 2O8XA 3GF2A 3JTHA 4A6EA 1LQ1A 5HS7A 3KCCA 3HOSA 4M73A 4HF0A 1Z91A 1KU3A 5FFZA 3TO7A 1XB4A 3IRRA 3O6BB 4L9NA 5BPIA 4IRHA 3MCZA 1HKSA 2D2WA 1IN5A 2H6CA 5AIQA 2H27A 3ABUA 3ECHA 2M87A 2ZKZA 3T8RA 1FZPB 1R5HA 4GCVA 4M71A 1SFXA 2LF8A 2ZJ2A 5D5WB 3F3XA 2FF4A 5CVRA 3T0YA 3MAJA 1R23A 2Q8KA 2HTSA 2QZ8A 2V1DA 3R60A 4KA4A 3I0TA 2ACJA 2VBWA 1SD6A 3EETA 3Q9SA 3FMQA 2P5VA 1FP2A 4HW0A 2OBPA 1YS6A 3U1DA 3IHUA 1Z05A 2XUBA 2PJPA 1TLHB 2CG4A 5HS8A 4HF1A 1FYKA 2Y75A 2V79A 4FT8A 4RB3C 4M6YA 4O6JA 1G3YA 1S3JA 2PI0A 1W7PD 1LJ9A 4HLXA 4FX4A 2PQ8A 4D0PA 5L3EA 4ZH4F 5K5OA 1B1BA 1KQ8A 4XSZF 5LBQA 3IC7A 2KIFA 5FD6A 2VBZA 2YU3A 1ZLJA 2JRTA 1B9NA 1P4WA 4ZZLA 3K9TA 2BE5F 1TW3A 2ZNZA 2F5DA 1ZRCA 1KU2A 5D4SA 1EH6A 4KIBA 5ILVA 1WI9A 3AAFA 5CVUA 3Q5FA 1W4MA 2IA1A 3I64A 3DFGA 4MEXF 4WCGA 1IXSB 2WWYA 5D6EA 3QP6A 2XAQA 4G6QA 1U8RA 3R0AA 3E3VA 1XCBA 3ZQ7A 2YX4A 2BYVE 4IJAA 4HV6A 1UHMA 3I53A 2FQ3A 1IW7F 1YS7A 2VE9A 1D8KA 1SFEA 3ZMUA 1R00A 3GX4X 1R7JA 1XGMA 3Q9VA 2FBHA 4ENNA 2P7CB 2LSOA 4HOBA 1ZRFA 2MC3A 1BC8C 3WTUC 3RKXA 3BPVA 1RNLA 4P9FA 3ZMTA 1Z6TA 3J80K 3TOAA 3SHFA 2XROA 4LLGF 4G94A 1LEAA 3C1DA 3HHHA 1CF7B 1J5YA 3M8FA 3K69A 1O3SA 3IKVA 3RPQA 4RB1A 1J9IA 3E19A 1TQMA 1VTNC 1T2KA 1UFMA 4OU0A 4HF2A 4A0YA 1A04A 1F1ZA 2JTVA 2FBKA 5D5UB 1FLIA 2FU4A 2E7WA 1TBXA 4DNCA 4ENJA 1TNTA 1MGTA 4DQ2A 4Y17A 1QQIA 2QQ9A 4L0YB 2BBYA 1QVPA 1IZ1A 3LA7A 5L3BA 2QM3A 5LGNA 3WG9A 2CO5A 2XAFA 2FSWA 3HYIA 4EGZA 1O7LA 4OMYA 2W85A 5DEQA 1R1TA 4A5NA 1R1VA 5E8IA 1EH8A 2GZWA 3LA3A 3TDUC 2EFWA 3I54A 1IN6A 1IXRC 1F9NA 2JPBA 2KIUA 1XDSA 5BQTA 2PMUA 5L3GA 2K5FA 4ZYHA 1J7KA 5FLXZ 2O61A 1H0MA 3W6JB 2COMA 4BYYA 2IPQX 5DUKA 1FOKA 3RKWA 2CWEA 4L5IA 2WTEA 4LG0A 1G3SA 2WC2A 5ICCA 3N97A 2VXZA 1ZGJA 1JHHA 1R5GA 1Z7UA 5CVIA 1DPRA 2KJCA 3FZVA 4U88A 5KVRA 2V1UA 2P4WA 4EJTA 1U5TC 3JSPA 2L4AA 2XAJA 3WTVC 1GXQA 2ELHA 3C3WA 4I0AA 3J80Z 1KU7A 5DD4A 4NHJA 3LSTA 2QVOA 2PN6A 5E20A 4EM0B 2FNPA 5F6FA 3BOQA 3DPLC 3QP5A 3T1BA 3WGHA 3I59A 4TV7A 3V7CA 1FYLA 2DQRA 4MGRA 5FGMA 4I01A 4IF4A 5DCMB 3CTAA 3FHZA 3GVAA 1Z9CA 3M7GA 1YW7A 1ULYA 1TQIA 3IWFA 2UWMA 4M72A 3MZYA 3R61A 1HKTA 3C7JA 3P9KA 4PGHA 5LGUA 3WTXC 3HRTA 1KYWA 1P2FA 4CHUA 1SFUA 1ZG3A 1FY7A 3HTUA 3KFWX 1IN4A 3WE3A 2XAGA 2Z99A 2BV6A 2VT2A 4UVCA 4IRIA 1FYMA 4GYIA 3EYYA 4UV8A 2XRNA 4Q48A 2HFHA 3GUDA 3WU0A 4EJUA 3T5XA 1PDNC 1U2WA 4G8XA 4HYEA 3GWZA 3PFIA 2FOKA 1FBSA 2OQGA 5HOOA 3CJNA 4KN4X 5AONA 4CDGA 4RAYA 3R0JA 3WTYC 1T6SA 2P6TA 2XIGA 1D3YA 1L3LA 2F5FA 3F6VA 2M45A 1AOYA 2X0LA 2EA2A 3N4MA 2FRHA 4ZZDA 5LRSA 4KYWA 4IPAA 4LG0B 4EJVA 1BOAA 1QZZA 2EWNA 1U78A 1TNSA 3GFJA 2G7UA 3WTZA 4LFUA 2NNNA 4HBLA 3HOTA 1D8JA 1AWCA 1QBJA 3ZP5A 2A61A 1ZARA 5D6FA 4B09A 3I71A 2HDCA 3QRFF 4QWQA 1S7AA 1SD4A 2E1NA 4LGWA 4AIKA 2O6GE 4BHBA 3K1NA 2L02A 2ZCWA 4KUMA 5FD5A 2JSCA 3TGNA 5D8LB 3RJPA 2HKOA 3VOEA 1XD7A 2A69F 1LNWA 2BEOA 4M9SA 3FMRA 1S7OA 1ON2A 3OOPA 1YIOA 1X3UA 4GYGA 4Y13A 3FM3A 2XKOA 3QPTA 2V1XA 3P7NA 3J81K 2HYGD 4JBAA 2MH2A 1G6NA 4IHSA 3FF5A 4EJOA 4MTDA 4YIFA 1YG2A 3BP8A 5DV5A 3L2CA 3GW2A 3E6MA 1XSDA 4A12A 1SD7A 1QPMA 2L3DA 1R22A 3CO6C 4RS8A 4MHGA 4I02A 1ZAOA 2FMLA 2EK5A 1RZ4A 3BJOA 4CZZA 2G9WA 2A68F 1O3RA 5L3CA 5LEKA 5AIPA 2VC0A 4ZYGA 3ROUA 3ECOA 4F7ZA 2ISZA 4KFCA 4RGXA 2GQQA 2RKHA 3V7RA 3LAJA 4HX7A 3MWMA 3QOPA 3E6BA 3WGIA 5DD8A 1ZGAA 1QO0D 2JT1A 4YIIA 4OMZA 5D8KB 4IXAA 1LDDA 2IT0A 1F4KA 4HX8A 2R7DA 1HQCA 3SFZA 5LHGA 2V9VA 2D1VA 2J5PA 3DEUA 2A3SA 3ISPA 2VONA 3GYHX 2G7HA 4S05A 1PP7U 2DQLA 4KMFA 2YSRA 4A6DA 3F8MA 1WWXA 4LB5A 3EUHA 1OYYA 4UVBA 1J2XA 3F8BA 1XMAA 2RVCA 4Z2YA 1V4RA 5H6QA 3RDIA 3ZN0A 2EA4A 3NRVA 1JE8A 2Y0MA 1BI2A 3L09A 2RQPA 4M9XA 4OINF 2STTA 5ICEA 1BJAA
chains in the Genus database with same CATH superfamily
