1FX7A

Crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords IRON-DEPENDENT REPRESSOR IDER
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1fx7A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1fx7A03
4BNCA 2RV8A 3ISPA 5D8LB 3WGIA 1GXQA 3KP5A 4KIGA 3F8FA 4CYDA 3FXRA 4HAMA 1ZH5A 1R36A 4WCGA 1XD7A 2VC0A 1ZARA 3GEZA 1ZG5A 2QQ9A 4BXUA 3TOBA 1ODDA 1O3TA 3ECOA 2AXLA 3BPXA 4XRFA 2FXAA 3D5LA 4GCVA 2W85A 1Z9CA 1F9NA 2LF7A 4OIPF 2DFIA 2WTEA 3F6OA 3CDHA 4N9HA 3ELKA 2Q8KA 2VBXA 1ZREA 2FA5A 5AIQA 1Z7UA 3G3ZA 2ELHA 2LKPA 5CYVA 1PP7U 3RYRA 3LWFA 1SD5A 3LFKA 2BEOA 1HW5A 4HOBA 4YFXF 2Z3YA 5DCMA 1DUXC 3LSTA 1REPC 2E1CA 3BJ6A 1BI2A 4M6XA 4Z2YA 3JSPA 4L0ZB 4HV5A 3DXJF 1YG2A 6PAXA 2Y75A 1YW7A 1SD6A 3ZMTA 2H6CA 4LFUA 1QBJA 5E18F 4RB1A 2K4BA 2IA1A 1P2FA 1KQ9A 1ZN2A 2QZ8A 2VE9A 4L5IA 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 4G7OF 2XVCA 3IL2A 4YG2F 4WK8F 5LRRA 1E2XA 3GZ5A 2A07F 4XBFA 3HOSA 4G94A 1R1UA 1XB4A 1YQAA 3ZMDA 4IHSA 4EMSA 1S7OA 1IN4A 1G6NA 2JSCA 2FEZA 1O7FA 3U9GA 3EETA 1OMIA 2EV0A 3GWZA 4BHCA 3PQJA 3FMSA 4U0YA 5AONA 3DKWA 3EQLF 2V79A 3L00A 2CQKA 3CUQC 2F2EA 1PP8F 2W25A 3E6BA 4XLPF 1BC8C 2XUBA 2FMLA 3HUGA 2GXGA 4IXAA 1BJAA 3MAJA 1IXCA 1TNSA 1XCVA 3RKWA 2DQRA 1T98A 4KFCA 1J59A 3TGNA 4P9FA 3MZHA 2CO5A 3SZPA 4LD5A 2W24A 4I09A 3M1EA 1NHAA 5LLQA 2PQ8A 1BM9A 3HRTA 5HOOA 1OYYA 3NEUA 3QP6A 3DP7A 1U3EM 2K7LA 1GXPA 5H6RA 4HLXA 2XAJA 4AD9A 4CGZA 1G4DA 2Y0MA 1BN5A 2HWVA 4CO8A 4S04A 4RS8A 2PMUA 1FNNA 1IN8A 3T1BA 5LEKA 2VT3A 1F4KA 3HRUA 3V8KA 3TQNA 3HHHA 1B59A 4GYGA 5L3CA 3GFJA 2YR2A 3BY6A 1J0RA 3MFKA 2COMA 4UUVA 2D1HA 4HX7A 1TQIA 4ZYHA 4CZZA 1B9NA 1HQCA 4EV0A 2M30A 4OIQF 2P7VB 5FD6A 3K2ZA 3R0AA 1JHHA 3M8FA 2NYXA 4P55A 3QPHA 5CLSA 4LK1F 2ISZA 1IXRC 2GIVA 1ONVA 4G8XA 4ZH4F 2IPQX 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 5LBQA 5D4SA 2P6SA 4KUMA 1B6AA 2E7WA 5K5QA 3I0TA 2DPUA 3WTWC 4MEXF 3KE2A 4KA4A 4I02A 4KIFA 3MQ0A 4YIFA 5BPIA 1O3SA 4UVAA 3CJNA 4MTDA 2NAZA 2P5KA 4OMYA 4ZYDA 3IRQA 3E5QA 4PZJA 4L5JA 3I53A 2DAOA 4Q5SF 3QPTA 2M5WA 2FOKA 1O3QA 5LEJA 4E70A 4Y13A 1ZAOA 2XASA 1K79A 2NS0A 1SMYF 4FT8A 1B1BA 5BMZA 4NQWA 2HZTA 2HOEA 2RVCA 1BI0A 2P5LC 3I5UA 4ASNA 4LG0A 4ESJA 1VTNC 4HDVA 2GCXA 3REOA 4MGRA 3WTTC 4U7BA 1Z6TA 3NRVA 3TO6A 1XN7A 1MDMA 5D6EA 3M7GA 3QP5A 1U5TC 1FSHA 1W5TA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 4EGYA 4LB5A 1J5YA 3JW4A 2JRTA 4UNOA 2KIFA 1BOAA 3WU1B 3RYPA 4HW0A 4OOIA 3TO9A 1ZLJA 1JXSA 5FFXA 2K02A 2MH2A 1IXSB 1UFMA 3I59B 5EEHA 3K1NA 3P7NA 4TV7A 4N9IA 5ILUA 2G7UA 1D3YA 4KT5C 2P4WA 1HSJA 1SFXA 3GXOA 2DO7A 2FBIA 3F6VA 4KMUX 3ZMVA 3I64A 3WE2A 5F64A 2CG4A 4L9TA 3ZMSA 4U88A 4UV8A 3Q9SA 4L9JA 1X3UA 5D5XB 2TDXA 1J2XA 5DD4A 1OYWA 1FLIA 1LDDA 1QW1A 2HTJA 1FY7A 1HW2A 1FBUA 4N0BA 1DPRA 3ROUA 4Q48A 4ETSA 1USSA 3T0YA 1MZBA 3G73A 1MGTA 5IT9Z 3MHXA 3ZP5A 1C0WA 3C18A 1R7JA 2LNBA 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 4G7HF 2HS5A 4HBLA 4MNUA 2CYYA 1P6RA 1RZ4A 3R4KA 1QO0D 1CF7A 2L02A 2UWMA 3E19A 1CF7B 3CO7C 4AWXB 3BDDA 2CW0F 3JSOA 1LVAA 3F72A 4EM1A 2HR3A 1P4WA 3GFIA 4EJUA 2ZMEB 1TLHB 1KU7A 2E7XA 2QWWA 4G9YA 4I2OA 2IW5A 2O03A 2PMHA 3LQRA 4AIKA 1KU9A 4GGGA 1TQMA 1B4AA 3GZ6A 3Q5FA 3RIRA 2R7FA 3MZYA 5FFZA 1YYVA 2JPCA 4LLNA 1YIOA 1UB9A 3KP4A 2V1DA 1I27A 1RIOH 2A3SA 1G3SA 2O6GE 3TO7A 5E1WA 2HEOA 5FD5A 2L4MA 3Q9VA 3IC7A 3AAFA 5L3BA 2OA4A 1J9IA 3RJPA 3FM5A 2ZCWA 3GYHX 5DCFA 5KVRA 3O3KA 2JTVA 4P9UA 2HQRA 2G7HA 4PGGA 4UHTA 2H94A 4EQQA 3QOPA 2A68F 3OOPA 1ON1A 2Q2EA 3I71A 3WTZA 4LGWA 1L3LA 2K5FA 5L3FA 3KEQA 2ZFWA 3V4GA 2LX9A 1IUYA 1EH6A 4PDKA 3SHFA 1H9GA 3VFZA 1UHWA 3VB2A 4M72A 5HVQC 1R1VA 2XROA 4KNYA 4A2UA 3ZMUA 4JBAA 4RAYA 3H3UA 3HSEA 1LQ1A 2L4AA 3T8TA 1D8JA 1LB2A 4M6YA 2MLGA 2WWYA 3I54A 3HHGA 2VBZA 4HF1A 3QRFF 1XDSA 3TDZC 5JR3A 1KA8A 4NHJA 2KIUA 3TOAA 1XSVA 2NNYA 2VOOA 1BYMA 4ENMA 4R79A 1SD7A 2ZXJA 3WTUC 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 4A5NA 1WI9A 4QWQA 3GF2A 2STTA 4I98B 4UVCA 4EM2A 3FM3A 5E8IA 2DQLA 5JHUA 1IN6A 2YU3A 1UCRA 2M45A 1JGSA 4L18B 1ZG1A 3KP2A 5L3DA 2P7CB 5ICFA 5JVTA 2MA3A 5FGMA 4QLCU 1Z91A 3KP3A 1MKMA 5ILVA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 2JZYA 2BYVE 4HDUA 1KYWA 4CICA 2P5VA 4FX4A 1ZYRF 1J75A 1ZHFA 5DUIA 4EGZA 5D5VB 2FF4A 3KP7A 2OQGA 3C1DA 5ERIA 3V7RA 5DEQA 4DQ2A 1K7AA 3RI4A 5E17F 2A61A 1AWCA 5E1ZB 4HZFA 4LLLA 4L9VA 2EFWA 2IRFG 2HGCA 1I1SA 1V4RA 5EEGA 2RN7A 3E6MA 1S29A 1HKTA 5ICCA 2O0YA 3N97A 1RNLA 4CHUA 1K78B 2MBFA 2F5FA 2FMYA 3IKTA 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 4WXDA 3IRRA 4B09A 1P4AA 5L3GA 3WGGA 4A5MA 5CVVA 1L0OC 4L9NA 2O61A 1IN5A 4RB0A 3SZTA 1FYKA 1SD4A 3LAJA 4A0YA 4M73A 5FB2A 2OZ6A 4EVIA 3WTSC 4ZZLA 3W6KB 4HX8A 3HSFA 1G3YA 3E5XA 4FHTA 4IVNA 4RB3C 1S7AA 2MLKA 2EFNA 4A0XA 2EFOA 2QQAA 3F21A 2FE3A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5HDKA 4YIIA 4M71A 2V1UA 1MDMB 2G9WA 4BHBA 1WQ2A 1T38A 4IRIA 2XV4S 4UV9A 2OD5A 1LNWA 1Z05A 2Z5UA 1S6LA 2MD5A 3BWGA 2XAFA 1YS7A 4BYYA 3IWZA 3E6CC 2XAHA 4WXCA 3JTGA 1EH7A 3WU0A 2A5YB 2STWA 1WKMA 