1FX7A

Crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRON-DEPENDENT REPRESSOR IDER
publication title Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1fx7A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1fx7A03
5JVTA 5HDKA 3JTGA 2D45A 2V1UA 3V7RA 4A2UA 2DQLA 1ZRFA 2P5VA 3MZHA 2XKOA 1BC8C 3IRRA 3JAMK 2XROA 2WV0A 2IA2A 1GVJA 4L9TA 3QPHA 3IKVA 4M6YA 1WKMA 1ON2A 3QU3A 5AIQA 4UV8A 4L5IA 1F9NA 4HW0A 1IN6A 1QO0D 2HQRA 1BI1A 5ICCA 4BYYA 1U3EM 2Z99A 2LF8A 2X0LA 4S04A 1T2KA 1QBJA 2HWVA 1HXDA 5L3EA 4WCGA 3O6BB 1KQ0A 2R7DA 3SXYA 2QYOA 1EH6A 3TDZC 1R1VA 2O8XA 5FD6A 2VBYA 3FM5A 3KP6A 4PGGA 2BE5F 1R7JA 2D1HA 2WWYA 3G73A 2EFPA 5ED4A 3TOAA 1Z1DA 5FLXK 4P9UA 3N4MA 4KT5C 1Z9CA 5LBQA 5D4SA 4LG0A 2PG4A 3E6CC 1F1ZA 2GA1A 4G94A 4YIFA 1R58A 4AIJA 3I71A 2K5LA 2R3SA 5D8LB 1HQCA 2XGXA 3MZYA 5E8GA 2MBFA 2UWMA 2L4MA 4NB5A 2E1NA 2L4AA 4OIOF 3TO6A 5CLSA 1OMIA 3V8LA 2KJCA 1UB9A 2OD5A 1L3LA 3ROUA 3ZMTA 2VONA 4YFKF 4PGHA 2A68F 2F2EA 2GQQA 4YIIA 2EK5A 2VOPA 2KIMA 3LFKA 3HHGA 1R1UA 1FBQA 1XGOA 4U7BA 4ENMA 3J81K 4IXAA 4IHTA 3ZMVA 2QBYA 4M9XA 4I98B 1Z6RA 2F5CA 3GEZA 1B4AA 1QZYA 2FOKA 3T0YA 3RKXA 1RUNA 2IP2A 3IKTA 3S2WA 3GWZA 3C3WA 3K1PA 3DFGA 1KYZA 3ZN1A 3GFJA 3SFZA 2HYGD 1WSUA 1SAXA 2FNPA 3GLXA 1ZYRF 3HSRA 4O3MA 4UNOA 4WXDA 3J7AO 3VEPA 2O3FA 2GCXA 2E7WA 1B9MA 3BJAA 3IRQA 3RYPA 4HX7A 1P4AA 1IF1A 1USTA 5HS9A 3WTXC 2DK5A 1IXCA 3QP5A 5IT3A 5BS6A 1X3UA 2Y75A 1W4MA 4YFXF 1R23A 4ESJA 2CG4A 1P4XA 1B1BA 4P96A 4A6DA 3DKWA 3R61A 2FQ3A 2A6EF 5L3CA 2XAFA 4IVNA 3F8FA 1XD7A 1LQ1A 2QWWA 4HBLA 1B9NA 4LK0F 3K69A 4LK1F 3WE3A 4EGYA 1HW1A 3DEUA 2A61A 5HLIA 1SD7A 2ZBKA 2FMLA 2RGVA 3H3ZA 2FNAA 1KU7A 2K5FA 1YW9A 2O0YA 1B6AA 1OYIA 3GF2A 1D8JA 2JSCA 3LA2A 2DQRA 2ZO4A 1LNWA 3BOQA 2L02A 5J8CA 1SD6A 1LJ9A 2IA0A 