1O3TA 4ZN1A 3QWXX 1IDZA 2D0QB 2Q2EB 2XPWA 2R5MA 1GDTA 2YR2A 1UE9A 2VGNA 2YDLA 2VKDA 2ZPHB 5GAN8 3CCEA 3WGGA 4ENMA 1ETKA 2WB1N 4XKWA 2IRFG 4FYXB 4GBQA 4Y28E 1MSFC 1C6VX 4JUVA 4RTTA 1N9RA 3BR0A 5AT1B 1PM3A 2JXBA 4E70A 2LCSA 2DETA 5E3OA 1USTA 3DBHB 1LE8B 2L0KA 2EBPA 3PSFA 3P8DA 5CQGA 4UXNA 5KK1A 1RC9A 3H0DA 1HYOA 3VS0A 2X6OA 2ZMEB 2RDPA 4O3MA 1H8KA 4QPOA 2L2PA 2QTVA 3OBYA 3E97A 1Q7YU 2EYYA 4CCMA 2E34A 2L54A 2NVYJ 3QPSA 1PD1A 2L7MP 4D1QA 2EPFA 3OSGA 2P4TA 1I81A 1TSFA 2HKQB 3FX3A 1TWGJ 1MV3A 2D0NA 3DP7A 3CLOA 4AG2C 4HNVA 5BOXA 4IX7A 3ASOH 1W36D 2E5QA 2DFIA 5A2QK 1FBQA 1JHFA 1Z21A 5FW9A 2XK0A 1HD3A 1U5TB 3FXUA 4G9YA 4I09A 3FISA 4FIBA 3QYHB 3VS1A 1QU3A 2EGAA 3H5RA 3HKZA 4N4NB 1B59A 2HR3A 1MJ9A 1IC8A 2JS0A 3QO3A 3ONQA 1HJDA 3VS4A 1SVLA 5GP9A 2CV0A 1TL8A 4G12A 4XK8E 1X2NA 4A2UA 1YQAA 3ERED 3HZJA 3G73A 1X6OA 1N8RR 3K10A 3WHCA 3M4OJ 3MZ8A 3KZYA 4FTHA 1WQWA 2DXCA 3MEXA 1QCNA 1KQ0A 1B6AA 3OSVA 2KDSA 3CCQQ 2E2HJ 2RNAA 4DJAA 4C3IJ 5K5QA 2OTLT 2A3LA 2M0OA 5D6XA 4DBQA 2X35A 4C8QE 1OQKA 3KLOA 5CPRB 4MQVA 1M9SA 2CP5A 4HNUA 3F22A 5CK9A 4B48A 2EJGA 2V8KA 1OPCA 2H94A 5CJ9A 4HLYA 1U3EM 2JA8J 4BJTA 3F21A 3JCMV 1BIBA 1ZR4A 4ESRA 4HQMA 5F64A 3L1AA 1U9NA 3KLNA 2KQRA 1O4XA 4M3FA 2EIKH 2LP5A 2P5LC 3K6GA 4LK1F 4HKEA 2LVSA 5GAOn 1I8FA 2HZYA 2XSJC 4EEFG 2CGPA 4HG2A 2PLYA 2DLLA 3Q3SA 1HKQA 5HS9A 4R79A 2VB6A 3RPUD 3HSEA 5E79C 2M9UA 4X1VA 3HFOA 5AYFA 3GPLA 1U1TA 3CMET 1YX5A 1Z6RA 3HL2A 2DYIA 2VXEA 2H1KA 1LJOA 1M27C 3CCJQ 2O2OA 3RKYA 5CVJA 2HVSA 4IOCF 4A4GA 1LFUP 1RL2A 2AZVA 3F9KA 2K9GA 4IURA 4DOWA 2CW8A 2PUOB 2DU9A 4OWRB 5HLGA 2FVUA 4BY6B 3HSBA 4Y15A 4KIFA 4A0XA 4EMSA 4BY1J 4OIOF 2HQNA 1IHWA 3BDLA 3JB9D 3AL0B 2NS8A 2OI3A 3JSCA 5DUIA 2HOAA 1YW9A 3ZMDA 1XTDA 2LJ3A 4HVWA 4C0DC 3CUQC 2KT0A 5DYMA 5J1RA 5I11A 1S8NA 2EYQA 3BG9A 3BJ6A 3CCJA 5IT9E 4UB8C 1ZBJA 2O31A 1WPYA 2DL8A 2FD5A 3GTPJ 1HK9A 2D1HA 1X6BA 1M1KU 2NOGA 5FO5A 5F1RA 2LBFA 2DXBA 1MMAA 5K1YA 4M7AE 2Y30A 3KEQA 1TWCJ 3UNGC 1JKQC 3GXOA 2EQMA 2IGMA 5CR2A 3GFLA 3BQYA 4PFOA 2GLOA 3QKJA 3F8NA 3ZN1A 1OKRA 1Y96A 2LREA 3JRDA 3NTIA 4U7BA 1J0RA 3JB9G 4CYDA 3CMYA 3CCYA 4N9IA 2JUCA 3OIOA 2HL5C 3EFOB 2W24A 3LQQA 2EILH 4RTXA 2FO0A 1SD5A 2JN6A 3TKYA 3DTIA 2CP7A 4IIOA 1JTYA 2VN2A 5GAOm 2QUFA 4B44A 1Y56A 2YUNA 3G4SA 1H9TA 2KRMA 4IHWA 1VQOT 1PRMC 2ZPFB 3JCMc 3DBRB 2JA7J 1JTXA 3DXJF 2WBMA 1M3BA 1QVFS 3EG9A 1GFDA 3J81R 1DJ7B 5DCFA 5IY5H 1Q1HA 3PMTA 1TTYA 2ZSIB 2E7XA 1YHQT 3C18A 3CDHA 4RTYA 1RAEB 4BL0B 4BU2A 1N78A 3JCMW 3QPLA 2F5EA 3RZOJ 1OI1A 2ZPIB 2QEXA 1TQPA 3L7WA 4NB5A 5IYDJ 2BY3A 2EFOA 2EFPA 1ZQ3P 1VQLQ 1V5FA 4N4GA 4PJOF 5IHKA 1RKTA 3CCRQ 3GFMA 2RREA 2ZBKA 3M1CA 1OR7A 1UGSB 7AT1B 5C44J 3C2BA 2PUKB 3JTGA 3L1PA 1HOMA 4BB7A 4Y3OA 2GTOA 5EYRA 5KYUB 1AVZC 2R5AA 1WFWA 1FSHA 1VQ9I 2FBIA 1Y8RB 3BCAA 2AKKA 2LQNA 1ZGWA 1IXCA 2DAOA 2FJ1A 4FE4A 5LLQA 4C92B 4XTUA 2WACA 3N5BB 2KFDA 1RETA 5LRRA 1G4DA 2CSOA 4LK0F 3OQ5A 3VS6A 4LD5A 3H9NA 2NOJB 1WHHA 4UUSA 3DTKA 5ED4A 3ZQGA 4Q4ZF 2O03A 3COAC 1IV8A 4FCYA 2QSGX 2M8GX 2PBIA 1I5ZA 2QSFX 2QYOA 2QBYA 1I4K1 2KRSA 4A3GJ 3L00A 2K3BA 2ROLA 2NUTA 2GWRA 1Y1VJ 1OCCH 4L9TA 4LD6A 2P8TA 1VQPI 1BYMA 1NBEB 2FE3A 4M75C 1K6OA 3OIQA 3DF8A 1YE9A 3OS2A 4RTVA 4D8DA 1WZ2A 1WJQA 1Y0NA 2O9VA 3OSFA 1VQ8A 2R7WA 3BWGA 5BMZA 3QDRB 4RB0A 1GBQA 4XR6A 2EYZA 2K5IA 4LITA 2CQQA 4QIWN 3FDRA 4OIPF 1TH7A 3CD6A 3CPWA 1IUYA 1MH4A 1MUZA 3X24B 3CMEQ 5C0MA 1XC5A 4P1WA 1E7OA 1GXIE 2DT5A 2RJCA 4UUTA 2KDZA 3KEOA 3FMSA 1QMCA 3EFRA 1KYZA 2B7EA 2CFXA 2MA3A 2Q2EA 3BLYA 1MJBA 2HQAA 3WODF 3H0FA 1I27A 4IRGA 4RMNA 5EJCA 3PVQA 1YI2T 1Q81R 1AWOA 4Y91A 2BW3B 4RLQA 3AKZA 3HGGA 2KL4A 2QSHX 2VOOA 4EPCA 3VYGA 4I7HA 3LQRA 1BI0A 1RLPC 2DK5A 1XN7A 2OC6A 1Z0XA 2RNJA 1J59A 2Z33A 4IQJA 2W84A 1RI9A 2RM4A 2IXSA 4BQAA 3B6CA 3OYLA 2KIQA 1LFPA 4XM3A 3ABTA 1K79A 2X6XA 3V8KA 3GTQJ 3F8CA 1YBYA 4PLLA 2FZKB 5IH2A 1VQKT 2K27A 2XV4S 2IA2A 3QUIA 1M8VA 1GBRA 2XAHA 1SMTA 4B9WA 1PUEE 4DEYA 4F14A 1GUUA 2K5LA 3E0JB 5EEHA 3M59A 4E2FB 1WHMA 2KHMA 3JRZA 3G1LA 3OR1C 4I6ZA 2VQHA 1G3WA 2LTOA 2P7VB 1VYVA 4PJOD 3K4CA 3M8JA 5BPDA 2XHKA 1YRNA 1Z67A 1TUDA 4CI0C 3CCLT 1BKBA 1QP3A 2MI6A 3D0SA 2ZNYA 5JR3A 2ZJRF 1FC3A 1KD1C 4WF2A 5KNLA 2PTKA 4OMFB 5HDNA 2HS5A 2GIVA 2DMNA 4P55A 4BS9A 2R7SA 3DLAA 4RB2C 2RI5A 1SAUA 3QYFA 2LCCA 3CMAA 3LFKA 1B07A 3VPRA 4AU7A 5GAN5 1T95A 2ZXIA 3GNGA 5LFAA 1UFFA 2WB1A 3JSOA 1AKHA 4E7JA 2CGHA 4WWCA 3I58A 3FM5A 3H3UA 3HOUJ 3GBGA 5D6YA 1VQ5Q 2W25A 1M5Q1 3F0CA 5ICGA 1TW2A 1R58A 4LJZF 5IOZA 4QW2A 1K0SA 3J7AO 2H09A 4HNTA 2HOEA 2YHTA 3CCRT 2FZGB 4M6VA 2X9HA 3NEUA 4LLLA 1PP8F 3MEAA 3MJXA 1TWFJ 3BG3A 1U5TA 4PJNA 1X69A 1WQ2A 4XU1A 4OVAA 5IP9J 3ZQCA 3DEEA 5A2QR 1IGUA 1VQ5A 2H6BA 3KP4A 1XS9A 1PSFA 4C2TA 5FFXA 1H89C 2CV2A 3R6SA 4ZDLA 2FHDA 3OYHA 5EG0A 2FRWA 3ZFJA 1S6LA 2Z16A 4D5CA 5EEAA 4B9XA 4JK1X 4XORA 1T56A 1QVGA 3BY7A 2CP3A 5TJJA 3I9V2 1UMQA 4DYQA 3OW2S 2AHQA 5FROA 4BUGA 1JXSA 3CMAQ 1FP1D 1K7AA 4KDPA 4DBRA 1FIAA 3RTRA 4XLPF 1MV0B 2K2MA 4ZGEB 1YYVA 4L9JA 1T0FC 3QWLA 3VU3C 1ITYA 1WCMJ 