1YTYA 5H6QA 3RTRA 1D5VA 5HLGA 2QQBA 1O3RA 3FMQA 1U5TA 3BPVA 1USTA 4YFNF 1BBYA 3RPQA 2M1BA 2LSOA 3P9IA 2KJBA 3CTAA 2PI0A 3GW2A 2VODA 2QLZA 5LGNA 1AOYA 1FP1D 2D2WA 2K4JA 2PG4A 2ZJ2A 1YO5C 1IW7F 2XRNA 5ICEA 2F5DA 2R7DA 5D8KB 4ESFA 1R58A 2MH9A 3CUQB 3WTXC 3GX4X 5LHGA 3I58A 4IF4A 2GA1A 1O7LA 3K69A 3KCCA 5LGTA 3K0LA 4S05A 2DW4A 2DU9A 4DNCA 4G6QA 1K6OA 5LHHA 2OBPA 1R5GA 2XIGA 2L54A 5CVJA 3MEXA 4LB6B 2L3DA 4BH9A 4M9XA 4BAYA 4RGXA 4RGSA 3DQVC 2JPBA 5DDGA 1LDKB 1FSEA 4MEYF 4PGHA 4CXFA 2HYGD 3ZN1A 4HQMA 2DI3A 2K5IA 1ZG3A 2H3JA 2EFQA 1KYZA 3FX3A 3IKVA 4KYWA 3B73A 1FWZA 4GXOA 3F8MA 4XLNF 1KGSA 5HLIA 2W84A 2ACJA 4O3MA 3WODF 3CLOA 2FQ3A 3F8NA 1JHFA 2HYFA 3SQNA 3BROA 1WSUA 3ERED 4Q47A 2EFPA 2F5CA 3C3WA 2ZKZA 2Z9OA 3I59A 3K1PA 2PBIA 3IWFA 1U6GA 4K2EA 3K9TA 2DPDA 3DV8A 4IRHA 4Q4ZF 1DDNA 1HXDA 1XDUA 2KKOA 4M74A 2ZNYA 2EWNA 4KMFA 1YW9A 3LA2A 1QZZA 3D0SA 2RQPA 3F22A 2RNJA 3P9CA 4RAZA 3WE3A 4HX4A 1TW3A 5ILSA 5D5WB 2K27A 1HW1A 5DV5A 2VXZA 2WV0A 1H0MA 1F5TA 4M9ZA 5A2QK 3V7SA 2XKOA 2Z33A 3H92A 4RGRA 1Z6RA 1I1GA 3CO6C 4R8HA 5D5UB 5IT3A 1BI1A 3VODA 1KU3A 1CGPA 2XHKA 1ZRDA 1YW8A 4HA8A 2PJPA 1V3FA 2IT0A 4ENJA 2H6BA 2AS5F 2QVOA 5D4RA 2PEXA 1Y0UA 2K5LA 3KLOA 4MQVA 3V7CA 4WXHA 2YX4A 2HTSA 4RB2C 3GLXA 3ECHA 4WF2A 2ISYA 2BBYA 1QNTA 3R0JA 1ZLKA 4XSXF 2KRFA 1TNTA 3V8LA 4M9SA 1MJ9A 3DFGA 1T0FA 3RKXA 3HYIA 2UZKA 4WWCA 3NQOA 1FX7A 3L9FA 2K4YA 4U7DA 3EYIA 1U8RA 3ABUA 4GO1A 1S8NA 3HTSB 1J7KA 2P8TA 4ON0A 1TQPA 1YFHA 2JT1A 3N4MA 1STZA 3K1MA 3FXQA 3W6JB 1MJBA 2GA2A 3V8JA 2VT2A 2X0LA 4I0AA 2ZO4A 1QPMA 3L2CA 1IF1A 1MJAA 4EJVA 1TBXA 3OV8A 4LK0F 5DYMA 4A6EA 2RDPA 2Z99A 3ML6A 1A04A 2EV5A 5F6FA 3ZPLA 2CFXA 2FBKA 2XGXA 2FU4A 2DLLA 1PDNC 2EJRA 1E17A 2CSOA 2HKXA 4OIRF 1P4XA 3U1DA 1TW2A 2H09A 4A6DA 5ED4A 3T5XA 5HDNA 3RPUA 2KJCA 5J8CA 1UHMA 3QAHA 1PUEE 1FOKA 3CUOA 1W5SA 3GUDA 4JK1X 4ZZDA 2V9VA 3E6DA 1QVPA 1ZGAA 4XSZF 3LA7A 4A12A 1IN7A 3WG9A 1EH8A 2A69F 3P9KA 3BJAA 2YPRA 3DEUA 3H3ZA 2IA0A 3HSRA 2PN6A 3LAPA 4EJOA 2RKHA 1FC3A 1S3JA 5JI6A 1I6XA 4H0EA 2WC2A 2H27A 2ZNZA 1RUOA 2ETHA 5LGUA 2DK5A 4ZYGA 1U5TB 1DP7P 1OR7A 4B8XA 2XAQA 2KIMA 2IA2A 3E97A 3CUQA 5K5RA 1IZ1A 4FX0A 5E1XA 1XGMA 1GVJA 2IJLA 5AIPA 2ZBKA 3R60A 4MQ9F 5E20A 4I01A 2W57A 4O6JA 3COAC 2VONA 1IRFA 5IT9K 1ULYA 3ABTA 2DTRA 4GYIA 4IPAA 5LRSA 2HDCA 4ESBA 1ZRCA 4OIOF 5CJ9A 5DCMB 2UXXA 2NNNA 2FRHA 2RGVA 3RKYA 2P6TA 5BOXA 1W7PB 4O5VA 1HKQA 3SFZA 4ZYEA 4LLGF 1K78A 4P5OA 4HF0A 2VN2A 4R1HA 3BZ6A 2YX7A 3FHZA 1QGPA 5K1YA 1OKRA 4AIHA 2EK5A 1R00A 1BC7C 2VC1A 2J5OA 5FLXK 4KICA 1BIAA 1BIBA 2EA4A 1FT9A 3U2RA 1G3WA 3ZMZA 1FBQA 4D0PA 4U0WA 2QBYA 1KQ0A 5J6XA 5FO5A 5DD8A 1R22A 2VBWA 3FZVA 1I5ZA 2ZMEA 2IP2A 2V6CA 3QU6A 1P92A 3ULQB 3FXUA 1T6SA 4Y17A 2RC4A 1F1ZA 1SFEA 5ICGA 1D8KA 2GZWA 5CVRA 1EV7A 3BJOA 1FBSA 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 2IVMA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 1W4MA 3JTHA 4LG0B 3EYYA 4Y15A 2D45A 1T2KA 3O2PE 1XSDA 2DT5A 2B0LA 5HLHA 1OYIA 5E8GA 4UXNA 2VBYA 3J7AO 1SMTA 1DPUA 2DBBA 3F8CA 3T8RA 4OINF 4EJWA 2OU2A 4LJZF 4HLYA 1R5HA 3DF8A 4ENNA 5TJJA 3J80K 3M9AA 1ZGJA 3BOQA 4OMZA 3VOEA 2BV6A 4ENKA 1QQIA 1H9TA 2PFBA 2X4HA 3WTYC 1XCBA 4U0VA 1XGNA 5BPDA 2F5EA 3KFWX 5CVUA 4IJAA 2D1VA 4YFKF 2BE5F 4I0BA 1LDJA 4HF2A 1Q1HA 2PLYA 2XAGA 3TKYA 5HS8A 2K86A 1TTYA 2NRAC 1U78A 5F1RA 4NB5A 1MD0A 1YS6A 4RGUA 3O6BB 4EJTA 2FSWA 3FMRA 2A6EF 4JQFA 5KK1A 2CGPA 1HSTA 3HTUA 4PCQA 5A2QZ 5K5OA 2Y48A 3QU3A 3LA3A 5J8FA 2OZUA 1W7PD 5DUKA 1IAWA 2ESNA 5HS7A 3VEPA 1Z1DA 1IRGA 2R3SA 4OU0A 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 4BHPA 1U2WA 2VOPA 3E5UA 2LDUA 1OPCA 4LMYA 3DPLC 1ON2A 1SAXA 2J5PA 1LEBA 2O8XA 2HQNA 2V1XA 1FP2A 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 1XGOA 3JAMZ 2OQRA 4BQAA 5TRDA 2QENA 1O57A 2XKPA 1WWXA 1YLFA 2A6HF 1FYLA 3GO5A 3I4PA 1LJ9A 5BS6A 3HRSA 5HDGA 3SXYA 3J81Z 3J80Z 1XGSA 2GAUA 5L3EA 4EM0B 2C6YA 2MC3A 2UXNA 5BQTA 2FNAA 3KZYA 2GWRA 3IHUA 3KLNA 4G7ZF 2CWEA 4P96A 3RDIA 2M8EA 2O3FA 3F23A 1GHCA 1BI3A 1XMAA 4IRGA 1LEAA 3FWEA 1ZRFA 2M87A 2HKOA 5H20A 3DPTA 2EA2A 2E1NA 3R61A 2QBYB 1WRJA 1R1TA 3M8EA 2LF8A 3FF5A 4HYEA 1QZYA 3TDUC 2GQQA 4A0ZA 2QYOA 1XMKA 4IHTA 1XSXA 3WTVC 3ZN0A 3HIFA 3EDPA 2OAZA 3PQKA 1RI7A 4KN4X 1G3TA 3KEOA 3WGHA 4HQEA 3GVAA 4KDPA 3ZQ7A 4KN7X 4L0YB 1FZPB 3KP6A 4F7ZA 2BGCA
chains in the Genus database with same CATH superfamily