1SD4A 4KMFA 3I5UA 4JK1X 1IRFA 2JT1A 1KU3A 1ZGJA 4A0YA 4A0ZA 4ZZDA 2H27A 2LKPA 2KIUA 2Z3YA 1BOAA 3R60A 2A3SA 3ZMSA 2D1VA 2EV0A 5EEGA 1JHFA 2YR2A 2LDUA 2HDCA 4AIHA 1KU2A 1YQAA 3HTSB 2LF7A 4Z2YA 2F5FA 5FFXA 5FFZA 1IN8A 2YSRA 1W7PA 3HOTA 3DPLC 2FRHA 2ADUA 4OIRF 4CXFA 1Z6TA 5LGUA 3WE2A 2PMUA 2VC1A 1STZA 4RGXA 2IPQX 4R8HA 5EEHA 2NYXA 1J9IA 4LMYA 4KICA 1IAWA 4B09A 4MEXF 3BJOA 1H0MA 1TBXA 4LLGF 5L3GA 1ODDA 1SMYF 2O03A 3F6VA 5HLHA 2Q0OA 3FMQA 4RB3C 3J80Z 2KIFA 2HS5A 1V4RA 1DDNA 2RQPA 4EMSA 3U9GA 2CSOA 3C18A 3L7WA 1LEBA 3L9FA 1FWZA 4EJVA 1U78A 5LHHA 1K78A 2FBKA 4ZYEA 4Q48A 3F22A 3CUQC 2NNNA 2K4BA 2PQ8A 1WI9A 1FC3A 3LAPA 1P6RA 2DBBA 3RTRA 4KYWA 1D3YA 4BXUA 4HV6A 1B59A 3JTHA 2CQKA 2ISYA 3CUQB 2EA2A 3FMRA 4IPAA 4MTDA 4P5OA 2E7XA 1FOKA 1ON1A 3BPVA 3LAJA 2KRFA 3FHZA 1MDMA 4EM0B 3LA3A 5TRDA 4AWXB 2OA4A 2DAOA 3ISPA 3HUGA 4HZFA 3VFZA 5HOOA 2HYFA 1T6SA 3ELKA 1BBYA 3T5XA 1P92A 4MEYF 2VBWA 2CO5A 4R1HA 1HKQA 4E70A 5HLGA 1KGSA 1ZHFA 1RIOH 1FP2A 3TGNA 4A5NA 3E5UA 3KFWX 3SZTA 1XSDA 4KIFA 3KEQA 4L0ZB 2DTRA 4UVBA 3GYHX 2QLZA 3ABUA 1FLIA 2W24A 2KJBA 1V3FA 2PEXA 2VBXA 1GHCA 4A6EA 2NNYA 1FZPB 3I59A 1YS6A 3GUDA 4GXOA 2HEOA 1J2XA 1XN7A 3R6SA 1SFUA 2VXZA 3LQRA 1K6OA 4AIKA 1O7LA 2LX9A 3TDUC 2OAZA 2ETHA 4KDPA 2XKPA 4IF4A 1KU9A 2PLYA 1IN4A 4ENJA 3MCZA 4Q5SF 4AD9A 3IL2A 3GZ5A 3QOPA 2XAHA 1PP8F 1XCVA 3CJNA 3KZZA 1H9GA 1MKMA 3QPTA 2RC4A 5A2QZ 5E1ZB 2STWA 3EUHA 2Y0MA 1J5YA 6PAXA 3DXJF 5DEQA 2VT3A 3WODF 3M9AA 2DFIA 1ZRCA 1XGNA 1KQ9A 3PFIA 5LEKA 4G8XA 5LHIA 3F8MA 3ZN0A 4RAZA 2ZNZA 4BHBA 4XBFA 1KYWA 4L9JA 4UVAA 4ENNA 4BHPA 3D5LA 4Y13A 2VOOA 2EV6A 1TLHB 1YFHA 5CVIA 5D6EA 1TW2A 4M6XA 4GCVA 2A6HF 2LNBA 2QQAA 1IZ1A 2CWEA 1DP7P 2XRNA 1G6NA 1YW8A 4L5JA 1YYVA 4GYIA 1E17A 2QZ8A 4HQMA 5ICFA 2DK8A 1G3WA 3EYYA 4LG0B 