2LF7A 2DPDA 5GAN3 3FB9A 1Q86R 1C0WA 4C8QD 2PMZA 2V6CA 4PJOB 2HOTA 1TXQA 2COZA 2DO3A 1OYIA 3HTSB 3DB3A 2VWFA 4I0BA 4ENKA 3M53A 3H8ZA 1TS9A 2DPUA 1KGSA 3KP7A 5E3NA 1JGGA 3MP1A 4GLMA 1I6XA 1WHLA 2F2EA 5CVVA 1YRNB 2GFUA 4RGSA 6AT1B 3IKTA 5A2QE 3KEYA 1T0JA 5A0DA 1LKXA 3EUHC 2OD5A 3EQLF 5DCMA 4BQNA 3S3NA 1FEXA 4J9EA 2MK5A 2RQUA 3DCFA 2OUMA 4U0WA 3KXTA 4RMOA 5HKCA 2A6EF 4M3GA 4IUTA 2M30A 3QZ9B 4G7ZF 2E6ZA 3CUQA 1NPPA 2L4MA 1X4PA 2A07F 2F69A 2HXIA 5DM6F 1SVOA 3FLGA 2GA2A 2NNYA 2Y90A 3GBQA 1VOMA 3EDPA 4GDFA 3CXCP 5GMKe 2M8EA 3PIPF 1K4TA 1WJCA 2A37A 2MMPA 4U0VA 3RPUA 2PNIA 4IUUA 5EC7A 3SFMA 4M7DA 1LVAA 4Q5SF 2HYFA 2CJJA 2QWWA 3H9GA 3V4GA 2R7ZJ 2P0QA 1D09B 1MSEC 1F36A 2EYXA 4A53A 4YEJA 1VQ5T 1O7FA 3H9JA 3PO3J 3DEWA 1EKEA 3SXYA 4F55A 3URGA 2CW7A 3K4KA 5J8CA 1ZSZB 2RK2A 3W2WA 4QVDA 4IO9F 3JRHA 2K79A 1OMIA 2YUQA 2CQKA 2HNHA 3J7AY 2IS6A 3SZTA 1D3BA 3GNFB 2ED1A 4EM2A 2HSPA 2V26A 5GADJ 3H5AA 4J00A 3TSZA 2ZMEA 3GZ5A 1W7PA 3QPHA 4ZGJB 4BH9A 3ZOBA 1OQYA 2E6NA 4A4KA 3CCMT 2HZTA 4LOCA 5GAN2 1REPC 1HDPA 3JCMf 3G2BA 3SFIA 4FE7A 3TU4K 1IHVA 2VJ5A 3OMGA 2DZ9A 1J09A 4M4ZA 2X4HA 4GLKA 5EZHA 4PUSA 4RBOA 3G3ZA 3HIFA 1BR4A 1EV7A 4H4KC 1W2BP 1CKBA 1VQNI 4A4HA 4KGVB 4CICA 5KYXA 2EFNA 2LDUA 3I3LA 1AOJA 3MEVA 3K1MA 4XRMA 3REBB 1YN8A 3HOVJ 1UUEA 4ESJA 2E41A 2UZKA 5IT9K 3N05A 4AUXA 1W36C 1LOJA 2XDDA 2EQJA 2IG0A 1V1CA 1IN7A 3B73A 5GJVB 1ETQA 3K4LA 3AG1H 5L3FA 2K9LA 2Z5UA 4YFKF 2X4XA 3KUFA 4XU2A 1R49A 3CC4T 4UUVA 4A3JJ 3GCMA 3K1PA 4AVPA 1KSWA 1QW1A 4EMKB 1U9OA 2F6CA 1FNNA 3K70C 2GAUA 3DTEA 1ZH5A 2KT8A 1AWWA 2EFQA 4R8HA 1QCOA 1WKMA 3VFZA 2XMFA 4IHVA 3TQNA 4QKUA 2DM1A 3F6OA 2TDXA 3LWFA 4MFEA 1KQSS 2RAEA 3ZQQA 5IOYA 2R7FA 3M8EA 4NQWA 1WVRA 4C92G 2DA9A 5HLHA 2JW4A 2WAEA 4DBFA 1MDMA 1VIEA 5GAMg 2Y9YA 3D5LA 1YO5C 1HBXG 5DLOA 5JHUA 5GMKm 3JCMg 4NUBA 3D7SB 1K0XA 4ZC3A 1Z77A 1VYUA 5C4XJ 3BG6A 4BNCA 4AFSC 3OYDA 4L18B 1YIJQ 1YFHA 2KMUA 2EV6A 4M7AD 2M1HA 2EJRA 4EVIA 3LMMA 4XLNF 4ESBA 2IP2A 5LGTA 3ZGKA 1KU9A 4XNFA 3VUBA 3CXCA 4BXUA 5HDKA 1VQLA 3FXMA 1BBYA 1BN5A 5L3DA 1WXUA 4HCBA 3BZCA 3BDDA 3UATA 4CZCA 2MUNA 2OQRA 5HLTA 3KE2A 4M74A 4GO1A 2JMAA 3C94A 3BR6A 1XGOA 2GQVA 3L2RA 3H0HA 3EYIA 1UB4A 5E8GA 2O01E 4M7AF 4IHYA 1XGSA 2YPRA 5JVTA 2NAZA 2ZJPF 6PAXA 1OX9A 3TP3A 1SHFA 2NUTB 3G71Q 1ETOA 1H641 1S9HA 1KQ1A 5KH6A 2VC1A 3OOUA 1LEBA 3E5QA 1FSEA 3WHBA 3ZMSA 2L0AA 3C12A 1VQMA 2V9KA 2K3FA 3PQKA 1G3TA 5FB2A 2LKPA 3BR3A 3HPGA 1XSXA 1RUNA 1Y7XA 3FJPA 4TVRA 1VQNQ 2JN0A 4BI3A 2GXBA 1WHUA 1VQOA 3JW4A 3FBNB 2L9NA 5EGOB 2F2XA 4PKCC 2DMUA 8ATCB 3G71A 2QA4A 3OMYA 3PUFA 3S2DJ 1JEGA 3BROA 4WXDA 4Z8AA 2MBFA 2BOLA 1HW1A 4R1HA 2XU8A 4U87A 5IHNA 4F7UG 3U1KA 2K9MA 3TCJA 2ZCFB 3UR3C 3BR1A 1V5GA 3GEZA 2HQEA 2XKOC 2X1EA 1QNTA 1HW5A 1VQOQ 4A4FA 3VB2A 4M9ZA 1RAAB 3PVLA 2ZMEC 2NS0A 3A52A 3E5UA 3RYRA 4CCNA 1VQ8Q 3H0IA 2Q0OA 1XMXA 3H36A 1B9MA 3CMMA 1RKWA 4IOAF 4MMLA 4M3EA 3H1CA 3V8JA 3QAHA 2R7VA 1YJ9I 1X1CA 2K4BA 4OOIA 1XDUA 2BVMA 4MQ9F 3SZPA 2AS5F 3S1QJ 2HWVA 2EFIA 2XGXA 1NE8A 5L23A 4YG2F 3KP6A 1RRJA 2CW0F 2XICA 4UVAA 4AT1B 1K73C 1SMYF 1WHKA 4J83A 4N4OB 1TOVA 3OYCA 5J4VA 1M1EB 1Y6IA 3DWLE 5TRDA 4P96A 4VUBA 3OYJA 2DOFA 3BG7A 5LD2C 2LMJA 1CQTA 5ECAA 1B4AA 2IS2A 1BU1A 5GANh 3HL8A 4KNYA 4AD9A 1XG1A 2CS3A 1BOBA 1T38A 4LMYA 1NHAA 3HSFA 5H20A 3M55A 3DLLA 4EQQA 2Z3YA 2MG4A 1Q82R 1UGRB 5CYVA 3IAS2 2HVQA 3G4ST 1ETXA 5I2MA 2DW4A 3K70D 3KYLA 5E17F 1YITT 5F04A 3BW1A 1U6GA 5J6XA 2M5WA 3JRGA 3UKGA 1I1SA 1Z9QA 3LL7A 1O3QA 3I9QA 2MF2A 3J7YJ 3PE0A 1ODDA 2FA5A 1BI1A 2ZO4A 1YJNI 1HXDA 2DTHA 2FEZA 2HVRA 2PVOB 4KT6A 3WG7H 2Y69H 3GFIA 4N9HA 2R7OA 1JKOC 4OAYA 1I1GA 2DBBA 3CP8A 2CUJA 4M6XA 3CCJI 2X98A 3I55A 4ZYAA 1IRFA 1YITI 4DOVA 3CCUT 3MMYB 2AQFA 1XOVA 1PKSA 2K57A 1ZUKA 2X51A 1WSUA 2EQUA 1ZSZC 3QJ6A 5GAMj 1E6HA 1OPKA 5A2QZ 3UDCA 1OISA 1ZLKA 2L2OA 2G3RA 4EV0A 2MOXA 4BQOA 2IS4A 1SEMA 2V4JC 3KP5A 4PJOA 3I55Q 2EB7A 4BE0A 5IXBA 5DDGA 4KN7X 1Q95G 3VSLA 5EZGA 1V3FA 2XB5A 3RIRA 2DOEA 2QGFB 3K0LA 1UJ8A 3KP3A 1A36A 3KFVA 5KYWB 3P9CA 3FC3A 1IO2A 4FHTA 2E1MB 2R7QA 2QBYB 2E1OA 1FPQA 2Y48A 2A08A 3S2WA 4HAMA 2CSQA 3AL0C 4JJCA 4PSXA 5ERIA 3W2VA 1N77A 2MWPA 4RM3A 3J80R 1GVJA 1BR2A 2DAQA 1A5JA 2HSEB 4S04A 1LDJA 1IGQA 2HU9A 3GZNB 2V1QA 3WTTC 1KC8U 2ZXJA 2MFZA 1ON1A 5GANj 4CA0A 2VODA 1YP5A 3CPWP 1T98A 1M2VB 1VNDA 3MQ0A 2PQWA 1WJAA 3FXKA 2MCNA 2JMWA 2FXAA 4A54A 3PFYA 4MNUA 