3JRFA 4BNCA 2L7MP 1ETWA 3CCMA 2RV8A 4C2TA 1RAAB 1BR4A 1Z9ZA 3URGA 3CCJT 3ISPA 2JJ9A 1R5ID 1Y96A 3NPFA 4C0ZA 2RHUA 5GPCA 5LJ5e 2X1CA 2X4JA 5D8LB 3M0RA 3WGIA 4D7NA 1U06A 4KRTA 5HCKA 5LD2C 5GJWB 1GXQA 4HEA2 5GAEJ 4OAZA 3I56I 3REBB 2NUPB 4M7DE 4AFQC 4MZMA 5CO7A 2KXDA 8AT1B 2EIJH 3ASNH 2G3RA 2YUNA 2XGCA 4FSSA 3EGUA 3KP5A 4KIGA 4C0FA 4Y91A 3F8FA 4CYDA 2AK5A 2XF5A 4F16A 4G12A 3FXRA 4HAMA 3CCJQ 1ZH5A 3IUOA 2P0TA 1R36A 3ZRGA 4WCGA 3A0BC 3S3MA 1XD7A 2GF7A 2K9QA 3TEDA 2F5KA 2SRCA 5EGOB 2X3XD 2VC0A 1N6AA 1ZARA 3QQAA 2XGDA 4A93J 2O9VA 4LIVA 3GEZA 1ZG5A 2QQ9A 3HL8A 1VQOA 3QYEA 4BXUA 2HI3A 1ODDA 3TOBA 1O3TA 3A98A 1MSEC 1OLTA 5E3MA 3S1MJ 4X34A 1W2BP 3ECOA 2AXLA 3BC8A 2EPDA 3BPXA 5AYFA 4XRFA 2VIXA 4NBQA 1Y8RB 3GTJJ 3G4SA 3DWLE 2FXAA 3D5LA 4GCVA 1GCQC 2W85A 2X1EA 2GQIA 4GRIA 5EG0A 1Z9CA 1JEGA 2FJ1A 3BQYA 1F9NA 4R55A 2LF7A 2FO0A 5AT1B 2E2JJ 3OR2C 4Z6YA 1DGWY 2L89A 4OIPF 1IHWA 1IB8A 2DFIA 2WTEA 1YIJA 3JRIA 1E3HA 3F6OA 1TS9A 1ZSZC 3CDHA 1T0HA 5LJ5d 2E1OA 4N9HA 3ELKA 3HOYJ 2Q8KA 5LJ3d 2VBXA 2XB5A 2X6XA 1ZREA 4HT8A 2FA5A 2KIQA 5AIQA 5FKKA 5CKTA 1Z7UA 2B8AA 3G3ZA 3I3LA 4M7AD 3G2BA 4DEYA 1T95A 2ELHA 2LKPA 3L2WA 3PVQA 5CYVA 3CC2I 4CC3A 5IHIA 4RA2A 3LLRA 1PP7U 1NH3A 4KULA 2RJDA 4NUBA 3RYRA 1N27A 1DP3A 4J8OA 3LWFA 1SD5A 5DS9A 1K73C 3I4NJ 4M78G 1I8FA 2LP5A 4AG2C 1M4ZA 2VUBA 2XD0A 3LFKA 3H6ZA 2BEOA 4YIRX 4PJJA 3INZA 5HNHA 3KPHA 2R7WA 1HW5A 4HOBA 5CQEA 4RLFA 1RR8C 4DBRA 4YFXF 1QHHD 2MIOA 2Z3YA 2D9TA 5DCMA 3TW7A 1DUXC 5CKDA 1W2BA 1E3PA 3LSTA 2ELKA 2M7BA 1REPC 4A3KJ 2E1CA 2RQQA 3AT1B 1X3WB 4OWRB 1A6QA 3BJ6A 3V42A 4A53A 4PK4A 1QQJA 2BW3A 1BI2A 2QCOA 2WAQN 2DYSH 4M6XA 5J40A 4Z2YA 3TBIA 1JI8A 2ZPGB 4MMKA 4BQNA 4Q5WA 3JSPA 3DBRB 2DBKA 4L0ZB 1I4K1 4HV5A 5I2MA 3DXJF 1YHQT 1YG2A 2Z2SB 3PJRA 6PAXA 2Y75A 1YJNQ 1YW7A 3OSSC 1SD6A 2E5ZA 2DERA 1Q81C 3ZMTA 1UHFA 1GBRA 3CEYA 3A4CA 2H6CA 2X85A 3K4BA 4LFUA 1QBJA 1GDTA 4M7DG 2XPWA 3CCSA 5E18F 4RB1A 3NTKA 4RM3A 4FW1A 1ETQA 4M77C 2OCEA 3FXJA 2CV2A 3OS0A 1WXTA 2K4BA 4F7UA 2M2EA 2QEXI 2IA1A 1P2FA 1KQ9A 2QA4A 1ZN2A 3JRAA 2QZ8A 1ZQ3P 3JCMd 2VE9A 2R7XA 2P4RA 3VS5A 1M27C 4C5HA 2RMOA 2MF2A 4L5IA 1UFFA 2L3QA 1FPQA 3EUHA 2GFUA 2VE8A 4AVPA 2QUFA 3AG4H 4G7OF 2CP5A 2ID3A 2XVCA 3BR0A 4II2A 1X2NA 2FUG2 4BKXA 3IL2A 2GNCA 3WVDB 2MCNA 3CMAI 4YG2F 2MUNA 4WK8F 3EGXA 5LRRA 4BI4A 1E2XA 3GZ5A 2A07F 3OQ5A 1VQ7I 4XBFA 3HOSA 4G94A 1W5CC 5GMKh 4F52A 1J3TA 1R1UA 1XB4A 3DKMA 9ATCB 4Y92A 1N8RU 3PE0A 4NC7A 1JO8A 4M75D 1YQAA 2DYRH 3ZMDA 2EJFA 2M3AA 4IHSA 2V9PA 2QSHX 4EMSA 3S1NJ 4IUUA 1WIEA 3G4SQ 3K2AA 1BB9A 5KH6A 4BACA 1S7OA 1ACMB 2HCKA 2DIQA 3HPGA 1IN4A 1G6NA 3LX7A 2HQEA 3ASKA 2JSCA 4DYCA 2FEZA 1Z3XA 1FTTA 1O7FA 2KRHA 5F1JA 1ZUUA 2KQRA 2JMAA 4CI0C 3U9GA 1TOVA 2XDVA 5F27A 3EETA 1RAHB 1HA8A 3I4MJ 2P0KA 2JS2A 3GMEA 5TISC 3ZQCA 2RQUA 4C92G 1YBYA 1OMIA 3DEWA 1QMCA 1VQKA 3JREA 2EV0A 1B34B 3CJTB 3GWZA 3AL0C 4NOYA 4BHCA 2ZJRF 3PQJA 3RQIA 2QXFA 1W1WE 3FMSA 3W2WA 1H3HA 3AL0B 2XICA 4BI3A 3CCUA 4U0YA 3CCUT 5AONA 4UUSA 4EMGA 4X9DA 3DKWA 3EQLF 1H3ZA 2M0MA 2V79A 3L00A 2CT3A 2CQKA 4RBOA 2XGEA 5J4YA 2PUKB 2EYZA 3Q0VA 1VQKT 3CUQC 2F2EA 1PP8F 4ZDOA 1YX5A 2DFFA 2W25A 3E6BA 4XLPF 3QDRB 1BC8C 2XUBA 2KL4A 2FMLA 2BZ8A 1TWBA 4IZZA 2I0NA 1SSHA 1IXDA 3HUGA 1SRMA 4B4CA 1BOBA 1YRNA 2GXGA 4IXAA 3JR9A 3JRHA 1BJAA 2ECCA 3MAJA 4GDFA 1IXCA 1TNSA 1XCVA 3NTHA 4IIOA 5IXBA 1QA6A 3JV3A 2LBFA 3RKWA 1B72B 1D0XA 2DQRA 4IX7A 1T98A 4KFCA 2H3EB 1J59A 2QQRA 3TGNA 1S7EA 2E41A 2LJ1A 3BG7A 4P9FA 4FYXB 3MZHA 4LITA 1V29B 3PFYA 2BHZA 2WAQA 1GUUA 2CO5A 2GXAA 3OSVA 2RHIA 3SZPA 4E7LA 4A3MJ 3QG1A 2HPMA 1WJEA 2VPRA 1UGRB 4LD5A 2W24A 4BUGA 2M51A 4I09A 1E6HA 1VQ6Q 3M1EA 4PJOG 1NHAA 1Z0XA 5LLQA 3DKXA 5JVGF 2PQ8A 4GFBA 1BA5A 1BW5A 1OI1A 1XJWB 3MPUB 3CCVQ 1NJIC 1VQPT 1BM9A 2HZDA 3HRTA 5HOOA 3QSUA 1OYYA 2K3FA 3LH0A 3NEUA 4L59A 3QP6A 3OYGA 3DP7A 1FIPA 2LYCA 1U3EM 2QA4T 3X24B 2K7LA 3ASOH 1YJNI 1GXPA 1POGA 5H6RA 4HLXA 2XAJA 4AD9A 2ZPHB 4CGZA 4ZGEB 1G4DA 2CRGA 5DTDA 1ZTRA 1EFNA 2Y0MA 2CUJA 2KXCA 2ZPFB 3CCST 3DTKA 1BN5A 1UGVA 2HWVA 4MFDA 4CO8A 3OYKA 3G1JA 1RQ6A 3CCQA 2L7KA 4S04A 2QTVA 4RS8A 3BR1A 3ZCOA 2J6FA 2LREA 2PMUA 3CCJA 2K57A 1FNNA 2UUZA 2KYBA 4EATA 3M56A 2ZJQF 1Q81R 4HPQA 1IN8A 3T1BA 2RK1A 5LEKA 2VT3A 3BZCA 1F4KA 1K6YA 5IP9J 4XLFA 5GANh 4XU3A 3HRUA 4M78A 2M4GA 5IHNA 2PMZA 1I5LA 2EH3A 4JYKA 3V8KA 1M8VA 3TQNA 3OW2A 1AZEA 3T9NA 3CC7I 1Q82U 3HHHA 1Q82C 1B59A 1PUFA 4GYGA 4HNUA 2BIVA 3H5RA 2DTHA 3HFNA 5L3CA 2ME6A 2E34A 2DX1A 2YRVA 3GFJA 1N5ZA 2ZXHA 3BZKA 2CKKA 3WXMB 3BG5A 1J09A 2YR2A 3AG2H 3BY6A 3H8ZA 4UB6C 3GTOJ 3PNWC 2RI5A 3M53A 1J0RA 3MFKA 2JRMA 3BDUA 2KISA 2COMA 3QIIA 1Q86R 1VQMQ 2BE7D 3NHNA 3EH2A 5A2QE 4PSXA 1VQ5I 2CV0A 4UUVA 1OZ2A 1TUDA 2GBQA 2HMAA 2LH9A 2BGCA 5HODA 1IRXA 2D1HA 1HLVA 2L7FP 1BW6A 1ZR2A 3QDFA 4R56A 4HX7A 1FOYA 4DYQA 2N8GA 2VJIA 2XSJC 5IYDJ 1TQIA 2XF6A 1V5GA 4M4ZA 4CZZA 4ZYHA 1B9NA 1HQCA 4EV0A 3M4OJ 2M30A 3QJ6A 4IUVA 3HBLA 1MBJA 4AU7A 2HD0A 1OCRH 6AT1B 1YE9A 3MKYB 3A8LB 4OIQF 4BJ5C 2P7VB 5FD6A 3K2ZA 2QGFB 3VRZA 3R0AA 4JJNK 1JHHA 1I3QJ 1GV2A 4BE2A 3M8FA 4XMYA 1BU1A 2NYXA 2CW7A 4P55A 2IS1A 5E3NA 3E0JB 3QPHA 5CLSA 2E6ZA 4M75B 4LK1F 2ISZA 1IXRC 1VQPA 2GIVA 1ONVA 2JUGA 4G8XA 3DLAA 4BEHA 4AT1B 1KFZA 2OX7A 4B3AA 4ZH4F 2O4XB 2IG0A 5J1RA 3LSRA 1U1SA 2VI6A 3CMAQ 2IPQX 1MH3A 3GTQJ 4UVBA 3KETA 5JFRA 1SKUB 1WDXA 2ESHA 1HBXG 3BP8A 2QDYB 4FYWB 3JB9J 3HOVJ 5M5XJ 5LBQA 1ABOA 2DTOA 5D4SA 2LNVA 4J9CA 2P6SA 1E0EA 5GJVB 4KUMA 3G71I 1XG1A 3THKA 1B6AA 2L0AA 2AQFA 2E7WA 2KRCA 3JCMV 5K5QA 2KLOA 3I0TA 4CA0A 2DPUA 2H8RA 3WTWC 4MEXF 3KE2A 1WGXA 5F04A 2A5WA 4I02A 2EZIA 5EF6A 4E6KG 4KA4A 1YJWI 5KCOA 1X2QA 4KIFA 1MNEA 3MQ0A 4YIFA 5BPIA 2DO3A 1O3SA 2RH2A 3H0FA 2VJ5A 2A6TA 4UVAA 2F2XA 3OBWA 2ICWG 3R6OA 2EYWA 2K6DA 4F7UF 1JTXA 1I07A 1MUZA 2EKOA 3I5SA 5K7ZA 1WJCA 2VV5A 4FE7A 3RPUD 5KYWB 