4WXCA 1S7AA 2J5OA 3ZP5A 3C1DA 3F72A 3QAHA 1TQIA 5E17F 5LHGA 3I0TA 3V7SA 3M7GA 3F8CA 2EA4A 1LEAA 1H9TA 5K5OA 3L2CA 3DP7A 4RB1A 5ICGA 3WGHA 4M73A 3VODA 1R36A 4HX4A 3GZ6A 1TQPA 3CO6C 4HQEA 3IHUA 3RJPA 4RAYA 2CW0F 1YS7A 2CYYA 1ZRDA 3NEUA 4IRGA 4I09A 3HSFA 3T1BA 3QP6A 1HKTA 4S05A 1IW7F 1HBXG 3F8BA 4G7HF 4PCQA 2M5WA 1FNNA 4P9FA 3L09A 2M30A 2OBPA 5CVUA 3K2ZA 3H3UA 4OIQF 5IT9Z 2JZYA 4BNCA 1I1SA 2IRFG 1G3SA 1RNLA 3HRTA 5FD5A 3CLOA 3ABTA 3GFLA 3WU0A 3E6DA 5TJJA 2QM3A 3I58A 3ULQB 2HR3A 3FWEA 1SD5A 3RI4A 2HTJA 2PN6A 5D8KB 1W5SA 2W84A 1Z91A 4B8XA 2P5KA 4U7DA 1I1GA 5J6XA 2MH9A 4HLXA 5DCFA 1HKSA 2EWNA 2HZTA 4QLCU 4RB0A 3P9CA 3ECOA 4D0PA 3WTVC 5E8IA 4EJUA 4OINF 1ZN2A 3I54A 3GFIA 5L3DA 1YG2A 5H6RA 3DQVC 2FBIA 4L9VA 4BHCA 4ON0A 5K1YA 2HFHA 2RKHA 1FSEA 2Y48A 1XDSA 1HSJA 1BI0A 2GIVA 3H92A 3M1EA 4Y15A 4RGUA 4UVCA 2GXGA 2VN2A 3KE2A 4EJWA 4MQ9F 4HDVA 1Q1HA 1OR7A 3BDDA 3KLNA 1QPMA 3ZPLA 1TQMA 5CVRA 2ACJA 4EJTA 3Q5FA 1D8KA 3V7CA 3HRUA 1IN5A 2OQGA 3EDPA 4A0XA 4K2EA 3R4KA 1OYWA 2DI3A 3MWMA 3V4GA 5BOXA 4UUVA 1U5TA 4EJOA 1T38A 2MH2A 5ERIA 2IJLA 1BYMA 4ESBA 3I4PA 1FYLA 1XSXA 3FXRA 3EQLF 2L01A 4RGSA 1IXRC 4HV5A 3RDIA 2RVCA 3WGGA 1ZAOA 4KMUX 2QVOA 2DT5A 1W7PB 1MGTA 1JHHA 3LA7A 1SFXA 2H94A 5JI6A 2FXAA 2MA3A 3SHFA 1CGPA 4BH9A 4OMZA 2NS0A 2PFBA 1U8RA 1ULYA 2KKOA 3E5XA 2ZMEA 3IWZA 1O7FA 3FF5A 4FX4A 5DCMB 1FYKA 2JPBA 3ERED 2OQRA 4G6QA 2GZWA 5JR3A 2HKXA 2Q8KA 5CVJA 3P9IA 3V8JA 1LDJA 3RPUA 4DNCA 1FBUA 3R0JA 1RUOA 2RNJA 1F4KA 2W25A 1S6LA 2V1XA 1TNTA 2ESNA 1YLFA 5K5QA 1QVPA 5D4RA 2BV6A 2A69F 4Q47A 2DPDA 3N97A 2UXNA 5E1WA 4HF1A 5DD8A 2WTEA 2UZKA 4JQFA 3QU6A 1R5HA 2XAJA 2MLGA 1RZ4A 2FEZA 4P55A 1K78B 4EV0A 5L3FA 4KNYA 2Z9OA 5FO5A 5HDNA 2NAZA 4XRFA 1F5TA 3HSEA 5LEJA 3J80K 3KP3A 4CDGA 5FGMA 1LVAA 3KP2A 3IC7A 