4XRSA 2DL4A 5H6RA 2X3XD 3JCMe 2L3PA 3CC7Q 3AHUA 4L5JA 4L0ZB 2ZSHB 2EW3A 3AG2H 1Q1VA 1PKTA 2FG0A 2AQEA 1R1UA 2E35A 5GAEJ 4BI4A 1JUMA 2AKLA 3JAME 1DUXC 2QKMB 4XMYA 2P84A 1TZLA 2B9SA 3M4GA 1S72Q 2RD1A 2VLAA 2VKVA 3RERA 2MLKA 3A0BC 4E7IA 3BZKA 5GJWB 3H3VK 2MD0A 2BY1A 1GXPA 2M35A 4AWXB 4ZYEA 4C92C 3CC4Q 3D5SC 2IW5A 3ML6A 3RYPA 2DL7A 2DI3A 3OWTA 4QQGA 3FXQA 1PC0A 3BZ6A 2Z1DA 5F0CA 3MEUA 2DF6A 3OS0A 2ZZDA 2K40A 2DJZA 1R36A 2Y0SA 3ZQIA 4BACA 2ESHA 4EATA 3VS5A 3LSRA 2VXFA 3QU6A 1XX5A 4NS5A 3SJMA 4HV5A 2EJ9A 3GLLA 1XCVA 2VQCA 5LJ5d 4HZFA 1K4SA 1NG7A 3CC7I 3M57A 2OU2A 4GGGA 2LFBA 3M56A 4PJMA 2KKOA 2H8RA 2HYJA 2DTZA 3O8VA 1P4AA 1VQKI 2YLCA 5LEJA 1ZN2A 3LFUA 3I4PA 4C9YA 2DODA 4OIQF 3EGDB 4XBFA 3BPXA 2YRDA 3A98A 3L9FA 2DT7B 3CCRA 2EZHA 4EJWA 1K9AA 4ZTJA 3CJQB 2GF7A 3FKIJ 2HPIA 3PO2J 1S29A 2L8DA 1K4US 4ASNA 2EQRA 3JAMZ 3Q0WA 2DA5A 5HNHA 5CO7A 4QVCA 1ZREA 2ZFUA 3CEYA 1ZA2B 2P4RA 2RHXA 2ECCA 4X9DA 2KMTA 5DLQE 4Y92A 2RN7A 4G7HF 1MKMA 5D5XB 3CPFA 3T9NA 3X2QH 3DKXA 1JJ8C 1BA5A 2R4GA 2DMPA 2XAUA 2YS9A 4MTEA 4ON0A 5M5WJ 3QSUA 5EEGA 3HHGA 2CUDA 4KIGA 2D45A 2DA1A 2CZ6B 2F5TX 3ZMZA 2IPOB 1VF9A 2DCEA 2LLKA 1W4SA 2V9PA 1OU9A 1OV3A 3FHNA 3R6OA 4XTZA 2RF0A 3TOBA 1Q86C 1VQNT 1AT1B 3IRQA 2EV0A 1VZ0A 3K2ZA 4LDUA 2GXGA 3FXJA 4UY8I 2CP6A 2RQWA 3ELKA 2J6OA 2XI9A 3P9IA 2O0YA 5ILSA 2NWMA 1G59A 3F72A 2ISYA 4C0FA 3S32A 1WA7A 5A0LA 2A0FB 2GGRA 1ETYA 3WE2A 2FNAA 4AIHA 4RDUA 1CSKA 1RAGB 2E70A 1NZ9A 3F23A 4LLNA 1VYTA 3BJAA 2DD5A 4C92D 5GAMh 3J7AW 1S1NA 2HGCA 1X2MA 4IUVA 1FX7A 4HVUA 1ONVA 3H9QA 2QASA 2QQBA 5LHIA 4FX0A 2VT3A 2STWA 3O2PE 5D5VB 3U2RA 3HPHA 2GBYA 1ARKA 4C2UA 2M9HA 1W5SA 1A31A 1YNZA 5E3LA 1AZGB 4A3DJ 5GAOl 3KETA 1QVFA 4F3QA 4G6DA 5M3FJ 2F5KA 5EGOA 1XSVA 2RB6A 2DO7A 5LJ5g 4JX5A 3GLXA 1ZG5A 3HJEA 4E7HA 5J3BA 1ZYRF 2VPRA 1IRGA 3EFSA 2UXNA 1DU0A 5FLVA 1B3QA 4OMMA 1ORKA 2L89A 3CUQB 4LUEA 2HKNA 3HSRA 4AMCA 2KQWA 3E5XA 2O4XB 2G0EA 3I56Q 1M90U 3A8LB 3RSNA 2WV0A 1IAWA 1TP4A 2LNBA 1ZG1A 4O5VA 1HW2A 2EKHA 4IHTA 2GCXA 2BIVA 3F70A 4KRTA 3ER0A 4F93B 4P9UA 1QWFA 4CCOA 4KJZA 1K1ZA 2V7FA 1FTTA 2DL3A 2RMOA 1Q81C 2GNCA 5GPCA 3ZBDA 1KJWA 1ABQA 4IQ4A 5GMKi 1AZEA 3M9AA 3GTMJ 3S1MJ 3OYMA 2CYYA 1KQ9A 5TGTA 1YWPA 3FXRA 1IZ6A 1ZSZA 3KX2A 2DXUA 2J6KA 1VQ7I 1UJYA 4IZZA 1ZA1B 3NPFA 1Y0UA 1FMVA 3VYUB 3SWNC 2JWTA 4DOZA 1KONA 1FOXA 4PJOC 3I59B 5JFRA 5CKHA 1M1FA 1OULA 2VYTA 4M7DF 1AD5A 2OTLA 1RUOA 1E17A 3EG0A 3GTLJ 1MJAA 3K2AA 5IP7J 1OCRH 2BZTA 3JREA 1ZRDA 2DOAA 1G83A 1DGRM 2EH3A 4LIVA 2KISA 1DU6A 2QA4Q 3ABLH 3JR9A 1T3SA 1NLOC 1UCRA 4PFZA 1XMKA 2CUZA 1IREB 2R3SA 5J3LA 2IIMA 2PVGB 1CGPA 5LJ3f 1VQMT 2F4IA 4BBRJ 2E71A 2ADUA 2NYSA 2JPCA 3HRMA 2KLOA 2L9SA 4CCKA 2QEXT 2C6YA 1RABB 4M7AA 3VEPA 1LPQA 3A1YA 3CBOA 4B8XA 1GCPA 1QGPA 1R0CB 1X19A 2KY9A 3PJRA 1WXBA 4A4EA 4QQDA 5JVGF 2CUFA 2DFHA 1I5LA 3HUGB 1Y07A 2VC8A 4J9GA 2W1OA 2L01A 4UNOA 3MP8A 4A3BJ 4BE2A 4RTZA 1J3TA 3FBIB 2F5CA 1OCZH 3H92A 3M1EA 3O8GA 3ZQFA 2VUMJ 4KH0B 1VQMI 1Y1WJ 5KYYB 2Z9OA 3BQZA 1R77A 1WJBA 3SQNA 1FOYA 4EGYA 4LB6B 3OY9A 3H3ZA 1D3BB 2KXDA 1YI2Q 2HMAA 2JQ7A 2JUGA 3K4JA 2L9RA 2BY0A 1R4NB 1T33A 3IL2A 1SPKA 2KE9A 4MZMA 3L2UA 1EIFA 1K73R 2D8JA 1A0NB 1ETVA 4UHTA 5CLSA 1PYVA 2KRHA 1W6XA 4HDVA 2FPDA 3CBMA 4OF1A 1KFZA 1VQ7T 1PUFB 3JCMd 2K02A 4MO7A 2HQRA 4FYWB 1SVMA 3C2HA 1W2BA 3IP4B 3EH2A 4V2FA 3J7ZI 1NYGA 4MZTA 4K11A 1M2VA 4M77E 1K8AC 1MBGA 2PFBA 4BUPA 2LR8A 5IT9Z 3FK6A 2LY9A 4CCJA 2XIDA 5IXFA 1P6RA 4RA2A 4XLFA 4AIJA 2COYA 3BFMA 1OCTC 2ID6A 1QWEA 3RUXA 3U23A 5K7HA 1F1BB 4KULA 3FIWA 1YJ9T 1FMKA 2LT1A 2ESWA 2V1NA 4WXHA 4NDLA 2XGEA 2R0QC 1BW5A 1ZR2A 4UV9A 2R5YB 3OV8A 4ZDPA 2AXLA 5FKKA 3BY6A 4FT2A 4J9FA 4M78B 3V8LA 1S72T 2EAYA 1M1GA 4UC4A 4HQEA 2V1RA 3M0QA 1WJFA 2XC7A 1IJWC 2XF5A 4CC7A 2F1LA 4IVNA 4YTLA 4F04B 5GAN7 2MWOA 1LB2A 2PMHA 1BR1A 3CCST 2AHJB 2CQNA 3MZHA 1K78A 2E65A 4CGZA 5M3MJ 4CSWA 4LDWA 4BKXA 2K3PA 3VDXA 5K5RA 1MDMB 1X43A 3M4YA 4EDUA 4YFXF 2DLPA 5CAIA 3T8TA 1NJIR 4MIMA 3OYKA 2DTRA 2Y2ZA 1YIJT 1Z3XA 1SAXA 5KE3A 3JCMb 1L0OC 1UHWA 1KQSP 1WYXA 2MH9A 1K8AU 3E2UA 3I5RA 2M1BA 3UWNA 1RI7A 4XAXB 1KQ2A 3S17J 1LDKB 4ATOA 2JUFA 3RR6A 4PDKA 1WJSA 4C92A 2C0IA 4XN3A 5I21A 2TRTA 1O75A 3GTGJ 2P5KA 2IA0A 5JI6A 5TISC 1G2HA 4KMUX 2B8AA 4RCCA 2O3FA 4I2OA 2Y4YA 3A01B 3JRIA 1USSA 5HDGA 3L2ZA 4UB6C 1WJ5A 4GY5A 3MO8A 5HODA 1HSJA 2M0YA 2VOPA 3MFKA 3RCOA 3ASKA 1RIOH 3NMZC 4CC2A 