3OWTA 5GAGJ 5HLTA 3QYBA 5IYBJ 1S5LC 3CJNA 3O8HA 4MTDA 4JS5A 1VQLQ 2NAZA 3R6NA 2DAQA 3I55A 2P5KA 4FISA 4OMYA 4FL6A 4XONA 4XOPA 4ZYDA 3IRQA 1TWAJ 4FASD 5I21A 3ZBDA 3CCVT 1RABB 2W10A 4C3IJ 2LQWA 5A0GA 3QWYA 4BY6C 1ENHA 3E5QA 4A3DJ 2DA6A 2DD4A 1VQ6T 4PZJA 3CCEA 4L5JA 1Y8QB 1LOJA 1JQQA 4MIMA 3I53A 2DN0A 3TSWA 2DAOA 2R7UA 1B72A 4QPQA 3HG9A 3QPTA 4Q5SF 3CCRI 1KHIA 1ZBJA 2DIGA 2M5WA 1M8MA 2O31A 2FOKA 4M7DD 1ITYA 1NE8A 1VQLT 5EDNA 1O3QA 2R5ZB 5LEJA 3CP8A 5GANg 2LCSA 4E70A 4Y13A 1ZAOA 1QP2A 2E60A 2XASA 1K79A 2WSEE 3CD6A 2A05A 2NS0A 3EFSA 1KQSA 1MBKA 4A3CJ 3QZ9B 4PJ0C 1M90C 4F3QA 1D0YA 1A36A 4R0KA 4D5CA 2HVSA 1SMYF 1VQOT 2YHTA 2DOEA 2OC6A 4FT8A 4M78E 2DA1A 1OULA 1VQ8I 1HSQA 1B1BA 1TXQA 1ZUYA 3QZ5B 5BMZA 5FLXE 4NQWA 1YJ9Q 2HZTA 3H0DA 1W2BS 5A0DA 1R71A 1VQKQ 2DFUA 2HOEA 3JB9G 2PMZN 1SVOA 3MJXA 2RVCA 3TCJA 2AZSA 3M1CA 1RAGB 1EKEA 4IL6C 2DKGA 3CBPA 1BI0A 3CCUQ 1T3SA 3OMCA 2MFZA 3MMYB 2P5LC 3IH3A 3L2UA 2JN0A 3I5UA 1TT5B 4ASNA 2MZ4A 1Z7LA 2CZ0B 4LG0A 2LBFB 4ESJA 1VTNC 4HDVA 4AM3A 1JXMA 1VA7A 3DU5A 4MGRA 3REOA 2GCXA 3M57A 4BD3A 2M7AA 3WG7H 3WTTC 4F92B 4U7BA 1Z6TA 1XS9A 1VYVA 2PNIA 3A8OB 3M5AA 3NRVA 3TO6A 1XN7A 1MDMA 1Y96B 1UHSA 1UEBA 5D6EA 1YHQA 3M7GA 3C0CA 3JSCA 3QP5A 1U5TC 2BZTA 1FSHA 1Q81U 1W5TA 1NPPA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 2M4KA 1T08B 4XOTA 1DU6A 1H8KA 4EGYA 1ZSZB 2EIFA 4HVWA 4J7FA 4LB5A 1J5YA 3CBOA 4RTUA 3META 3FKIJ 2AKKA 3JW4A 1ZSZA 3OYBA 4FYYB 2M9HA 4NQWB 2EYYA 4B9WA 2JRTA 1S72Q 4JRIA 4BJTA 4UNOA 2VKEA 3ERMA 2HBWA 3LSJA 2KIFA 1BOAA 3WU1B 3RYPA 1N9RA 1VIFA 3UWNA 1QVTA 1AT1B 2EFIA 1M3BA 4LUEA 4HW0A 4OOIA 1ZBXA 3U23A 3A02A 5GMKm 5EEAA 1RI9A 1SANA 3CLQA 2MAMA 4EDUA 4XLEA 3TO9A 1ZLJA 1BCOA 4PSWA 1JXSA 3OYCA 4LDVA 1A31A 1WH7A 1V5FA 3CCLT 1KSWA 5FFXA 4KISA 2K02A 3HOUJ 1IC8A 2MH2A 2OCCH 1IXSB 2E4HA 1UFMA 2JW4A 4NNJA 4A4EA 3I59B 2EW3A 2CT4A 5LL6S 5EEHA 2LTOA 1VQ5Q 2XSDC 5HK0A 1TUGB 3K1NA 2WA0A 3EG9B 3P7NA 2RAEA 4M3DA 1UGQB 2O2OA 1X1AA 5GAMe 5LJ3h 2K9NA 2F48A 4TV7A 1YITQ 4N9IA 2YXYA 5ILUA 2XHCA 2G7UA 1M1GA 2RHXA 1D3YA 3MVPA 3BTJA 2ZZDA 3EAEA 4DZJA 4KT5C 4BS9A 2K40A 2P4WA 3FXKA 3NTIA 1HSJA 2DA7A 5C6SA 3FC3A 4P5NA 1OCCH 1BCMA 1R4NB 5BNGA 1FOXA 1SFXA 3GXOA 2DO7A 3SZGA 2FBIA 3F6VA 1R0CB 3PT9A 4KMUX 3RSNA 4LIUA 3ZMVA 4ZC3A 2EQUA 2PU9B 3OYJA 1BK2A 4AYBA 3I64A 3WE2A 1M1EB 5F64A 2D0QB 1X1DA 2CG4A 4C8QF 2IS4A 5DM6F 4M7AG 4L9TA 2DL7A 3VKIA 4X9CA 5GAN6 3ZMSA 3RKQA 4U88A 3VYRB 1VIEA 4UV8A 4XTXA 5L8RE 5JLXA 3ZEHA 3Q9SA 2R7SA 4DJAA 3U1KA 4ZN1A 4L9JA 3S2HJ 1IGUA 2VWFA 1WYXA 4EPCA 1X3UA 4OMMA 3Q0UA 5D5XB 3MCAB 5KYYB 2TDXA 4BJ6C 3S3OA 1JUPA 1J2XA 5DD4A 1SHFA 2KYMA 3EGDB 4GLKA 2P0QA 1OYWA 1FLIA 1LDDA 1QW1A 2HTJA 2VQGA 2X98A 2BKDN 4J6WA 2FL7A 1FY7A 3HKZN 3FDYA 2ZMEC 1FBUA 5IOZA 1HW2A 4N0BA 3H9GA 1DPRA 3ROUA 1FYNA 3P8DA 4Q48A 2J6KA 1QVUA 3BQZA 5EGOA 5B1AH 2WB1A 4JRQA 2GTJA 2XB0X 3K4KA 1X1CA 4ETSA 2OAUA 4F04B 1VQ9A 1W4SA 2V8JA 3M0TA 3M59A 4N4OB 1USSA 3T0YA 1KQSP 1MZBA 3G73A 2L3PA 3MO8A 3CESA 3TP0A 2IPOB 3OIQA 2PZ1A 4RTVA 3RR6A 1MGTA 5IT9Z 4XAXB 3K4LA 3MHXA 3ZP5A 4J9GA 1HJDA 1VQ4T 1C0WA 1JJ8C 3C18A 2LKXA 3M4GA 2Z16A 2JTEA 3BW1A 1ORKA 1TSFA 4HCKA 4DOVA 1R7JA 1B8IA 2JUFA 2LNBA 4L5GA 3D5RC 3CPWP 4M7DC 1IHVA 4I6ZA 1MV0B 2AHJB 3HOTA 1T39A 3MCZA 1X75C 2YSRA 2CGHA 1Q7YU 4KIBA 4A3EJ 2KGTA 2V7FA 3M0SA 1KD1R 4B44A 2DT6A 1NM7A 5IAYA 2JVGA 4CCKA 2R58A 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 2KR3A 3M54A 4JJBA 4HCBA 1S9HA 2WY7Q 4G7HF 2HS5A 2MMPA 4HBLA 4MNUA 2CYYA 1P6RA 1RZ4A 2KMUA 3PSFA 3R4KA 1Y1WJ 3J80R 1QO0D 2HZYA 3VS0A 2YLCA 1E7OA 4LUDA 5IN1A 1CF7A 1CQTA 1KJWA 2CUFA 3JRDA 2L02A 1YHQI 4RMOA 1QVFA 2UWMA 1LUJB 1RACB 1WLPB 2HSEB 3E19A 5GAN8 1TT0A 5B1BH 1CF7B 3CO7C 4AWXB 2JA6J 4D5FA 1OPLA 3ABKH 3CMEI 3CD6Q 3BDDA 2CW0F 4UUTA 3ZFJA 1BJZA 3JSOA 4D8DA 1LVAA 3F72A 4CSWA 4DBQA 1WJFA 2DLPA 2EQMA 4EM1A 3ESWB 2HR3A 1P4WA 2G0EA 4OAYA 3OYMA 3GFIA 4A3FJ 1KQ1A 1LPLA 2BTTA 3HB9A 2GLOA 4L5EA 4L6V5 2DD5A 4EJUA 2BZYA 2ZMEB 1TLHB 1KU7A 2E7XA 2RQWA 2YRCA 2QWWA 1P9QC 4G9YA 2P0PA 2K3PA 2L3RA 4I2OA 1I3AA 1EZZB 1XNIA 2IW5A 3GTGJ 4BB7A 3TREA 4BY1J 2H8HA 3S16J 3OYDA 3JCMX 5KAIC 1ETVA 2O03A 2FEIA 2PMHA 5CKFA 3CF2A 3FIWA 4OGEA 3LQRA 4AIKA 1KU9A 2KDSA 1UJYA 4GGGA 2KRNA 1TQMA 1B4AA 3GZ6A 4C92D 1VQ8A 2NXNB 3Q5FA 4C30A 3RIRA 2LRQA 2R7FA 4Y3OA 4I76A 4CZCA 1KC8U 3MZYA 5FFZA 1YYVA 3L1PA 2JPCA 4FCYA 4LLNA 3OYEA 4JX5A 2A36A 2GTOA 1YIOA 1APLC 4IQ4A 3CD6I 1W1FA 1UB9A 3KP4A 2DEQA 2V1DA 3K70C 4J00A 1I27A 2CS3A 1T0JA 3A1PA 3QODA 5GAMd 4FSXA 1RIOH 1A5JA 5J1UA 3KFVA 2RJFA 1ZELA 3SB2A 4NL3A 4CC7A 2A3SA 1G3SA 3MP1A 2BXZA 2O6GE 5CQGA 1PG5B 4XK8E 5GAMj 3CCRA 1GVDA 2DF6A 1NLOC 3MEVA 1T0FC 3TO7A 3S6WA 2EBIA 5E1WA 2HEOA 5CPRB 5FD5A 1M9SA 2XKOC 1W70A 1EX4A 2X6OA 2F6CA 2L4MA 3IC7A 3Q9VA 2WB1N 2L2OA 3AAFA 2LDMA 2DVJA 2LD5A 5L3BA 2OF7A 1U3OA 1YCYA 4GBQA 3ZQFA 2OA4A 2GM4A 4FTHA 5FLMJ 1J9IA 2VQHA 3RJPA 2COYA 3OW2S 4C0DB 4HT9A 3I55I 3FM5A 2ZCWA 3GYHX 1K0SA 1XC5A 3CCRQ 3MZ8A 1IDZA 1K9MU 1GXIE 1UECA 4C0DC 3UF4A 5DCFA 2EIMH 1ZR4A 5KVRA 2HBPA 1A0NB 4E6RA 1UG2A 3LMMA 2HL3A 2DILA 3O3KA 1GFDA 3IV5A 4BBSJ 