1S7OA 3U2RA 2QUFA 1DPUA 4MNUA 3ZMUA 2DW4A 2PI0A 4EM2A 2HGCA 2DLLA 4U0WA 1XMAA 4EGZA 1CF7B 3I53A 2VBZA 2RV8A 5K5RA 4ZZLA 3ML6A 3GO5A 2YPRA 3MAJA 3W6KB 4G9YA 2HQNA 4KIGA 5DV5A 2EFQA 3KP7A 1ZG3A 2IW5A 2M45A 1R00A 3KP4A 1P4WA 1O3QA 1LB2A 2GWRA 1OPCA 1ZLKA 5LGNA 2BYVE 1D5VA 1QGPA 2BEOA 5HVQC 3U1DA 1YO5C 5E18F 1BN5A 2XAGA 4GYGA 1FPQA 5H6QA 1L0OC 3K0LA 4LB6B 3T8RA 1I5ZA 4HYEA 3KP5A 1REPC 4PDKA 3E97A 4CHUA 1MZBA 4U0VA 4MHGA 3ZQ7A 1TTYA 1BJAA 1W5TA 2AS5F 4ZYHA 4ZH4F 1XB4A 4U88A 4HAMA 3FXQA 3I59B 5KVRA 4I0BA 5DD4A 2DO7A 4IRHA 1XDUA 4HA8A 4IHSA 3GW2A 3B73A 1S29A 3F21A 2J5PA 4OIPF 4I02A 2NRAC 1P2FA 1PP7U 1UFMA 3B02A 5DUKA 2C6YA 2F5EA 4GGGA 5JFRA 3GFMA 4ETSA 3WTWC 2RN7A 2K27A 3BJ6A 3BP8A 2K4JA 1XSVA 3MQ0A 1EH8A 5D5WB 2D2WA 2XHKA 2MD5A 3JAMZ 4HDUA 2M1BA 2ZNYA 3V8KA 5LLQA 4DQ2A 1ZGAA 3WGIA 3K9TA 5HS8A 3TO9A 1ZREA 4MGRA 4BQAA 3G3ZA 5LGTA 2L54A 3DF8A 2VODA 1LDDA 4MTEA 3M8FA 3EETA 1O3TA 3E19A 1BI2A 1O3SA 1E2XA 5ILUA 2AXLA 1ONVA 3FXUA 2VC0A 2K02A 2P8TA 2EFNA 1TNSA 1WRJA 5A2QK 1XGSA 3K1NA 2DPUA 3NQOA 2Q2EA 2QQ9A 2VE8A 5LRRA 4CO8A 2ELHA 3E6BA 2OU2A 3OOPA 4YFNF 2ISZA 2A5YB 4ASNA 5FLXZ 2ZKZA 1BM9A 2K5IA 5H20A 2H3JA 1FP1D 2IT0A 3HTUA 4M9SA 4I7HA 2K4YA 2V1DA 3MHXA 3BPXA 3TQNA 1LDKB 2V6CA 1MJ9A 4LD5A 3RKYA 1FT9A 2A07F 3F8NA 3GXOA 1FSHA 3CUOA 3O3KA 2G7HA 2ZCWA 1O57A 2B0LA 2VE9A 5FB2A 1ZARA 5CJ9A 2FBHA 1YIOA 4M74A 3ZMZA 2GAUA 4LFUA 4L18B 2TDXA 3J81Z 5CVVA 4XSZF 2H09A 2RDPA 3F23A 1HSTA 3Q9VA 1BI3A 2GXBA 1GXQA 4LLLA 3WTZA 3SZPA 2QBYB 2WC2A 2JRTA 3Q9SA 3I64A 4WF2A 2M87A 1BC7C 4OU0A 2YX7A 2W85A 5BQTA 1W7PD 1QNTA 3CO7C 4OOIA 2Z5UA 1R1TA 2FU4A 1A04A 1JE8A 3HRSA 4BAYA 2ESHA 2UXXA 4IJAA 4HOBA 3RIRA 3COAC 3PQJA 5IT9K 1BIAA 1MJAA 4G6DA 3KLOA 2P5LC 3E5QA 1KQ8A 4XSXF 3L00A 4KFCA 1IUYA 4RGRA 4I01A 2ZJ2A 