1BM9A 2J06A 2AIRB 2DXIA 5FKMA 3SEQA 2HKXA 5M9OA 4XRFA 3GZ6A 4XKCA 3H35A 4LDYA 5J40A 3ZQLA 4C0DB 3IAM2 2P0TA 1UECA 5CQYA 1X2KA 2OTJI 3HPWA 5J1UA 2JZYA 4PZJA 2XHCA 1JI8A 3DQVC 4E7ZA 4CH7A 1MZBA 1DGWY 4ESFA 3GF5A 1DP7P 5IHIA 2ZJQF 4C5HA 2PG4A 3E6DA 4Q47A 3CF5F 4PGGA 3LA2A 1ZQ1A 1WH7A 1ZHFA 3JAMR 4QTRA 1QVGP 3OYBA 2QQRA 2ID3A 3EH1A 3MP6A 4M78A 3CF2A 4KH1B 4BD3A 1YIJA 3KPHA 3PUBA 3TSWA 3MKLA 1DDNA 3GIBA 4M7DC 2PEXA 2FMYA 4DBHA 3IWZA 2KIMA 2OA4A 3KZZA 4OIRF 2LG4A 1S5LC 3CCRI 5B66C 1YFNA 1HSQA 1K9MC 1I07A 1BIAA 4LIUA 4NL3A 4JX4A 4IEJA 5KHDA 3S3MA 2ZPGB 3QJYA 5GAOp 1P7JA 4EM1A 1E2XA 3MKZA 1BI3A 1OYWA 1FT9A 3U9GA 1RLQC 1FBUA 3EAEA 2LJ1A 2EZLA 3QG1A 2QEXI 3CQZJ 5HK0A 4QPQA 1Q82U 4CYCB 1W1WE 2M02A 2RA2A 2OAZA 4W97A 2V6EA 2DA4A 5GANe 2W48A 2QEXQ 1WQ7A 2LQWA 3G1JA 4HRIA 3I5UA 3M3YJ 2VQGA 4OMNA 3ASNH 1YTYA 1U3OA 4NBQA 1X1DA 1FOWA 2M34A 2M4GA 1I50J 2KBTA 5J39A 1VQMQ 3JB9H 1MD0A 2B0LA 2MZ4A 1VQ4I 4PCQA 3MKDA 3HOYJ 4WK8F 4FSSA 2K9QA 4XTVA 5LL6S 1OJLA 4C30A 2VQLA 3WTWC 1S7EA 3A01A 3CCLI 1Z9ZA 2Y9ZA 1IB8A 1WRJA 3NHNA 3CCMI 1XJWB 1RR7A 1T39A 4AC0A 1D5VA 2RV8A 2JA5J 1X27A 3NAUA 4DYCA 1LNXA 3ULRB 1I3QJ 2DEQA 3O3KA 4XN0A 3V7SA 2KR3A 3OIPA 3E9FA 4EMGA 1YJ9Q 1Q82C 1VQ5I 4YFNF 4JX6A 3HRUA 2K86A 4CO8A 2QF7A 2OZ6A 2RC4A 2ETHA 3NQOA 2K4YA 4HSTA 4CRIA 3ZR8X 4F7UB 2RHYA 2LCLA 1RACB 1P92A 1QPIA 1NEBA 2L7FP 1H88C 1EA3A 2A05A 3FXLA 3HG9A 3TMOA 4BDZA 3DPUA 3HUGA 1YCSB 2KDOA 4C5EA 5GAN6 3CCJT 1T0FA 3JRAA 4OB0B 5E1ZB 4Z88A 1YJ9A 4Z6YA 1VQKQ 1CF7A 1RR8C 3F8FA 1FYNA 2GM4A 4JLIA 3VKIA 3ZEHA 1POGA 2VE8A 1E6GA 4AG1C 4GXOA 4IL6C 3HP9A 4K2EA 1FIPA 4RGUA 3WVEB 1MNEA 4BHCA 2R7TA 4C8QG 2VGMA 3FJ5A 1X3ZB 1C0MA 1WHJA 5J4YA 4CXFA 3KP2A 3FEOA 4QLCU 2FPFA 3G4SI 1EX4A 2VKEA 3M0UA 1Q7YR 3HOZJ 4BHPA 1KC8R 2BZYA 4I98B 4J01A 2EIMH 2KGTA 2DVJA 2YT6A 1VQKA 3RESA 2CSIA 2VVKA 3B02A 2KRFA 2XVCA 5J8FA 1KG1A 3OYNA 2BKDN 5E1XA 1T3LA 2JA6J 2K4JA 1W5TA 4J19A 2XDPA 2XPVA 2XASA 1YWOA 3EFOA 1BK2A 3G6EA 3WU1B 2P6SA 4RLFA 1B72B 3TO9A 1YCYA 2G6FX 3VODA 2QLZA 5FLXK 4XSXF 2OZUA 4CYCA 1JJ6C 2RN8A 4P5NA 4M77D 1E3PA 3WU2C 1F5TA 5GAMd 1B34A 2V8JA 1YLFA 1QVTA 3EG9B 4DEXA 4R55A 2MD5A 2MLGA 3JCMQ 2ECZA 4WXCA 5LHHA 1HCRA 3E6CC 2DBMA 4HX4A 1C1AA 3DPTA 4XU0A 4X34A 1Q81U 1VQ6A 3EGUA 2DD4A 2KT1A 2DMQA 3MHXA 2C06A 1P4XA 2R5YA 2BGCA 4ETSA 2RGVA 4HDUA 1X6GA 5LJ5j 3CUOA 2EGEA 1QP2A 4KICA 1YW8A 2DJNA 1TWBA 5FKLA 3EG2A 5KYNA 3HRSA 2NYXA 2BTTA 1MBEA 4I76A 2FL7A 2DK8A 3CESA 3CCLQ 1GL5A 1UZCA 3BG5A 5M5XJ 2CH4A 5BS6A 3HDDA 1OYXA 2K2VA 4R56A 1ZELA 5GAMe 1VQ6Q 2GQIA 4WCIA 2R7RA 5IYBJ 2HOSA 2QQAA 2YUSA 2LX9A 3PM1A 1Z1DA 2L3SA 4M7DB 2MVTA 1KD1U 2IGKA 2P81A 2DA7A 3ZPLA 2CU7A 4Y52J 2LX7A 4MZPA 4C92F 2JSPA 1OEBA 1K9MU 2IJLA 5E18F 3TL4X 2J6FA 2MABA 1UG2A 5B5EC 3I4MJ 2LZ6B 1HSTA 1W0TA 4P5OA 1JBMA 2DBKA 5IT3A 3JAMK 1KK7A 1Y57A 1GHCA 2E5ZA 5ICFA 2OX7A 4RAGA 2A5YB 1STZA 3ULQB 4RAFA 5J1YA 4KT5C 3CMAI 4BAYA 2QENA 2FEIA 3QWYA 4OGEA 3ZL7C 2I10A 2QAZA 3VYHB 3GMEA 1JJ2S 2ESNA 2RK1A 3ABMH 3EHRA 1VQ4T 2VBYA 4MEYF 5HLIA 5LJ3e 3LLRA 3TDZC 1MBJA 4C92E 1W7PB 2DTIA 3LAPA 3OYFA 2RH2A 5D6WA 3PQJA 2UXXA 1UB9A 2H3JA 4A0ZA 3VYRB 2EZKA 2AK5A 3GO5A 5KAFC 1MNDA 4NNJA 5HNFA 1SRLA 4H0EA 1IN8A 4N0BA 2ZFWA 1EH7A 2OCCH 3W6KB 1BCMA 1WNLA 4HXJA 4L9VA 3JCMX 3BR5A 2CS7A 2NXNB 5ILUA 2R7UA 1S72A 1H3HA 2VBXA 4RGRA 1JXOA 3JB9I 2F4MB 3QOEA 4U0YA 3EHQA 2K7LA 2VIXA 1B34B 4N0AC 3CCVQ 3K4BA 3IH2A 3R4KA 3VSKA 4WX9A 1BC7C 1TG0A 2NRAC 3OYAA 5LJ5h 2ROTA 3QU3A 4C5GA 3I4NJ 2CH4W 1EFNA 1QCFA 2YX7A 3RMSA 1VIFA 2J5OA 2JT4A 1QZYA 5D4RA 1TWAJ 4BY7J 1UDLA 2IS1A 4IUQA 3J81Z 2KI7A 3CC4I 2X4YA 2HTJA 3REAB 2QXFA 3CCVA 2IVMA 3INZA 1K78B 1O57A 4NOYA 2X9DA 2YXYA 4M7DD 1H92A 3RI4A 3OYYA 4AFZC 5FLXE 3TEDA 2A6HF 3AG4H 4OAZA 4JYKA 3CO7C 2KJBA 2L9VA 1IF1A 2RQVA 3S15J 3KZIC 1FWZA 2W57A 2O9LA 3CCVT 2HEOA 4DGWB 2LNVA 2HBPA 3QZ5B 3AFHA 2E2JJ 3E9GA 5CKTA 1DPUA 1NM7A 5E1WA 1WIEA 3HFNA 1J75A 1VQ7Q 3HOXJ 1IG7A 3LGLA 4J5YA 2L3QA 2E1CA 3ZMVA 1NJIC 2DT6A 2JTEA 2W4SA 5KAIC 2NVUB 3TO6A 4G7OF 5B3SH 2EV5A 4B3AA 2CREA 4JQFA 2F2WA 4LXCA 3FWEA 4E6KG 2LQKA 1H9GA 1NK3P 1DQUA 2GA1A 5HVQC 2O5RA 2X85A 3WTSC 1UG1A 1OR7C 1SANA 4A3KJ 3DKWA 2VXDA 4ZYDA 3L2WA 3C2GA 2R5ZB 2LKXA 2PVDB 1X3WB 3RMQA 2K9NA 3REOA 2RHIA 1AKHB 1VQ8T 4MDXA 2PMZN 2OTJQ 4M78E 1KD1R 1GCQA 4RAZA 1WJEA 1UHSA 2XD0A 1JGSA 1KA8A 1AHJB 1VQ9A 2W7NA 3TW7A 4U7DA 1QLYA 4HA8A 