1Y07A 2JTVA 1VOMA 2LT1A 3L1AA 3NMZC 3VRYA 2EQRA 2I8DA 1H92A 4P9UA 2HQRA 1QKXA 1WHGA 4E2FB 2G7HA 1YIJT 2MK5A 4PGGA 4JPBW 4UHTA 2H94A 2VKHA 3PL8A 4EQQA 2K9MA 2Y9YA 1JKRC 1HF0A 3JCMh 4C9YA 2HQAA 3QOPA 4D1QA 2A68F 4JX6A 4A3JJ 2RHYA 3C94A 3OOPA 1ON1A 3HUGB 1XX5A 1X6OA 1YFNA 2Q2EA 3MEAA 3I71A 2HDWA 2LOOA 3WTZA 4XU2A 1X4PA 4V2GA 1D3BB 2QYZA 4LGWA 5GADJ 2NS8A 1R49A 1L3LA 3RBBB 2K5FA 3MP6A 1IV8A 5L3FA 3KEQA 1CSKA 2NLUA 2ZFWA 3V4GA 5EG0B 3PIPA 2GGRA 1UGSB 4DA4A 1OOTA 2LX9A 5FKLA 2JQ7A 1WI3A 1AWWA 2VXEA 1XTDA 1IUYA 1EH6A 3HJEA 2DZ9A 3BR2A 4J01A 2XPVA 4PDKA 1VQMA 3SHFA 1H9GA 2QG9B 1YITT 5FLXR 1JJ2P 2DA9A 3MKZA 1Z21A 2PQWA 3VFZA 1UHWA 2OJED 2D5VA 3VB2A 1PC0A 4M72A 5HVQC 2EBPA 1SFOJ 3OBYA 1R1VA 2XROA 1VQPI 2EQIA 4KNYA 4IUPA 2Y30A 4A2UA 3ZMUA 1IO2A 4JBAA 2EVRA 4RAYA 1OYXA 2KAFA 2RJCA 2MG4A 2DTZA 2CMPA 1KG1A 2FG0A 3D5SC 3SWNC 3RCOA 4C8QE 3H3UA 5J3BA 2V1NA 3HSEA 3H9JA 3UA6A 3S17J 4M7AC 2D8JA 2P81A 3TMOA 1OCOH 1LQ1A 2KMTA 2L4AA 3T8TA 2IS6A 1QVFS 1D8JA 4II3A 1LB2A 4JJDA 3ZQHA 3E7LA 1V1CA 2VXFA 3CCMT 1M2VA 1JKOC 2CYZB 1Y6IA 4XORA 4M6YA 2L9SA 2MLGA 2WWYA 1PSEA 3H0IA 3I54A 3HHGA 2VBZA 1NJIR 2DK3A 1MSFC 1VQ5A 4HF1A 2BZXA 2ZSIB 3QRFF 1XDSA 3TDZC 5KYXB 2TCTA 1S72T 1D1AA 5JR3A 2E5KA 2B86A 1KA8A 2ZGWA 4PJOF 4NHJA 1MMNA 2KIUA 4ME7A 3VUZA 3TP3A 5IT9R 2Z0WA 3TOAA 1XSVA 2NNYA 2VOOA 1OU8A 5D6XA 5DLQE 1UDLA 2KT0A 3CC2Q 1BYMA 4ENMA 4M7AA 1YWPA 3FEOA 3OS5A 4R79A 1SD7A 3QKJA 4JS4A 2ZXJA 3ONQA 3WTUC 3RERA 1G83A 3F3XA 3WVEB 3KZZA 5J39A 3GFLA 3JCMe 4MHGA 1R23A 3CMMA 3LFUA 4A5NA 5GTIC 5KCHA 1WI9A 3OW2P 3F9KA 2O4XA 4ANJA 4QWQA 4BGDA 3GF2A 5GMKj 2STTA 4I98B 1ZSGA 4UVCA 4EEFG 2W82A 3FM3A 4EM2A 2JN6A 5E8IA 2ME0A 3GLLA 1TL8A 1ZA1B 2DQLA 1FXXA 2YLBA 5JHUA 1IN6A 1WJQA 3TSZA 2L0KA 1X2KA 1VYUA 4A3GJ 4XICA 2NOGA 2YU3A 1UCRA 2M45A 1JGSA 2BOLA 3CCQI 1ZG1A 4L18B 1RUWA 2K7AA 5GAMf 3KP2A 5L3DA 2R92J 3PM1A 2P7CB 1QZEA 5ICFA 4C5IA 2KSSA 3I56T 3PGGA 2C0IA 1D09B 5JVTA 2MA3A 5FGMA 3CQZJ 3J7AY 4QLCU 1Z91A 3CJQB 5FU7C 3G71Q 1KC8R 1G2HA 3KP3A 4Z02A 2B7EA 4OB3B 3RNJA 4XM3A 2CSQA 4RCBA 1MKMA 2QAZA 1AWXA 2KT1A 5ILVA 3JAMK 1NYGA 3PIOA 2EV6A 1M1KU 4MTEA 3LQQA 1W7PA 2L01A 4I99C 2EIKH 1X6BA 3BR3A 2JZYA 1AOJA 2BYVE 2MWOA 4HDUA 3IQLA 1K8AC 3E9GA 1VQMI 1JTYA 2A08A 3HEFA 1KYWA 2DFHA 4CICA 2P5VA 4FX4A 1MHNA 3QBYA 3VYGA 1NLPC 1M90U 4A3IJ 1PM3A 2QGUA 1ZYRF 1J75A 4CCLA 1ZHFA 5DUIA 1SEMA 2L8DA 2HQHA 4M7DA 2OTLQ 4EGZA 5D5VB 5FKOA 2FF4A 1HDDC 1RAIB 4ORZA 3KP7A 2OQGA 3C1DA 2WSCE 1VUBA 4C8QD 4F14A 4HNVA 2UV1A 5ERIA 2VASA 2LY9A 3V7RA 4N0AA 4MFEA 3SDBA 3JCMJ 3DTIA 5DEQA 3H35A 4MO7A 4DQ2A 1K7AA 5F0FA 1PNJA 2DL3A 3G6ET 3RI4A 5E17F 2A61A 1AWCA 5EC7A 4F7UB 1G5VA 4PJNA 1ZK8A 2PJRA 2JTFA 2HEQA 5E1ZB 2GOXB 4HZFA 2X51A 2L9VA 2NWMA 3JCUC 1AZGB 4C92E 1VQ7Q 4LLLA 3DCFA 4L9VA 3DEEA 4B48A 4IEJA 4XRSA 2EFWA 2IRFG 4IQJA 1OPKA 2F5VA 2HGCA 4MDWA 5IH2A 1I1SA 5CCAA 1YJWT 1V4RA 5EEGA 2KRSA 3PMIA 2H1KA 2RN7A 3E6MA 3NARA 3S8PA 1S29A 2XC7A 1HKTA 1HD3A 2X9HA 1QVGP 5ICCA 1K9MC 4UY8I 1TWHJ 3SJMA 2O0YA 1GCQA 3CCUI 1UJ8A 3N97A 4ZJZA 1RNLA 4CHUA 2BVLA 1K78B 2R5MA 2V1QA 1R6RA 2J6OA 2MBFA 2R57A 4PL6A 2A28A 2DDBA 2F5FA 3MEWA 2KDOA 2K2MA 2FMYA 3CDIA 3O8VA 3X25B 3IKTA 5J4VA 3DLLA 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 2HKNA 4WXDA 3IRRA 4J9HA 4AG1C 2B63J 4B09A 1P4AA 2K85A 2CFOA 4IHYA 1WX6A 5L3GA 2OV7A 1XPXA 4IUQA 3WGGA 4A5MA 4F7UE 5CVVA 1L0OC 1WVRA 1Y1VJ 4RAFA 1JUSA 3AG3H 1QLYA 3D7SB 5CKBA 1P7JA 4VUBA 4L9NA 3GP8A 4DZPA 2DFEA 2O61A 3ER0A 1IN5A 4E7KA 2J05A 1B34A 3CCLQ 1VZ0A 4RB0A 2K9LA 4LOCA 3SZTA 3CC4Q 1FYKA 1W6XA 2QDLA 2YRDA 1GV5A 1SD4A 5FU6C 3LAJA 4A0YA 4M73A 4RTYA 2MOXA 5KYUA 3BT9A 5FB2A 1K8AR 3S2DJ 5M3FJ 3VS2A 2KZVA 2OZ6A 1UZCA 2F4MB 2DJQA 2PVDB 4EVIA 3X2QH 3WTSC 2CZ7B 2FVUA 3CMAA 2O7OA 1HYOA 4KH0B 1K73R 1ZQ1A 5HK3A 4ZZLA 2R4GA 1BR2A 2MYSA 2E1HA 2QASA 4Y28E 4YEJA 3W6KB 3BFMA 4HX8A 3HSFA 1OCPA 1G3YA 3E5XA 4FHTA 2QEXA 1Z3YA 4IVNA 4BE0A 1AD5A 4RB3C 1S7AA 2NVYJ 4NDLA 2LCCA 4S0HB 2MLKA 2EFNA 3S15J 4M7AE 3RQ4A 2X9DA 1D1CA 2ECBA 4A0XA 3PO2J 2EFOA 1WQWA 2LC4A 4RTXA 2V1RA 5B3SH 1IUFA 2QQAA 2H1LA 1SFKA 3F21A 5KCMA 1Q1VA 3OSFA 2FE3A 2FQ4A 3L09A 5HS9A 2EB7A 5GAN7 2HFHA 3CMEA 3C7JA 5HDKA 5DM7R 1QP3A 1QVFP 2ZAEA 3VSLA 4YIIA 4M71A 3OYYA 1JT6A 2KQWA 2CUDA 2V1UA 1FIAA 1MDMB 4KT0E 1M1KR 1LE8B 3M07A 3VWBA 2G9WA 4BHBA 3N05A 4BQOA 3HP9A 4M75C 2OTJT 3IAS2 1AHJB 4PJOB 1A6IA 4M77A 3AKZA 1N8RR 4XN3A 1WQ2A 1T38A 4IRIA 4B9XA 1Q7YC 2XV4S 4UV9A 4CCOA 1C6VX 2W00A 2A37A 1JT0A 2OD5A 1KONA 1LNWA 1Z05A 1K9AA 1YJ9T 2Z5UA 1OCZH 5GANf 2R5YA 1S6LA 3GTLJ 3BWGA 1Y0NA 2MD5A 3UA7A 3A2KA 2DJIA 1YS7A 2O5RA 2XAFA 4BYYA 2VLAA 1O9SA 3IWZA 3E6CC 1X27A 1R0BG 1WPYA 3DB4A 3HM5A 3CCSQ 2XAHA 1YJWQ 2Y9ZA 1K73U 4CCNA 2L7ZA 2FRWA 4WXCA 3JTGA 3UT1A 1T3LA 1EH7A 5M5WJ 3WU0A 2A5YB 2STWA 1BBZA 2JTMA 5GMKi 1WKMA 2DYBA 5DY9A 2QA4Q 4HVVA 2IAIA 1YTYA 1VQ9I 3W2AA 1I81A 4FM4B 4M75F 3NAUA 5H6QA 3RTRA 1D5VA 2QEXQ 4ITVA 4RUGA 5HLGA 5GAN4 2QQBA 4A63B 4PJMA 5LJ5h 1O3RA 2VXDA 1UUEA 1VYTA 1H641 2MD0A 4DBHA 3X28B 3EG1A 1V5EA 2JUCA 3FMQA 1U5TA 3BPVA 1USTA 4Y4RA 2DA3A 5IPAA 4YFNF 4UUSB 1BBYA 2HDDA 4V19K 