4OMYA 3C7JA 4KN4X 1HW2A 1EV7A 2G7UA 2IA1A 3HIFA 3W6JB 3O2PE 5LRSA 4RS8A 3F3XA 2P6SA 2STTA 1J7KA 1RI7A 3BZ6A 2P7VB 2FSWA 3TKYA 2EFWA 1PUEE 2DU9A 3WTUC 2HTSA 4CGZA 3REOA 1AWCA 2W57A 4EM1A 5AONA 2L3DA 5JHUA 4L9NA 1ZG1A 1UHWA 1UCRA 2IVMA 2K86A 1C0WA 3EYIA 1IRGA 3P9KA 4KIBA 2FF4A 1Y0UA 1JXSA 1FBSA 5HDGA 1AOYA 4M71A 5D6FA 2G9WA 4LJZF 2FMYA 4L0YB 2PMHA 4ZYGA 3JW4A 3JSOA 1Z7UA 4IRIA 1XMKA 3WU1B 4LLNA 2JPCA 4U0YA 1U5TC 5E1XA 3VOEA 4R79A 2F5DA 1OKRA 3RKWA 2EFOA 5F64A 4FHTA 2MC3A 2XUBA 1K7AA 4I2OA 3WTSC 4WWCA 3D0SA 1U5TB 3GVAA 3SQNA 1BIBA 2BGCA 1GXPA 4XLPF 1KA8A 5D5UB 2JTVA 3FM3A 3WTTC 5BPDA 3HOSA 5DYMA 4GO1A 2XVCA 2H6CA 4CICA 4H0EA 2PBIA 4KUMA 3MFKA 4A12A 1G4DA 3ZMDA 1XGMA 5ILSA 5DDGA 3IWFA 1J75A 1DUXC 2HKOA 2FA5A 2LSOA 5ILVA 5AIPA 3KETA 1ZG5A 3VB2A 3HYIA 3CTAA 4N9HA 1I6XA 2ZMEB 4WK8F 2OZUA 2R7FA 4O6JA 2OZ6A 3LWFA 1T39A 2HOEA 4F7ZA 3JSPA 5CYVA 4Y17A 5D5VB 4LGWA 5BPIA 4CZZA 1U6GA 1QW1A 2COMA 1FY7A 1WWXA 4HF2A 1USSA 2BBYA 1O3RA 5DCMA 1ZLJA 4HX8A 3KCCA 4UXNA 2ZFWA 2YU3A 4KA4A 4QWQA 1QZZA 5DUIA 3HHHA 3DPTA 1OYYA 2CGPA 1JGSA 3KEOA 4I0AA 1J59A 4TV7A 1K79A 1UHMA 1J0RA 4PZJA 4FT8A 1DPRA 3BWGA 5D5XB 2PJPA 3FX3A 4HLYA 4XLNF 4KN7X 3E6MA 5KK1A 1R5GA 1U2WA 1Z05A 4N9IA 4LB5A 2YX4A 1T0FA 3T8TA 3AAFA 2V79A 2V9VA 3R0AA 3OV8A 4M72A 3TO7A 2EV5A 4WX9A 3FMSA 3CDHA 1MDMB 1WQ2A 5ICEA 3WG9A 2Z33A 4G7ZF 3E3VA 3K1MA 2GA2A 2EB7A 2XV4S 3CUQA 2E1CA 3QRFF 3LSTA 5F1RA 1CF7A 3HRMA 4AVPA 2O6GE 3P7NA 1G3TA 1YTYA 5J8FA 5E20A 1VTNC 2QENA 3F6OA 2CFXA 1NHAA 4CYDA 1SMTA 1R22A 1FYMA 1FX7A 4JBAA 1MD0A 3RPQA 2P4WA 1YW7A 5HS7A 2M8EA 1IN7A 2ZXJA 3DV8A 3MEXA 5L3BA 4FX0A 4NHJA 3LQQA 3WTYC 1I27A 4EVIA 4N0BA 4UV9A 4M9ZA 3RYRA 4ESFA 5F6FA 1T98A 2VT2A 3KZYA 1TW3A 2P6TA 3NRVA 2MLKA 1PDNC 1IXSB 1S3JA 4ZYDA 1SFEA 4Q4ZF 4MQVA 4A5MA 2XASA 2K7LA 4WXHA 3PQKA 4EQQA 1ZH5A 4ENKA 5BMZA 1XCBA 4G7OF 3FZVA 2P7CB 1EH7A 1S8NA 2H6BA 3BROA 4YG2F 2XAQA 3GX4X 4HF0A 3ECHA 1MJBA 1QQIA 4UHTA 2FE3A 1G3YA 2EJRA 3M8EA 2QQBA 1HW5A 4NQWA 4RB2C 2XIGA 2X4HA 4O5VA 3TOBA 2O61A 3BY6A