2EZIA 1XGNA 4A5MA 3A1PA 4JS5A 2BUDA 3DV8A 3P8BB 5IN1A 3HHTB 4BJ6C 2HBWA 5A0GA 2O8XA 1BB9A 1PRLC 1MNMC 3GF2A 3JTHA 1EF4A 4XTWA 4FL6A 4A6EA 2JK3A 3VYSB 1LQ1A 4JDSA 3HKZN 5HS7A 3LSMA 4HT9A 1VQ9Q 3KCCA 3HOSA 3CCSQ 4E7SA 4A3LJ 4M73A 3X25B 1YJNT 2WSEE 1B8IA 2UV1A 4HF0A 5GMKl 4A69C 1Z91A 1QA6A 4PJLA 3G71T 1KU3A 5FFZA 3TO7A 4L5GA 4XU3A 4HSRA 3QHSA 2O88A 1XB4A 4XTYA 2RHZA 1PJRA 4RM2A 3IRRA 3O6BB 4L9NA 5BPIA 3G7ZA 4IRHA 3MCZA 1HKSA 2D2WA 1PUFA 4J9CA 3JB9F 1IN5A 3A0HC 2EGCA 2H6CA 2FZCB 5AIQA 2NUZA 2H27A 5CQXA 1MMDA 3CCUQ 1B72A 1D0ZA 3ABUA 4M75D 3CDLA 2QGGA 2X4WA 3ECHA 2M87A 2ZKZA 3T8RA 3CJRB 1FZPB 1R5HA 5M5YJ 3CC7T 1VUBA 3V42A 5E3MA 4GCVA 4M71A 3PTAA 2WADA 4NL2A 2DFUA 1WX6A 1SFXA 1JJ2A 2LMDA 2LF8A 3I56A 4HCKA 2ZJ2A 2OPTA 3CC2I 5D5WB 4F91B 5CKDA 3CCUA 2I5UA 2FF4A 3F3XA 5CVRA 3SYTA 3ME9A 3T0YA 1H3ZA 2X1CA 3MAJA 1UEBA 1K73U 4MFDA 1R23A 1JUSA 2E1HA 2QCOA 3LSJA 4PJ0C 2Q8KA 2HTSA 2EQKA 2ZPBB 1KZHA 2QQ8A 2QZ8A 2V1DA 1TTHB 2R5ZA 3R60A 3Q0VA 2I2LA 2YLBA 4J6YA 2WAQA 4KA4A 3I0TA 4B4CA 2ACJA 2VBWA 4F92B 1SD6A 1PSEA 3EETA 1N75A 3Q9SA 5CQEA 3FMQA 2P5VA 4F7UA 2VASA 3DB4A 1FP2A 2DYRH 2K6DA 4HW0A 2D5VA 4M78F 1IO6A 4EMHA 1TWHJ 2OBPA 1YS6A 2M0CA 3U1DA 3LSKA 3K7AJ 1HF0A 2E5NA 1XQHA 3VJPA 1QHGA 3IHUA 1Z05A 3DU5A 3HKSA 4X1EA 3QODA 5EDNA 3LGFA 2XUBA 4II2A 4C3JJ 1D1AA 1TLHB 2PJPA 2CG4A 5HS8A 4HF1A 3DU6A 3E1SA 3JRBA 1SFOJ 1FYKA 1NTCA 1Z7LA 2MC4A 4DW6A 1NG6A 2DL5A 1VQOI 2Y75A 2XG8D 3CZ6A 2V79A 1Y39A 1U06A 1GVDA 2XF7A 1A6IA 4ANJA 2M51A 4FT8A 4RB3C 4M6YA 3OYGA 5BNGA 2EIFA 1QKWA 2F2VA 2YSQA 3META 3VS3A 3C95A 4O6JA 2NVXJ 2EJFA 3LOCA 1NJIU 1Z3YA 1G3YA 5JHFA 1S3JA 1E3HA 2PI0A 4KUDK 4LD9K 1BW6A 1W7PD 3PNVA 3SDBA 2VUBA 1NG2A 1LJ9A 4C0GA 3H41A 4HLXA 4FX4A 1OCPA 2PQ8A 4D0PA 5L3EA 2E60A 3JRFA 1D1BA 3HGYA 2OTLI 2GTJA 4BQQA 4DZPA 3CC2A 4ZH4F 4BEHA 2B63J 2X48A 5K5OA 1QKXA 3VRZA 1B1BA 2DA6A 4KT0E 1KQ8A 5B1AH 3S6WA 1AA7A 4BBSJ 4XSZF 1UAAA 5LBQA 3IC7A 2KIFA 3OA6A 2DTOA 1W5CC 1RESA 2MW8A 3JCMh 4EMKA 5FD6A 3PMIA 5FLMJ 2VBZA 2ABLA 1WGXA 4LUDA 2ZPEB 3CDIA 4L59A 3IQLA 2HL3A 2YU3A 4N4HA 2OJED 2CT3A 1MBKA 2JVVA 3FKJA 1YI2I 3CXCS 3G6EQ 4IHXA 4LDVA 1FMWA 4Q5WA 3S1RJ 2FX0A 3M07A 2R93J 1ZLJA 2JRTA 1B9NA 1P4WA 2P0WA 4ZZLA 1UHFA 3EGXB 3K9TA 3H6ZA 2BE5F 4JZ3A 1VQ4Q 1TW3A 1D1CA 3LSGA 2DFFA 2K85A 3RBBB 3J7AF 2KEAA 4JJDA 2ZNZA 2F5DA 2PU9B 2DRKA 4RCBA 1R5ID 1ZRCA 1FTZA 1KU2A 2CZ0B 5D4SA 1EH6A 4KIBA 1VQPT 5ILVA 1WI9A 3AAFA 4OMPA 4BXXJ 3D5RC 4XOTA 4EIKA 5CVUA 1JKPC 4JRPA 3Q5FA 1W4MA 2IA1A 2LK2A 3BT9A 4W1UA 1X75C 3I64A 1RAHB 4FSXA 4JRKA 4OB1B 3EUKL 3DFGA 1YJNA 1VQ6T 4MEXF 3S14J 2DFEA 3ABKH 5FKOA 4WCGA 1IXSB 2IAIA 2WWYA 4AM3A 5D6EA 2CV1A 1R9TJ 1OU8A 2RJFA 5GANf 2QTXA 3W6VA 4DYRA 1IRZA 3WVDB 3QP6A 2HQHA 4J9BA 3Q0UA 5HY6A 2XAQA 4G6QA 3ERMA 1A6QA 2K9SA 1UHCA 3G1MA 4C3HJ 1U8RA 4L6V5 4D5FA 3R0AA 3OBWA 3G4SQ 1YJNQ 3G6ET 4MDWA 4ZGDB 3E3VA 1XCBA 1MBHA 2I0NA 1VQ9T 3VYTB 3ZCOA 3ZQ7A 4ZDOA 2JTMA 3QYEA 3NTKA 2YX4A 2BYVE 4IJAA 4B43A 1N9SA 4RG2A 3FXOA 4HV6A 2O9SA 1UHMA 1JQQA 3I53A 2L7ZA 1WXTA 2LD5A 3C4SA 4PL6A 1WDXA 5I22A 2FQ3A 2XRLA 4C0ZA 1IW7F 4J9IA 2MAMA 1SF9A 1YS7A 2X3WD 2VE9A 1K9MR 4BJ5C 1D8KA 1SFEA 2DIQA 2A5WA 5KCOA 3ZMUA 5IPAA 1R00A 3GX4X 3S3OA 4E6RA 1R7JA 1XGMA 3W3CA 1CKAA 1U0JA 2QKLB 3VS7A 3Q9VA 1PCXA 2JS2A 2FBHA 5CCAA 4ZJZA 4ENNA 2LSOA 2P7CB 4YRVA 3OYEA 5LJ5e 4HOBA 1ZRFA 5FWBA 4C2MJ 2MC3A 3JCMJ 1BC8C 1PWTA 2IGOA 3CLQA 5K7FA 3WTUC 5H2FC 2JM9A 3RKXA 4A3CJ 2E36A 4FISA 3BPVA 4PJOE 1RNLA 4P9FA 2JVHA 3HM5A 4DIQA 2P0KA 3ZMTA 1Z6TA 3J80K 3CCQT 3TOAA 1U5SA 2M4KA 5JLWA 4OB2B 3SHFA 2CZ1B 2XROA 2E12A 4V2SA 4LLGF 2GBQA 1YITA 2WV1A 4G94A 3CC4A 1LEAA 1FJLA 3C1DA 3HHHA 1CF7B 3LSPA 4CUGA 1N5ZA 2QG9B 3UA7A 4NC6A 2L7KA 1TU0B 1U8BA 3CCMQ 1J5YA 1B7TA 1JB0E 3M8FA 3PFSA 2SRCA 4HT8A 1GFCA 3K69A 1O3SA 1YJWT 4F7UF 3G6EI 2ZXHA 4FW2A 2ZAEA 3IKVA 3Q1JA 4YELA 1V5EA 3RPQA 3VWBA 1N6AA 1YITQ 2HDAA 4RB1A 3WXMB 1VQ7A 3SD4A 1J9IA 2F4OB 3E19A 2LBFB 1TQMA 2CUEA 1VTNC 1K76A 4S0HB 2KNBB 1JRIA 2F5VA 1T2KA 3NTHA 2OCEA 1MHNA 1UFMA 4A3MJ 1X1AA 4OU0A 4A0YA 1A04A 4HF2A 3CCUI 3GTOJ 3LH0A 1XTAA 4HCZA 3NWSA 3B6AA 1F1ZA 2JTVA 3NWTA 4ABZA 1EZZB 1I5OB 2OJ2A 2VJIA 2FBKA 5D5UB 2QI2A 5CKEA 3S2HJ 2W82A 2H1LA 3BTIA 3SHWA 1M3CA 3C0CA 1FLIA 2JM8A 3BTCA 2V8IA 3A8GB 4XLAA 5FRNA 2FU4A 2E7WA 5KYWA 4LE9A 2FQ4A 1OOTA 1TBXA 2KZVA 2DJQA 4YIRX 5DM7F 2M16A 4RG8A 3MD2A 1ZLMA 1RPWA 4DNCA 3R6NA 