2YS9A 4Z89A 5GTHC 1WHUA 3RPQA 2M1BA 2LSOA 3P9IA 1EF4A 1OEBA 1ARKA 4J83A 2KJBA 3CTAA 2PI0A 5GAHJ 1YIJI 3GW2A 2VODA 3GTMJ 4XKBA 5GAN3 2W1OA 4QTRA 1IZ6A 1Q95G 5FROA 2DMUA 3E2UA 2QLZA 1PWTA 4C92A 5LGNA 3J7AF 2DTIA 3DLMA 2LCLA 3HFOA 1AOYA 1C1AA 3FRNA 1FP1D 4CC4B 2TRTA 3G4SI 3GF5A 1X3ZB 4HCCA 2D2WA 2K4JA 3FIFA 1HOMA 1MV3A 2PG4A 3O5ZA 3VDXA 1PRLC 3ZQIA 1VQ8Q 1MGQA 1VQOI 1EJ9A 2CP7A 3S14J 1M1FA 3A8MB 2RM4A 3OY9A 1RKTA 3MP8A 1UMQA 2ZJ2A 1I5OB 3JB9F 1MW7A 3GBQA 7AT1B 1YO5C 2QQ8A 3EHQA 4AFZC 5D6WA 5E3OA 1IW7F 2XRNA 3DPUA 5ICEA 3QHSA 1OX8A 2CREA 2F5DA 4AVZA 4A4HA 2DBMA 3LGLA 3M9QA 4LDXA 4J5YA 3M3YJ 2R7DA 3X20B 5D8KB 4ESFA 3LNQA 1ZUKA 2BY2A 1MMSA 1R58A 2KRMA 2YWWA 3EGDA 2MH9A 3EFRA 2Y31A 3GBGA 1NG2A 3M4YA 3WU2C 5A2QR 3OA6A 3CF5F 4AFUC 3CUQB 1K9MR 1GL5A 3QWLA 3WTXC 2XF7A 4JUVA 3GCMA 3GX4X 5LHGA 1LKXA 3I58A 3JRGA 4IF4A 2BY1A 2GA1A 4KITB 3CC2T 1O7LA 3K69A 1ZKGA 2DA4A 1IV6A 1RAEB 3KCCA 1RLQC 2FRYA 5LGTA 1TC3C 3K0LA 4S05A 1EIFA 1PD1A 1M3AA 1X58A 2DW4A 1YN8A 2COWA 2RD1A 5CR2A 1V55H 2DU9A 4G6QA 4DNCA 1OU9A 2DEUA 2JVHA 1K6OA 5LHHA 3G1LA 1OFCX 2JVVA 4D6WA 2OBPA 4B47A 2O88A 2ZFUA 1R5GA 1DQUA 2XIGA 2L54A 3TL4X 1Y57A 2DOFA 2OUMA 5CVJA 3MEXA 1VQLI 1MNDA 2L3DA 4LB6B 3MN2A 2DXCA 4YELA 2V8KA 2JMCA 1SSFA 4BH9A 3S1QJ 4M9XA 4BAYA 2L9NA 4RGXA 4RGSA 3A01A 2XK0A 5KYUB 3CC4T 1YI2A 3OOUA 3QYGB 3DQVC 2L3SA 3G1OA 2WY8Q 2JPBA 3W3CA 1P7IA 2DXUA 5DDGA 1LDKB 1FSEA 4MEYF 4E7IA 4PGHA 1FJLA 2D1XA 5GAOm 5KYNA 4HSTA 1NEBA 4C92F 1T8IA 4OVAA 3C95A 3EUHC 2VKVA 3BTCA 4RM2A 3VYTB 4OB0B 2FD5A 4CXFA 4PLLA 2HYGD 3ZN1A 4XIDA 4HQMA 5C4XJ 5KAFC 1YOVB 1WHLA 4JOMA 5GANd 2DI3A 1YJNT 2HQXA 1ZG3A 2K5IA 2H3JA 2EFQA 1WJAA 3A03A 3QYFA 1KYZA 5IP6A 3FX3A 1W36C 2WV1A 2CH4A 3IKVA 4KYWA 2IBDA 2IS2A 2DL8A 3RMSA 3VS7A 1K4US 3DKYA 3B73A 4LDYA 3CCEQ 3LOCA 4IKFA 3VS3A 4LN2A 1WJRA 1FWZA 2QKLB 1NTCA 4GXOA 5GAOq 3F8MA 4XLNF 5F08A 1I50J 1KGSA 3P8BB 3JRCA 1NJIU 4A4KA 3CCYA 5HLIA 2CP2A 5GAMg 2W84A 1VQ7T 2ACJA 2XG8D 3A5ZB 4O3MA 3WODF 5CQYA 2HVQA 2HDAA 1K4TA 5IOYA 1SEUA 3U21A 2VUMJ 1CKAA 5FU7B 4V2SA 1B07A 3CLOA 2FQ3A 3FXOA 2IVWA 3QJYA 1OCTC 1QPIA 4JLGA 3F8NA 4M77G 3VS1A 2HOTA 3W2VA 1JHFA 2AO9A 2QQSA 2HYFA 3SQNA 4G6TB 5IT9E 2M35A 4P1WA 3TVTA 1R8OB 3BROA 4F17A 3HL2A 4Q47A 1PYVA 2EFPA 4W1UA 3ERED 1WSUA 1LJOA 3FHNA 4HG2A 1ETKA 2F5CA 1WHHA 1C0MA 4CRIA 3FBIB 3PNTA 3C3WA 4ZYAA 2RNGA 2CSIA 2L2PA 3CCEI 3LYIA 4N0AC 4RG2A 5GMKe 2ZKZA 3SFIA 2Z9OA 3I59A 2F5TX 2CUEA 5IXFA 3K1PA 4J6XA 5F0HA 3JAME 2PBIA 2FPDA 2X1DA 4WCIA 2HYJA 2EAYA 3JCMg 4KH1B 2E5QA 5FWBA 2E1MB 2HOSA 4NC8A 4XU1A 5CKEA 3IWFA 4ZDPA 1WHMA 1U9NA 1KK7A 5B66C 2XPUA 1U6GA 1VNDA 2YUPA 3SEMA 1WZ2A 4K2EA 3K9TA 3S93A 1OJLA 3DV8A 3UR3C 3CCVI 1AKHB 2DPDA 1K1ZA 1R77A 2LMJA 4IRHA 3KYDB 4Q4ZF 2DM1A 2RO0A 5CKHA 3VYHB 5FRMA 3FK6A 1WCMJ 2KPMA 1DDNA 1HXDA 2LQKA 4B43A 1WI7A 2OAWA 1X1BA 4LNPA 4OB2B 4MLOA 2AXTC 1ZA2B 1XDUA 2CZ1B 5I11A 3LH5A 4RKUE 2KKOA 4M74A 2VB6A 2V9KA 3HOXJ 2Y69H 3DTEA 2ZNYA 2EWNA 3QXEB 3JB9D 1QVGA 2E19A 1RKWA 4KMFA 2OTJQ 2KZGA 4C2MJ 3G71A 1YW9A 4EMKA 3LA2A 5FLVA 3HPWA 1QZZA 2JA7J 5E79C 2CP6A 3D0SA 2VVKA 5GAMh 1M90R 2RQPA 3LSGA 2KDZA 1M2VB 1SVLA 2LZ6B 1HDPA 5C4JJ 2CDTA 3F70A 3F22A 2KROA 3UKGA 2WADA 1WJDA 1N9SA 2KK4A 2RNJA 4XTZA 3P9CA 2ELJA 4M3FA 4RAZA 3VYUB 4OMOA 3M8JA 4QVZA 4XLAA 4QT7A 4UC4A 3WE3A 4OMFB 3S3NA 1JBMA 2VKDA 4HX4A 1TW3A 4ELYC 1Q86U 4C0GA 4KT6A 2B9SA 4LG3A 1ABQA 2Z1DA 3H1CA 5ILSA 5EG2A 5D5WB 2K27A 3JCMb 1HW1A 2LK2A 1OV3A 1TU0B 5DV5A 2MVTA 2LQ8A 2NVQJ 2VXZA 2WV0A 1LVKA 4AMCA 1H0MA 2OPTA 3QPLA 1QHGA 1F5TA 2EPFA 4J9FA 4TVRA 4M9ZA 1F36A 5A2QK 3V7SA 2E1MC 4RG8A 2XKOA 1RI0A 4ZTJA 2Z33A 2DNUA 3W6VA 2LLKA 4AUXA 2KVQG 3BE3A 3H92A 4RGRA 4PJLA 3EHRA 3CQTA 2RN8A 3OYFA 4CC2A 5D6YA 1S72I 2LVSA 1Z6RA 1I1GA 3CO6C 5KYXA 4R8HA 4CH7A 5D5UB 5IT3A 2E12A 3RESA 1BI1A 1W0UA 1TTHB 2RF0A 2Y2ZA 4PKCC 4BI8B 4M75E 4BE1A 4EMHA 1BR1A 4C8QB 2CQ7A 3VODA 1N75A 1KU3A 2EZKA 1RAFB 3CC7A 3HHTB 1CGPA 1PVEA 3I35A 2XHKA 1YJ9I 1MNMC 1ZRDA 1YW8A 4HA8A 1TH7A 1ZLMA 2PJPA 2DE0X 2NVXJ 2MI6A 4IUTA 2OTLT 1V3FA 2IT0A 4ENJA 1K61A 3CCLI 2H6BA 3FXMA 3EG2A 2OJ2A 4M78D 1N77A 2QVOA 5D4RA 2AS5F 3GZNB 1M2OA 2Y4XA 5EJCA 5E3LA 3FJ5A 3H41A 2EINH 2KY9A 3GOXA 4XRSG 2PEXA 3PIOF 3CCJI 1MIJA 1Y0UA 3BR6A 2ZJPF 4M3GA 4J9EA 2K5LA 4X6AJ 2E2IJ 1I6HJ 1YIJQ 3OR1C 1VQ9T 3KLOA 1VQNA 2C0OA 2E3IA 2ED1A 2OTLA 4E4HA 3JB9H 3KIOA 1UG1A 2IGNA 4MQVA 1ZGWA 3EH1A 3GNFB 3V7CA 4WXHA 3VYSB 2DODA 1MMDA 1LFUP 2YX4A 2HTSA 3AHUA 2CS7A 4RB2C 2ZCFB 3QUIA 3FB9A 3CC7Q 3GLXA 3ECHA 1YJNA 1MBGA 4WF2A 1Z9QA 2X6WA 4ZNXA 5GAN5 2ENMA 2ISYA 1IREB 2BBYA 1F43A 1QNTA 3PSIA 2LKSA 3A01B 1ERDA 2VKNA 2LTPA 3R0JA 2AKLA 1ZLKA 3I5RA 3QWXX 4XQ3A 3CP2A 5LJ3f 2E71A 3LSPA 2V8IA 1RRJA 2CQNA 2HXOA 2FPFA 2QKMB 1KQSS 1Q86C 1HC8A 1QWEA 4XSXF 5KNLA 4RTTA 2BHYA 2KRFA 3SDZA 5KE2A 1H8AC 1M30A 1H88C 1TNTA 1UGPB 4X1EA 2E5NA 3V8LA 1E3OC 4M9SA 5EZHA 3KYCB 1PD0A 1MJ9A 2LVMA 4J7IA 1WJSA 1WH5A 2YU9J 2R7OA 3DFGA 2K3YA 5C0MA 4DGWB 1T0FA 1X1PA 3RKXA 3CC4A 3HYIA 2UZKA 4WWCA 3GNGA 2CQQA 3G71T 4M6VA 1Y7XA 4ZGDB 2EZLA 3NQOA 2K2VA 1JKQC 3B6AA 3H0GJ 1FX7A 4QPOA 4NS5A 3QYHB 4B1RA 3L9FA 3UPUA 