chains in the Genus database with same CATH superfamily
5IP6A 5JVTA 3FDYA 3OYAA 3K70C 1YWOA 5HDKA 3JTGA 2D45A 2V1UA 1JI8A 3V7RA 2RNGA 1MMSA 5LJ5h 1JUPA 5F0CA 1X2NA 4A2UA 1PNJA 3A8HB 3W2AA 1UECA 3CC4Q 3K6GA 2DQLA 4PJJA 1MMNA 2QEXI 1ZRFA 2P5VA 2LR8A 3HM5A 1ZA2B 5GAMd 2LP5A 3MZHA 3BC8A 2XKOA 2Y31A 1YJWI 2HOSA 4Y52J 4DYRA 1BC8C 3EFOA 5GAN2 4HT8A 2E2IJ 2E1MB 3JCMP 3IRRA 2ME0A 4X1VA 1G5VA 3JAMK 3HOUJ 2KDSA 3UF4A 4QVZA 3THKA 2VVKA 3BLYA 2XROA 1VQPI 1QQJA 2GOMA 5HODA 1SHGA 2WV0A 2DA9A 2E5KA 3A03A 2MCNA 5A0LA 2IA2A 3KPHA 1GVJA 2ATCB 2W7NA 1UHFA 4L9TA 2JQ7A 2QDYB 2DJNA 3NTIA 1YN8A 2Q2EB 3QPHA 4ESRA 3IKVA 4M6YA 1WKMA 1TWAJ 1ON2A 1AWOA 3PNVA 4HVUA 3QU3A 5AIQA 1E7OA 1RPWA 1WPYA 4QW2A 5DLQE 4UV8A 4L5IA 4OAZA 4UY8I 1F9NA 2X6WA 1IN6A 1QO0D 4HW0A 1H89C 1X6OA 2CH4W 2HQRA 1D0YA 1BI1A 2VXFA 2WADA 4QQGA 1ZX6A 1LE8B 1BJZA 5ICCA 4BYYA 4MZPA 2EYXA 5CCAA 3VYGA 1U3EM 1H3HA 2Z99A 2LF8A 3WHBA 2X0LA 4S04A 2AQFA 4AYBA 1T2KA 1VQLA 3ZQCA 2J06A 2DN0A 3CXCS 4E47A 3CF2A 1QBJA 2KE9A 4LDUA 2HWVA 5IHKA 1HXDA 4IHYA 3UKGA 4NC6A 5L3EA 1YI2A 2HD0A 2YRCA 4CCOA 4WCGA 3FXOA 3JCMJ 3O6BB 2QG9B 3VS0A 2ZPGB 2CDTA 1KQ0A 2SRCA 1VZ0A 2KISA 1NTCA 1YIJA 2R7DA 3NARA 2ZGWA 3SXYA 3ZXSA 4D9JA 4IZZA 4QPQA 2QYOA 2L7MP 4C8QF 2YUPA 2KT1A 1EH6A 3G1OA 3QYEA 3TDZC 3N05A 1R1VA 2R7TA 1WXUA 5CKBA 4C3IJ 2O8XA 3AG3H 2VBYA 3FM5A 5FD6A 3JRBA 2JTMA 3KP6A 2V8JA 3ZRGA 1U9NA 1W36D 4PGGA 2M3AA 4DOWA 1IJWC 3CCJQ 2BE5F 4MLOA 1R7JA 3ASNH 1AWXA 3LLRA 2D1HA 2WWYA 4XL9A 2I5UA 3G73A 5IYBJ 2EFPA 1D0ZA 4B43A 5ED4A 3QJYA 