3THKA 4ENJA 5LJ3j 2ECBA 4XKVA 4M77A 8AT1B 4OGCA 2IEKA 4BI8B 2OAUA 5F1JA 1SRMA 1W2BS 2QA4T 3O8HA 1TNTA 2O7OA 1MGTA 2EBIA 1MW7A 4DQ2A 1WPKA 4Y17A 4B3XA 1QQIA 2QQ9A 4L0YB 5FWCA 2BBYA 1QVPA 3HB9A 5GAOr 1IZ1A 4X6AJ 1NYFA 4FYYB 3TQ7P 3HOWJ 2MIOA 3P8HA 4OMQA 3M0RA 4V19K 1VA7A 1PD0A 2NVTJ 2EYWA 1EJ9A 3LWIA 1I6HJ 2DYSH 3KBGA 2JA2A 2LVMA 1SHGA 3TEEA 2NVQJ 3LA7A 2LNHB 2FUG2 5L3BA 1WFXA 1NLPC 2QM3A 2LC4A 5LGNA 3WG9A 2E1MC 4HPQA 4KISA 1OZ3A 5KYUA 2CO5A 2EQIA 2XAFA 2FSWA 3HYIA 2D8HA 2HDWA 3HC7A 4M75E 4EGZA 3GP8A 2HAXA 2Y0SN 1E0EA 3O5ZA 1V29B 3S16J 3LW5E 1VFCA 2MPXC 3DKYA 1AWXA 1O7LA 2X1DA 4MMKA 2JTFA 4GFBA 4OMYA 2W85A 5DEQA 4F17A 1R1TA 2DXTA 2DJIA 4D7NA 2K3YA 4A5NA 3I35A 2LRDA 4HEA2 2RJEA 4FT4A 1R1VA 5LJ3h 1MGQA 1RAIB 3OSSC 2RQTA 1K83J 5E8IA 1EH8A 1X1BA 2D6FA 2VL8A 5DS9A 2ZC2A 4XLEA 1IRXA 2GZWA 3CCEQ 3CCEI 3PIOF 4OB3B 3EG1A 4BDYA 1N27A 2PZ1A 3LA3A 5FU6B 5HCKA 1UTIA 1RUWA 3TDUC 3CMAT 2Y31A 1JJ2P 4A3EJ 2CRGA 2EFWA 1U1SA 4LNPA 5FU6C 2IGNA 3I54A 2LOOA 1IN6A 1IXRC 1ETWA 1QVUA 2M3AA 4A3IJ 1F9NA 2BHYA 4PLIA 4BXFA 2LY1A 2JPBA 1WLPB 3CCLA 2DMOA 3I5SA 3CCET 1KQSA 3CJTB 1N8RC 1OPLA 2KIUA 4C8QA 1LCKA 5LJ5f 3CPWS 5K7ZA 2KROA 4AFQC 2M7BA 4JZ4A 3MN2A 3PIPA 1XDSA 1MMGA 2W00A 5GAGJ 5BQTA 4PJOG 1R4MB 2LY2A 2PMUA 1MIJA 1RI0A 1SKUB 5L3GA 4IUPA 5GTHC 1GV5A 4B1RA 1SSHA 2UUZA 2K5FA 4ZYHA 1J7KA 1TT0A 5FLXZ 5F0HA 3CP2A 3TREA 2A6TA 2O61A 3SWNB 3X20B 1H0MA 1MH3A 4ZTFA 1M8MA 3ESWB 3W6JB 2COWA 2VKNA 2QYZA 5DTDA 2COMA 2DMTA 1SEUA 4ELYC 3RZDJ 3KIOA 4BYYA 4DA4A 2IPQX 2KZGA 1IV6A 5FU7C 2LJ0A 4FETA 3HXLA 3IV5A 3M9QA 5GANg 4XKBA 5DUKA 1FOKA 3RKWA 1I0CA 2YRCA 4J6XA 4J7IA 2ELKA 4JP0A 2CWEA 2JZ2A 3LNQA 3I55I 4L5IA 3LH5A 2WTEA 2CP0A 2DEUA 3U21A 4LG0A 1G3SA 3BTJA 2WC2A 2ZB9A 2LDMA 4NC8A 1T08B 5ICCA 2FOWA 2LQ8A 1YHQI 5IT9R 2KYBA 3CBPA 2FB7A 3N97A 3GTKJ 2VXZA 2HDDA 1ZGJA 1JHHA 2CT4A 3I56T 2L5QA 2QGUA 2QA4I 4I99C 4BGDA 2YU9J 4KGZB 1R5GA 1WI7A 4E7KA 2M2EA 3JV3A 1LPLA 1ZUYA 1Z7UA 5CVIA 1D5YA 1IXDA 2ENMA 1Y71A 4J7FA 2YUPA 1DPRA 3VUZA 1ERDA 2KP6A 2KYMA 3RNJA 2DA2A 2KJCA 2MYSA 3ZQHA 1QVFP 2Z2SB 2NS7A 1JKRC 4CC4B 3FZVA 3MVPA 1T8IA 1VQLI 4U88A 1TC3C 2WSCE 5KVRA 3S1NJ 5J47A 2HQXA 1UELB 4QSHA 2JJ7A 3LX7A 1YI2A 2W0ZA 2BZXA 2V1UA 2ED0A 2W10A 1VQ4A 2P4WA 1PHTA 4EJTA 1U5TC 4FASD 3JSPA 4M75B 2L4AA 4ZNXA 2HQ5A 3A8OB 1FXXA 2LRQA 2XAJA 3PL8A 3WTVC 5GANd 2STTA 4F16A 2XDVA 2O4XA 1B8IB 1GXQA 1OCOH 1M1KC 3EG3A 2JJ9A 2ELHA 3C3WA 3RKQA 2KXCA 3OMCA 2BVLA 2CKKA 5EG0B 3RDVA 4C8QF 4I0AA 3J80Z 1KU7A 2XDBA 4JJBA 5DD4A 4XRSG 4NHJA 2TCTA 1KHCA 4PJJA 3LSTA 2CZ7B 1UG0A 4IIMA 2QVOA 2PN6A 1BL0A 1ZHIA 2CDTA 1D0XA 5E20A 2R92J 4EM0B 2FNPA 2LH9A 5F6FA 4C8QB 4V2GA 2A28A 3BOQA 1TUCA 3QDFA 2ME6A 4J9HA 1R8OB 3EUAA 2HXOA 4M7DE 1X2QA 2VV5A 2GIZA 3OR2C 3DPLC 3QP5A 3T1BA 3WGHA 1ZUUA 2FRYA 2RPNA 3QYGB 1OFCX 4C8QC 5EG2A 1YHQA 4QVZA 2DDBA 1X01A 3I59A 5CIUA 4TV7A 2DNUA 2EKOA 3V7CA 3PNTA 4AIDA 1R6RA 3H0GJ 2DQRA 2K5CA 2LKSA 1FYLA 1G2BA 4MGRA 3J81E 3OW2A 1Q86U 2CMPA 5FGMA 2DYBA 2RHUA 3H5NA 2RNGA 1AHDP 1JT0A 2ZXWH 4JJNK 2CQ7A 4Z02A 1M90C 4I01A 3I56I 1BBZA 2FYKA 1QZEA 4XIDA 2RO0A 3QQAA 4IF4A 5DCMB 4M77F 1YHQQ 3CTAA 2LTPA 3FHZA 1WJDA 3GVAA 1Z9CA 1YJWI 3M7GA 1YW7A 2D1XA 4M7AB 4WTOB 2YRVA 1N25A 4BEHB 1RAFB 1ULYA 3CCSA 4N4IA 4CCLA 1ZX6A 2DVEA 2E3IA 2R7XA 5LJ3d 1TQIA 3IWFA 2A7YA 2UWMA 4ELZC 1UGVA 1HC8A 4M72A 4J9DA 3SDGA 1Y0MA 3MZYA 3R61A 4IKFA 4M75A 1HKTA 4AYBN 1VI0A 2E64A 4XLHA 3C7JA 4B6MA 5FKNA 3P9KA 4PGHA 5LGUA 2RI2A 3JB9J 3WTXC 1NH3A 1M30A 3HRTA 1VQNA 1KYWA 1P2FA 3K4NA 2Z0WA 4CHUA 2JRMA 5LJ3g 1P7IA 2B86A 2M7AA 2KK4A 1SFUA 1ZG3A 1FY7A 2QDLA 5L8RE 3QYBA 1NEGA 2DILA 3HTUA 3BCBA 4M7DG 5EF6A 2JNGA 3KFWX 1IN4A 3WE3A 2XAGA 4XOPA 2Z99A 2BV6A 2VT2A 4UVCA 4IRIA 5DY9A 4BE1A 2HCKA 3P5JA 2CFOA 1K6YA 3SB2A 1W70A 1FYMA 4QQ6A 2RI3A 1HA8A 3OYIA 4GYIA 3EYYA 4UV8A 2XRNA 2GFAA 4Q48A 1Y8QB 1GV2A 2HFHA 1H8AC 3CCQA 2XGDA 3GUDA 3WU0A 2AZSA 2NUPB 3DLLF 1AEYA 1APLC 4ME7A 4GRIA 4EJUA 2LP0A 4HVVA 4XQFA 1TUGB 3T5XA 4M77C 3VV0A 1PDNC 2J05A 2LT4A 1U2WA 4G8XA 2XF6A 1WH5A 1I1JA 4FYVB 4DZJA 3QIIA 3M0TA 2MSYA 5C4JJ 4HYEA 2BXZA 3GWZA 3PFIA 1IGNA 4M77B 4RUGA 2C0TA 5DM7R 2QK0A 2FOKA 1FBSA 2OQGA 5HOOA 1GCQC 3BC8A 3S8PA 2HZDA 4E4HA 3W2AA 3CJNA 4FW1A 4KN4X 5AONA 5B1BH 4CDGA 3A8MB 4E47A 3JCUC 1KC8C 4RAYA 3M58A 4X9CA 3EGXA 3R0JA 2GXAA 3WTYC 1WI3A 1T6SA 1ZBXA 2AT1B 3A02A 4B47A 1S72I 1PNJA 2P6TA 2XIGA 