2IGKA 3CZ6A 2K4YA 4U7DA 3EYIA 2NUZA 5K7HA 1U8RA 3ABUA 1JUMA 4RAGA 4K11A 4CCJA 5GMKl 4GO1A 1S8NA 1IDYA 2WBMA 3FK7A 1J7KA 2P8TA 3HTSB 4MZPA 4ON0A 1TQPA 2NVTJ 1YFHA 2AZVA 3L2ZA 3DB3A 4JZ4A 1JRIA 2GIZA 4E7HA 3VSKA 3L2RA 2JT1A 1D5YA 1RESA 3N4MA 1STZA 3K1MA 3FXQA 2CU7A 4C92C 2SEMA 3W6JB 1MJBA 1X4OA 2GA2A 2VT2A 3V8JA 1VQKI 2D8HA 2EQJA 1LPQA 4HVUA 1QWFA 2X0LA 2ZXIA 3SWNA 2MPXC 2VGNA 4I0AA 2DMQA 3OIPA 2ZO4A 1QPMA 1UJ0A 4XLHA 3L2CA 1YRNB 2F2WA 2K3XA 3CMEQ 1IF1A 1JJ2A 3EPZA 2F1LA 1MJAA 4EJVA 1FMKA 1LCKA 1TBXA 4FIBA 2XDBA 3OV8A 4LK0F 2WSFE 5DYMA 4A6EA 2RDPA 1D3BA 1X2MA 2Z99A 1KHCA 3OB9A 3GIBA 4A3BJ 3ML6A 1WJ5A 2R0QC 1A04A 1Y0MA 1EA3A 4RTZA 2EV5A 1M5Q1 3PIPF 2R5ZA 2Q1ZB 5F6FA 2CFXA 2FBKA 3ZPLA 4KUIA 2XGXA 1UB4A 2FU4A 2A0FB 2RPNA 4GY5A 2K9GA 4CUGA 4N4NB 1PKTA 3CBMA 2OTJA 3FBNB 2DLLA 5GANj 1PDNC 2MC4A 1VQ7A 2EJRA 1R4MB 1E17A 2CSOA 2HNIA 3PNVA 2JT4A 2HKXA 4NC6A 4OIRF 1P4XA 2X4YA 4ESRA 3VJPA 1RPWA 2QK0A 5FWCA 3U1DA 2VYTA 1VQ8T 2CH4W 3HZJA 1TW2A 3CMET 2AT1B 2H09A 4A6DA 3EUAA 2E70A 1VQ4Q 4KGZB 4M77E 3OS2A 2E6NA 2DMPA 4OMNA 5ED4A 2VQLA 3LSMA 1MH4A 3P5JA 1Y56A 3T5XA 5HDNA 5JLWA 1QKWA 1WFWA 3RPUA 1X43A 1JGGA 2QA4I 1OX9A 3J7AW 4DBFA 2KJCA 1D1BA 3LSHA 5J8CA 4DIQA 3L2QA 1UHMA 2R7ZJ 4MMLA 3FJPA 3RMQA 1G59A 1VQNT 2Y90A 3IP4B 1W36D 2IIMA 3JCMP 1QVGS 1V76A 3CCSI 3QAHA 1PUEE 1FOKA 3CUOA 3DBLB 3GUDA 1W5SA 2BY0A 4JK1X 4ZZDA 3CXCP 3HSBA 2V9VA 3E6DA 4CYCA 4BDZA 1QVPA 1F1BB 3H0HA 2EGEA 3C12A 1ZGAA 4XSZF 3LA7A 3BCAA 4A12A 2HKQB 1U8BA 2R7VA 1YJWA 3C2BA 2PVOB 2COZA 2JS0A 3L2VA 2HPIA 4N4HA 1IN7A 2HXIA 1G8XA 1SVMA 2CH0A 2LY1A 1SC7A 1A35A 2DRKA 2LC2A 4ZTFA 1SG5A 3H36A 3WG9A 1EH8A 1QCNA 3VPRA 2OTLI 1KQ2A 4LD6A 1QCFA 5FW9A 2XAUA 3CC7T 2A69F 3MKDA 2IEKA 5K7FA 1TUCA 1MBEA 3SEZA 4ZDLA 2V26A 3P9KA 3BJAA 3OS1A 1Q82R 2YPRA 3G1MA 3DEUA 2R5YB 4PUSA 3H3ZA 4XQFA 2I10A 2IA0A 3HSRA 2IGOA 1UELB 2KNBB 1OISA 4N4GA 2PN6A 1WFXA 2NYSA 2DL5A 2WACA 3CMYA 3G6EI 3LAPA 1RC9A 1WNLA 4FETA 2RK2A 2Y0SN 3BR5A 1WXUA 2DMOA 4EMKB 5GAOp 4ZN3A 2W0ZA 2XDPA 2RI2A 2Y4YA 4EJOA 1LNXA 1Z77A 3VV0A 1RR7A 1NBEB 3CCET 2RKHA 1FC3A 2A7YA 3JAMR 5LJ5g 1S3JA 5JI6A 1GT0C 1I6XA 5KE3A 4KJZA 4H0EA 2WC2A 1U1TA 1Y39A 1HK9A 5J1YA 5CIUA 1LE8A 5I2SA 2LP0A 2NUPA 5ECAA 2EZHA 1K8AU 4OP0A 2K9SA 4F93B 3OYIA 4RLQA 2H27A 2ZNZA 1RUOA 5GAOr 2DXBA 4XLCA 2ETHA 1MMGA 5LGUA 3SD4A 2DK5A 2JK3A 2JOYA 4M75A 1DJ7B 4ZYGA 1Z67A 1U5TB 5A0LA 3GTKJ 4M7AB 4ATOA 1DP7P 1FTZA 3HTRA 4XRMA 2F69A 2R5AA 3BY7A 4PJOD 1OR7A 2ZC2A 4B8XA 2DRMA 2XAQA 2KIMA 1BL0A 2IA2A 3E97A 2X48A 3OL4A 2ROLA 3CUQA 5K5RA 4OMPA 1IZ1A 8ATCB 1WA7A 4A4FA 1MBHA 4FX0A 5E1XA 1YITA 1B3QA 4QQGA 3C2HA 1XGMA 2K3BA 1GVJA 2VQCA 1YCSB 2IJLA 5AIPA 2ZBKA 5CQXA 3R60A 3A1YA 2ZB9A 3HDDA 4F55A 3CDLA 4MQ9F 4PNOA 5E20A 4I01A 1Q7YR 2W57A 1AA7A 4O6JA 2FZGB 4QVCA 2MABA 1NG7A 1JU5C 1S1NA 2VJJA 2EGCA 3COAC 2YT6A 4M77F 3A0HC 3K7AJ 3H5AA 2VONA 1IRFA 3NWTA 1YITI 5IT9K 1ACIA 1ZHIA 1FOWA 1OR7C 1ULYA 1MBFA 2KE9A 2XU8A 3ABTA 2DTRA 2W4SA 4GYIA 4IPAA 5EZGA 5LRSA 2PTKA 2AQEA 2HDCA 2LMDA 4ESBA 1ZRCA 3E1SA 1E6GA 2QSGX 4OIOF 1O75A 2LNHB 5CJ9A 2FHDA 5D7UA 3I55Q 1UG0A 5DCMB 2UXXA 2MGQA 4QKUA 2NNNA 3H3VK 3NFCA 4XK4A 2FRHA 2RGVA 3RKYA 1WHKA 1XOVA 2P6TA 3NGPA 3HKSA 3CC2A 5BOXA 1W7PB 4O5VA 1HKQA 3SFZA 4ZYEA 3JCMQ 5DM7F 2DXTA 3I56A 4LLGF 1SAUA 1YNZA 1K78A 3EFOB 2R7RA 4Y52J 4P5OA 3BLYA 4HF0A 2VN2A 2JSPA 4BXXJ 2KT8A 2RQTA 4B6MA 4R1HA 3MKLA 4C8QG 2XDDA 3BZ6A 3SEQA 2LFBA 2YX7A 1I0CA 3FHZA 1QGPA 5K1YA 3M0PA 3CCMI 3H9QA 3UNGC 1OKRA 4AIHA 1IJWC 2EK5A 1M3CA 2PX9A 3PO3J 1R00A 2W7NA 5JHFA 5FRNA 2KEAA 2P4TA 1BC7C 2VC1A 1GRIA 1AWOA 3VU3C 3WHCA 3IAM2 2LJ0A 2J5OA 2QF7A 4Y33A 5FLXK 4KICA 1BIAA 2E2HJ 1CKBA 1BIBA 2CZ6B 4KGXB 1YI2Q 3HOZJ 2EA4A 3BG6A 3I9V2 5HY6A 3G6EA 5FKMA 1FT9A 3PNYA 2LRDA 1U5SA 2M02A 3U2RA 5CAIA 3WHBA 1QCOA 2X3WD 4JRKA 2M1HA 2RI3A 1G3WA 3LGFA 4BY7J 2L5QA 5FU6B 2VJ4A 1U0JA 4FQGA 3CPFA 3K10A 4C8QA 3ZMZA 1FBQA 3K4NA 3ZOBA 4OB1B 1FEXA 3ABLH 4D0PA 3EGXB 4JZ3A 4HNTA 4A4GA 2MW8A 3M0UA 5LJ3g 5C3EJ 4RDUA 3QPSA 3A52A 4U0WA 2EYXA 5I22A 4QQ6A 3DLLF 3MKWB 3HGGA 2QBYA 2NUTB 3CCQQ 4AYBN 4IOAF 4XKCA 3LWIA 3EG0A 2DMNA 1KQ0A 1ZX6A 1WGSA 3VS6A 5J6XA 2X4XA 1SPKA 5FO5A 4YTLA 5DD8A 1R22A 2VBWA 3O8GA 4BXFA 2ABLA 3CCQT 3FZVA 1I5ZA 1JKPC 2ZMEA 5J3LA 1Y71A 2ECZA 2IP2A 2QEXT 4LDUA 3FLGA 2V6CA 2J7IA 4JDSA 3QU6A 4C3JJ 2VPLA 1XTAA 2HSPA 2CQXA 2X35A 1LFPA 1P92A 3RUXA 3L42A 3ULQB 2MSYA 3JB9I 2O9LA 3J7YJ 1HCRA 3FXUA 2NOJB 2RNAA 3PFSA 2I2LA 4MDXA 5LJ3j 1T6SA 3AG1H 3H5NA 3CD6T 2YDLA 1K76A 4Y17A 3VS4A 2RC4A 4JJCA 1WPKA 4M3EA 4CCMA 1JJ6C 1F1ZA 1SFEA 2BW3B 5ICGA 1MMAA 3JCMc 1D8KA 2QSFX 1PHTA 5GANe 1OQKA 3K4CA 4WTOB 3LSIA 2OTJI 4N4IA 2GZWA 1YI2T 1TWFJ 4JLIA 2DMTA 5CVRA 1GBQA 1EV7A 3ZQGA 4IURA 2YUQA 2CW8A 3BJOA 2FPEA 1KD1C 4QQDA 2HQ5A 4M7DF 2M0YA 5IYCJ 1GFCA 2LQNA 1AHDP 3K70D 1FBSA 2BXYA 3HOWJ 2ADUA 3B02A 5FLXZ 3LW5E 1NPRA 3R6SA 3RDVA 3HRMA 5J47A 2IVMA 4DYRA 1FMVA 1RUNA 1TG0A 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 4DEXA 2C06A 4BDYA 4II1A 1WXBA 4A54A 1W4MA 3FXLA 3JTHA 4LG0B 5IHKA 2WAFA 5IP7J 3LL7A 1WHJA 1NG6A 2XMFA 1VQ4A 4BQQA 3IH4A 4Y7NJ 4PFOA 1VQ5T 