1YFNA 3HXLA 4QTRA 2VKDA 5FKOA 3TOAA 1VQ4T 1Z1DA 5FLXK 4BJTA 3CPFA 1RLPC 4P9UA 3N4MA 2ZZDA 5FKNA 5B5EC 4KT5C 3OS1A 1Z9CA 2BW3A 5LBQA 2F4MB 5D4SA 1WJEA 4LG0A 3I56I 2PG4A 4C92F 1OPKA 4B4CA 2DA2A 1ZQ3P 3J80E 4PUSA 2FB7A 3E6CC 1K4SA 1F1ZA 2GA1A 2L3RA 2JT4A 3JRZA 4OGCA 4G94A 1MBJA 2V4JC 4M7AC 3R6OA 2IGNA 4YIFA 5EZGA 3QYGB 1R58A 3DEEA 1HC8A 1SPKA 2XF6A 3EFSA 4AIJA 1QWFA 1BW5A 3I71A 4BE0A 2DXBA 4BQNA 2K5LA 4JLIA 2L9RA 2R3SA 1XMXA 2E34A 5D8LB 1HQCA 1KQSP 2XGXA 1T56A 3MZYA 2LX7A 2YU9J 1G2HA 5IHNA 3C2GA 1WH7A 5KCHA 5E8GA 1TS9A 1W6XA 1APLC 3AG2H 2MBFA 4J7IA 1BR4A 4PJMA 3VSLA 2UWMA 4M78C 2L4MA 4NB5A 1WX6A 4CYCB 1PRLC 2E1NA 4V2FA 1JKQC 2J6KA 3REAB 3I55A 2L4AA 4OIOF 4AC0A 3MN2A 3CQTA 3H0IA 3TO6A 2QQ8A 5CLSA 1OMIA 3V8LA 2KJCA 1UDLA 4OF1A 1UB9A 2OD5A 1L3LA 5D6XA 3ROUA 2BY0A 4LIVA 4PSXA 5EZHA 3ZMTA 4ELYC 5K7HA 5GTIC 2VONA 4YFKF 1H88C 4PGHA 4OMMA 2A68F 2F2EA 2GQQA 2KY9A 3ABKH 3CCVI 4WCIA 3UPUA 4YIIA 3PMIA 2OC6A 2EK5A 2VOPA 3A1PA 3M0UA 2B7EA 2KIMA 4MIMA 4EEFG 2K57A 1VQ9A 1X1BA 3G1JA 4M78B 3GTJJ 2KDZA 3LFKA 3HHGA 3CMAQ 1R1UA 1FBQA 1TH7A 3G6EQ 3H9NA 3HL2A 1XGOA 1LFPA 3G71Q 3VYTB 4U7BA 3J81K 4ENMA 2F6CA 4IXAA 1KHCA 5EGOB 4J9BA 1UHCA 4IHTA 3HB9A 1R6RA 3ASOH 3FISA 2DVEA 1TWCJ 3DTIA 5C4JJ 2DXCA 3FXJA 2OX7A 3ZMVA 1JB0E 5IYDJ 2QBYA 4M9XA 3OW2S 2G3RA 1UGPB 4I98B 1Z6RA 2WB1A 2WACA 1R49A 2F5CA 4A3JJ 4JJBA 4V2SA 3GEZA 5J3LA 2ZFUA 1B4AA 1QHGA 2CQXA 2VI6A 1QZYA 3FKIJ 2FOKA 1SC7A 2RQWA 4LDYA 3EAEA 3T0YA 3RKXA 1RUNA 2AZSA 2IP2A 2GTOA 4P5NA 3IKTA 3KBGA 4BD3A 2OUMA 1TOVA 2A37A 2J6FA 2M0YA 5GMKi 1NBEB 3S2WA 3GWZA 1SHFA 3BW1A 1RADB 3CC7A 3C3WA 3K1PA 3DFGA 3TSWA 1ABOA 1BBZA 1KYZA 3ZN1A 2JXBA 2X4YA 3GFJA 3SFZA 4CCJA 3QG1A 4C0DB 1YITT 1KD1R 2HYGD 4C3JJ 1N25A 2CSQA 5GP9A 2EJFA 2O5RA 3K4NA 3QQAA 4FM4B 4C2UA 