2CH0A 3PIOA 3CMEA 1D3YA 3SDZA 1L3LA 5F27A 2KRCA 2GOMA 4NQWB 1LE8A 2HD0A 1SSFA 3F6VA 1JT6A 2F5FA 2M45A 1AOYA 1V76A 2M0MA 1MBFA 2X0LA 1QQJA 4ZN3A 1R71A 5IAYA 2C0OA 3LSIA 2O8KA 1XNIA 2EA2A 2JOYA 3N4MA 4CC3A 2MGQA 2FRHA 3LSHA 3AT1B 4ZZDA 4XICA 2E5KA 5GAMf 3GOXA 3SZGA 3CMEI 5LRSA 4KYWA 1WHGA 4IPAA 1LVKA 3OW2P 4LG0B 2D9TA 1K61A 3MKYB 3CCVI 2JVGA 4M78C 2HI3A 4D9JA 4Z89A 2JMCA 4EJVA 4D7MA 1T0HA 1BOAA 2DX1A 1QZZA 2COBA 2DDAA 2EWNA 4JOMA 2CYZB 3FIFA 3CC2Q 1LFBA 4LN2A 2GOXB 5J26A 1U78A 3NFCA 1ENHA 2BXYA 3IH4A 4UUSB 1M4ZA 1WZOA 3EGDA 1X58A 1IUFA 1TNSA 3A8HB 1R0BG 2BE7D 5CKBA 1OX8A 2VJJA 3GFJA 2G7UA 2A36A 3WTZA 2XGCA 4LFUA 4X0GA 2NNNA 4HBLA 3HOTA 1D8JA 3HEFA 2VPLA 2EVRA 1KIKA 1AWCA 1KHIA 1YX3A 1SG5A 2OV7A 1QBJA 3L42A 4BY6C 3ZP5A 3VS2A 2A61A 3SWNA 3LYIA 1UGQB 4II3A 2BY2A 2BE9B 2R57A 4LDXA 1ZARA 2WAFA 1SFKA 5D6FA 4B09A 3QXEB 3M54A 4JLGA 4XTXA 3I71A 2CP2A 1WJRA 2EPDA 2HNIA 3OS5A 5GMKj 2HDCA 3QRFF 9ANTA 2YUOA 4JRQA 1S7AA 1SD4A 2E1NA 4LGWA 2Q1ZB 4QWQA 3ZXSA 4AIKA 2O6GE 1DP3A 3KYDB 2ZGWA 1VQLT 4BHBA 3K1NA 9ATCB 3IH3A 2L02A 2ZCWA 3NARA 4M7AG 5IP6A 3FDYA 4KUMA 5IYCJ 3A4CA 3X28B 5FLXR 4L5EA 1Q7YC 5FD5A 5JLXA 1WGSA 4KUIA 2JSCA 4EMKC 3TGNA 2EIJH 2DE0X 1YJWQ 2RQQA 3HTRA 5D8LB 3OL4A 4XL9A 3RJPA 3A5ZB 4FU6A 4E7LA 2VKHA 2HKOA 3BDUA 3VOEA 4JPBW 4QT7A 1XD7A 4PFPA 5KYYA 1GLNA 2A69F 1I3AA 1LNWA 2BEOA 4M9SA 4MLOA 3DBLB 3RQ4A 1MMSA 3MCAB 3FMRA 2F48A 3UF4A 1S7OA 2CQXA 3ZRGA 1ON2A 3OOPA 4Y7NJ 1YIOA 1X3UA 4GYGA 4Y13A 2PX9A 2P0PA 3FM3A 2LYCA 3CC2T 2XKOA 3QPTA 2V1XA 2RJDA 4J8OA 4KBMB 2KVQG 1YJWA 1LUJB 3P7NA 3J81K 5FJ8J 2KAFA 1V55H 5KCMA 3X26B 3M0SA 2X6YA 5HK3A 5C3EJ 2WA0A 2PJRB 2K3XA 2ME0A 2HYGD 2VJ4A 3PGGA 1W0UA 2AXTC 4JBAA 2MH2A 2DA3A 1G6NA 4IHSA 2ATCB 3FF5A 4EJOA 4AVZA 2YWWA 4N0AA 2KSSA 3UPUA 2OF7A 1GRIA 2E3HA 4J6WA 3CQTA 3E7LA 1BJZA 4MTDA 3J80E 4YIFA 5C6SA 1YG2A 3BP8A 5DV5A 3DKMA 3L2CA 2HPMA 3QBYA 1M3AA 2WY8Q 5KCHA 3GW2A 5FRMA 3E6MA 5I2SA 2KRNA 1I39A 2IVWA 3FK7A 1ZTRA 3OS1A 1HLVA 1BCOA 1K8AR 2BHZA 1OZ2A 4D8KA 1XSDA 2VI6A 4A12A 4C5IA 1TT5B 1SD7A 4F7UE 4NC7A 1AWJA 4M3DA 1NK2P 2LC2A 2DRMA 1QPMA 3A03A 4KGXB 3SEMA 2L3DA 3TVTA 1R22A 3CO6C 4RS8A 4MHGA 5FU7B 2I8DA 4M78D 5CKFA 2ELJA 3BR2A 4I02A 2QDYB 4RTWA 1OLTA 3PNYA 4XLCA 1AU7A 1UGPB 3CD6T 3HBLA 3A2KA 1VQ8I 2HEQA 1ZAOA 2FMLA 1E3OC 5GPAA 2EK5A 4FQGA 3GTJJ 2DKGA 4OMLA 4XONA 3MPUB 1RZ4A 3G71I 1X1PA 1ABOA 4XQ3A 4Y4RA 3BJOA 2E2IJ 4CZZA 2OTJA 3CC7A 2N8GA 2G9WA 4JRIA 4RKUE 4FM4B 1Y96B 2A68F 1O3RA 2DK3A 3PNWC 1M1KR 5L3CA 4HCCA 2IBDA 4G6TB 4F52A 1SC7A 5LEKA 1ZK8A 5AIPA 2VC0A 4ZYGA 1ZSGA 3ROUA 3CCMA 3S93A 2X4JA 4M78G 4M77G 4PK4A 3ECOA 4F7ZA 1F43A 2ISZA 4KFCA 4RGXA 3AG3H 2DIGA 3BE3A 4Y33A 2GQQA 1VQPQ 3L2VA 1YIJI 1QRYA 3TBIA 2H3EB 2RKHA 3V7RA 2BZ8A 5GAN4 3LAJA 4LG3A 1G5VA 1GT0C 4HX7A 3LWHA 2PJRA 3MWMA 3QOPA 4PNOA 1JUPA 3PSIA 4A93J 1IDYA 3E6BA 5D7UA 2CUBA 3K4MA 1JU5C 2RQRA 1P9QC 3EPZA 3CCSI 2R58A 3WGIA 5DD8A 2EINH 1NPRA 2E4HA 1A35A 1ZGAA 1QO0D 2JT1A 4YIIA 1RADB 4OMZA 2OAWA 3DLMA 5D8KB 2XSDC 3PT9A 1VQPA 4IXAA 1LDDA 2IT0A 3NGPA 1F4KA 2KPMA 3MKWB 4M75G 4OP0A 3CD6Q 4HX8A 2AO9A 2R7DA 3JRCA 1YOVB 1HQCA 1HDDC 1W1FA 4ITVA 1M90R 3SFZA 5LHGA 4II1A 2K7AA 3TP0A 5GMKh 4KITB 1D0YA 1ACIA 2V9VA 5GAHJ 2L3RA 3OL3A 2D1VA 2J5PA 3DEUA 1QHHD 2A3SA 1VQ6I 1RQ6A 2X6WA 5F08A 3ISPA 3IUOA 3GYHX 2VONA 2DN0A 2G7HA 4S05A 3G1OA 1PP7U 2WSFE 2Y4XA 4OMOA 1V54H 3RQIA 2DQLA 2DZCA 3UT1A 2DERA 4KMFA 2YSRA 2NLUA 2NUPA 1N8RU 2WY7Q 4A6DA 3CCQI 3F8MA 4M7AC 4PSWA 1WWXA 4M75F 4LB5A 2QQSA 3OB9A 4ORZA 3UA6A 3M5AA 1XPXA 1O9SA 1UJ0A 2DPPB 4A63B 3EUHA 1OYYA 4R0KA 4JS4A 1M2OA 3BTLA 4UVBA 2ICWG 1J2XA 3F8BA 3JCMP 2OTJT 1XMAA 1JO8A 2RVCA 2J7IA 3MEWA 2H8HA 1G8XA 1X4OA 3VRYA 3SEZA 4Z2YA 4AYBA 5GAOq 4XK4A 3CD6I 1V4RA 2XPUA 3KYCB 1ZKGA 4A3FJ 2BW3A 2FPEA 5F0FA 5H6QA 3TW6A 1ACMB 3RDIA 3ZN0A 3M0PA 1MMNA 2EA4A 3I55T 4RTUA 3D1NI 4D6WA 2OTLQ 3NRVA 4AFUC 1JE8A 5GTIC 1QVGS 3FRNA 2Y0MA 4M3BA 1BI2A 2WAQN 2H8WA 3L09A 1JXMA 2SEMA 5KE2A 5KYXB 2E10A 2RQPA 4M9XA 4OINF 1PVEA 2E19A 3L2QA 1PG5B 2XKPA 5ICEA 2XB0X 1BJAA
chains in the Genus database with same CATH topology
1O3TA 4ZN1A 2D0QB 2R5MA 2ZPHB 3CCEA 2YR2A 5GAN8 2VGNA 4M7DE 3WGGA 4ENMA 2IRFG 4Y28E 4JUVA 1N9RA 4E70A 1USTA 3P8DA 4UXNA 5KK1A 2ZMEB 2RDPA 4O3MA 3OBYA 1Q7YU 3E97A 2L54A 2P4TA 1I81A 3FX3A 3DP7A 3CLOA 5BOXA 2E5QA 2DFIA 5A2QK 1FBQA 1JHFA 1U5TB 3FXUA 4G9YA 4I09A