3EYYA 1X19A 4Y15A 4CYCB 1OQYA 2D45A 1T2KA 2DVEA 2PUOB 3G7ZA 5M9OA 2DETA 3O2PE 1B7TA 2P0WA 2EKHA 1KC8C 1XSDA 2DT5A 2CV1A 2B0LA 3I55T 1I39A 2RB6A 5HLHA 1OYIA 4M75G 2KP6A 2GOMA 4U87A 5E8GA 3DU6A 4XTWA 4UXNA 4XKVA 4M77B 5KYWA 2VGMA 2VBYA 2F2VA 1TWGJ 3J7AO 1SMTA 3IH2A 1DPUA 2DBBA 3F8CA 3T8RA 3VUBA 2DXIA 2ATCB 2LG4A 4OINF 2V4JC 4EJWA 2ROTA 3PTAA 2OU2A 4LJZF 4HLYA 2KI7A 3Q0WA 4B3XA 4OMQA 4PJOC 4C3HJ 1R5HA 4XL9A 3KEYA 4FW2A 3SFMA 3DF8A 3OYHA 4ENNA 1UTIA 2CP0A 1O4XA 5TJJA 4RTWA 1BKBA 2EJ9A 3J80K 3M9AA 1ZGJA 1VQMT 3BOQA 4OMZA 4QVDA 2CP3A 3VOEA 2RQRA 2BV6A 3OSGA 4XTUA 3H9NA 4ENKA 5TGTA 3J81R 1YWOA 2EILH 3CC4I 1QQIA 1H9TA 1I1JA 4C5EA 1IGQA 3TEEA 2O8KA 2DDAA 4F7UG 5LFAA 4M7AF 4QIWN 4M78C 3ZR8X 2PFBA 2VL8A 3REAB 2X4HA 4RCCA 4M3BA 3K4MA 2X6YA 3WTYC 1DGRM 1TWCJ 1XCBA 4U0VA 5GAN2 4PJOA 1WZOA 5KYYA 1XGNA 1M1KC 5BPDA 2W48A 2JA8J 2F5EA 2HVRA 4XU0A 3KFWX 4BL0B 2H8WA 4X0GA 2ZPBB 5CVUA 4YRVA 3CPWS 1GLNA 4XKWA 4IJAA 2QGGA 4J9IA 2NS7A 2D1VA 4BUPA 4YFKF 3A8GB 4ZGJB 2BE5F 2DA2A 3Q3SA 4ELZC 4I0BA 5B5EC 1LDJA 2ZSHB 2J06A 1ETYA 4HF2A 3ZXSA 2F4IA 3LSKA 1Q1HA 3GPLA 2LT4A 4QW2A 2PLYA 2XAGA 1VQOQ 4J19A 1IG7A 2DPPB 3Q1JA 4XN0A 2EQKA 3S1RJ 3JCMf 1VQNI 2FZKB 3TKYA 3I9QA 5HS8A 3CXCS 1XQHA 4FYVB 2K86A 3K4JA 2AIRB 1TTYA 4A69C 2JM8A 1X69A 1RETA 3BTLA 4RMNA 2NRAC 3J80E 5FJ8J 1U78A 1UHCA 5F1RA 4NB5A 2DT7B 4JP0A 2LJ3A 2YSQA 3G6EQ 5IY5H 1MD0A 3P8HA 2WAEA 3MEUA 1YS6A 3B6CA 3EUKL 4RGUA 1VQ6I 3RZOJ 2EYQA 3O6BB 3CCLA 5KHDA 2ZXWH 4BBRJ 4EJTA 2HOAA 9ANTA 1SF9A 3CPWA 5HNFA 3K6GA 2R93J 2FSWA 3OYLA 3CCRT 1YJ9A 3FMRA 4DOZA 3OMGA 2A6EF 4JQFA 5KK1A 1H89C 3TW6A 3ULRB 4OGCA 2R7QA 2CJJA 1WQ7A 1RL2A 2HL5C 3KBGA 2CGPA 1JB0E 3GTPJ 1HSTA 1VI0A 2RQVA 3HTUA 5GP9A 1R9TJ 3QOEA 2ID6A 4PCQA 2M0CA 5A2QZ 5K5OA 3PVLA 5GPAA 2X4WA 4HCZA 3ME9A 2C0TA 1S72A 2Y48A 2D6FA 4J6YA 1TP4A 1YX3A 1VQNQ 2E65A 4ABZA 2E64A 4HRIA 3ZQLA 3QU3A 2M9UA 3LA3A 3EFOA 4FE4A 1UE9A 3C4SA 4XR6A 1VQ6A 5J8FA 1X6GA 2GFAA 1T33A 2OZUA 2O01E 3C2GA 3X26B 1VQ9Q 1W7PD 5DUKA 1IAWA 1DU0A 2ESNA 4UB8C 5FKNA 1TZLA 3BG9A 5HS7A 5LJ3e 3VEPA 4V2FA 2BVMA 1Z1DA 4AIDA 2R3SA 3D1NI 4OU0A 1IRGA 3I56Q 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 1AVZC 4BHPA 3A8HB 1U2WA 3TU4K 3EG9A 2JA5J 2M8GX 4JX4A 3E5UA 2VOPA 2GBYA 1KIKA 4D8KA 2LDUA 4IHWA 2OI3A 1OPCA 4LMYA 1IO6A 3DPLC 1ETOA 1GCPA 5J26A 1ON2A 5LJ5f 2JWTA 2JXBA 1G2BA 4FT4A 1SAXA 4X1VA 2J5PA 4XTYA 1LEBA 3BG3A 2RA2A 4IO9F 2M34A 3CMAT 5H2FC 1IGNA 3OIOA 2O8XA 2HQNA 2V1XA 3BTIA 2NVUB 2XI9A 2DYIA 2PVGB 3HKZA 4C92B 1FP2A 2MWPA 2AHQA 2I5UA 3JRBA 1JXOA 3HXLA 1JE8A 1NEGA 3M0QA 4G6DA 3MWMA 3F8BA 5D6FA 2EJGA 2M0OA 1XGOA 2JZ2A 3JAMZ 2OQRA 2ZPIB 3HGYA 2M16A 4DW6A 3BDLA 4MZTA 3SWNB 4AFSC 5L23A 3G4ST 4KUDK 1NK3P 3TQ7P 4M7DB 3QO3A 2BY3A 2LR8A 4E7SA 5TRDA 4BQAA 1FMWA 4C8QC 2JNGA 3PUBA 4A3LJ 4Z8AA 4M78F 2PJRB 2FOWA 1D0ZA 2QENA 4PFPA 1O57A 2XKPA 3ZGKA 1WWXA 1YLFA 2A6HF 2KBTA 1FYLA 3PUFA 1VFCA 3UDCA 3GO5A 3I4PA 1RADB 3CCMQ 3JRZA 3FKJA 3RZDJ 2ED0A 2RREA 2E10A 4EIKA 3MD2A 5CK9A 2E3HA 3J81E 2CUZA 3CCVA 2BUDA 3OMYA 1LJ9A 4XNFA 1KZHA 5BS6A 1SRLA 4HSRA 2CUBA 4HXJA 3ZL7C 4E7ZA 2XRLA 3HRSA 2DZCA 5HDGA 1UAAA 3SXYA 4BEHB 3J81Z 3J80Z 1XGSA 2GAUA 5L3EA 4OF1A 3KYLA 4DOWA 4EM0B 2K79A 2ZPEB 3E9FA 2XIDA 2C6YA 4J9BA 4IOCF 2MC3A 2UXNA 5BQTA 2FNAA 3KZYA 4BU2A 2GWRA 5F0CA 3IHUA 5M3MJ 2RHZA 3JCMW 3KLNA 2JMWA 4G7ZF 4PJOE 1VQ4I 2FB7A 2CWEA 2JJ7A 4P96A 2EGAA 3RDIA 4FT2A 2M8EA 3F0CA 2O3FA 3SHWA 4BY6B 5EYRA 3LWHA 1NZ9A 2GQVA 3F23A 4C2UA 3N5BB 4PLIA 2QI2A 2L9RA 4E7JA 4D7MA 1PKSA 1YHQQ 4C5GA 1GHCA 2COBA 1N78A 1B8IB 1SHGA 1BI3A 1XMAA 4IRGA 1N25A 3J7ZI 1LEAA 1PRMC 2YUOA 4XTVA 2LY2A 1K4SA 3DBHB 4LD9K 1K83J 2DA5A 1NYFA 4J9DA 2BE9B 3FWEA 1ZRFA 3CXCA 2M87A 2JM9A 1LFBA 2HKOA 3AFHA 5H20A 4D9JA 1N8RC 4KBMB 1NK2P 3HC7A 3DPTA 2K5CA 3KX2A 2EA2A 2D0NA 2FZCB 3HPHA 1VF9A 1YP5A 1QU3A 1PCXA 2DJZA 3ZQQA 3OYNA 2E1NA 3SYTA 2G6FX 3R61A 2QBYB 4FU6A 2NUTA 2E36A 2P84A 1WRJA 1X01A 2HNHA 1VQPQ 3S32A 2VC8A 1R1TA 3M8EA 1PJRA 2LF8A 1AWJA 2JA2A 3FF5A 3UATA 4HYEA 3OYAA 4M77D 1QZYA 1QRYA 3TDUC 2LX7A 2DOAA 2HU9A 2E35A 2GQQA 2Q2EB 2A3LA 2IXSA 4A0ZA 4F91B 3PMTA 3OL3A 1PSFA 2FYKA 3EG3A 5LJ5j 4JRPA 2QYOA 1U9OA 1XMKA 1KD1U 2KFDA 4Z88A 4PFZA 2V6EA 4KGVB 4IHTA 5HKCA 1XSXA 3WTVC 4AC0A 4M78B 1AEYA 3KZIC 3ZN0A 5C44J 1IRZA 1V54H 4EMKC 2YUSA 1T56A 2DCEA 4NL2A 5DLOA 4OMLA 2FX0A 1AU7A 1RLPC 3HIFA 3EDPA 3M55A 4LXCA 4GLMA 2OAZA 1PUFB 3PQKA 1AKHA 1RI7A 4E47A 5GAOl 4HKEA 2QTXA 2KHMA 1YI2I 3KXTA 4LDWA 2O9SA 4KN4X 4IHVA 3KUFA 1G3TA 3FDRA 1JJ2S 1K0XA 1XMXA 2DJNA 3SDGA 2ESWA 4IIMA 1VQLA 3KEOA 3WGHA 5M5YJ 4W97A 2Y0SA 3CJRB 4HQEA 2DL4A 5GAOn 3GVAA 1W0TA 2HAXA 2R7TA 4KDPA 3ZQ7A 1OZ3A 2F4OB 3BCBA 3FISA 4KN7X 2RJEA 3NWSA 1WJBA 4L0YB 1ETXA 3ABMH 3KP6A 1FZPB 4LE9A 3M58A 4H4KC 4QSHA 4F7ZA 4IHXA 2IGMA
chains in the Genus database with same CATH topology
4BNCA 3CCMA 2RV8A 3CCJT 3ISPA 4C0ZA 1Y96A 2RHUA 5LJ5e 2X4JA 5D8LB 3WGIA 1GXQA 4M7DE 4MZMA 5CO7A 2G3RA 3KP5A 4KIGA 4C0FA 4Y91A 3F8FA 4CYDA 3FXRA 4HAMA 1ZH5A 1R36A 4WCGA 3S3MA 1XD7A 2GF7A 2F5KA 2VC0A 1N6AA 1ZARA 1VQOA 3GEZA 1ZG5A 2QQ9A 3HL8A 4BXUA 3TOBA 1ODDA