3JV3A 1VQ8I 2IS4A 2Y90A 1WSUA 1SAXA 2JRMA 1AHDP 1ITYA 4RLQA 3H5NA 2XICA 2XF7A 3OYNA 2FNPA 5GAN3 3GLXA 3RPUD 2K3PA 2O9SA 1ZYRF 3HSRA 4O3MA 4BDZA 4WXDA 4UNOA 3J7AO 1QCNA 4PKCC 2ID6A 1DU0A 5KE2A 2BZTA 2XPVA 3SDBA 3VEPA 4BQOA 1ETKA 1J3TA 3W6VA 1S9HA 4OMFB 5FU6C 2O3FA 3CCQT 2GCXA 2E7WA 2BE7D 1F43A 3GIBA 2DYBA 3DWLE 2WAFA 1WJAA 1B9MA 3MD2A 3CXCA 1LVKA 2EYYA 3BJAA 3IRQA 4JUVA 3RYPA 3HGYA 2LG4A 4HX7A 4CCLA 1ERDA 1P4AA 3OL3A 1VIFA 2DF6A 1IF1A 3GP8A 1WGSA 1USTA 3H6ZA 5HS9A 3WTXC 3X26B 2ZXHA 2F2XA 1JJ2S 1AHJB 1F36A 3VS1A 2DK5A 3A98A 4Z88A 5BNGA 2R4GA 2TRTA 5KNLA 3PVQA 1IXCA 3QP5A 1IV6A 2AHQA 3BFMA 5IT3A 1Q7YR 1VQNT 5BS6A 5A0GA 1X3UA 2Y75A 3QDRB 2LCLA 1W4MA 4YFXF 3AG1H 1WJSA 1NM7A 3L42A 3CZ6A 2FPDA 3M4YA 3HKSA 2KRCA 4M3FA 4LDXA 3PFSA 1R23A 4B9XA 4JJNK 3AKZA 4Z8AA 4M75E 3CD6Q 4ESJA 1ZHIA 5JHFA 2YUSA 2CG4A 3A4CA 4A3KJ 2IPOB 5GAN7 2LJ3A 1P4XA 1IHVA 4FIBA 2XF5A 1B1BA 4P96A 1JJ8C 4A6DA 1XNIA 3DKWA 3M59A 3R61A 5KAIC 3MKDA 2FQ3A 1I8FA 1RAHB 3G4SQ 2DT6A 2RB6A 2CP5A 2A6EF 5A0DA 3AFHA 5L8RE 3DBHB 5L3CA 1VQKT 3H35A 2CFOA 4H4KC 2XAFA 3A8OB 4PJOG 2DBKA 4PLLA 3KX2A 2QTXA 4IVNA 3GTLJ 4BEHB 1IREB 5GAHJ 4M7AG 1M90R 1D3BA 3F8FA 2PUKB 2DOEA 2ZXIA 1AOJA 1XD7A 2VGMA 1LQ1A 2QWWA 4HBLA 4MMLA 4M7DD 5DM7R 1B9NA 3BZCA 2M1HA 4LK0F 3K69A 4M3GA 2L3SA 4LK1F 4KT0E 3IQLA 3C12A 1EA3A 1T08B 3K2AA 2IEKA 5JVGF 4GY5A 4XM3A 2VV5A 1KSWA 2EJGA 5KCOA 2RREA 3SWNC 3WE3A 4EGYA 1HW1A 3DEUA 2AZVA 2A61A 2HVSA 4HG2A 4M78G 5HLIA 1SD7A 2DFFA 5E3OA 2ZBKA 3LSIA 4N4NB 3VU3C 2FMLA 1VYVA 1JKOC 2KMTA 2L2OA 2RGVA 3H3ZA 2FNAA 3TEDA 5CO7A 2QDLA 1KU7A 4OVAA 2K5FA 4ZYAA 1B34B 2V26A 1YW9A 3SEQA 2O0YA 4HNUA 1QPIA 3VV0A 1SFKA 1AZGB 2EQUA 4NOYA 1B6AA 1OYIA 2JJ7A 5HKCA 3GF2A 2KEAA 3TREA 1D8JA 1KHIA 2JSCA 2VJ5A 3LSHA 2AKKA 1GXIE 2RJCA 3CBOA 4XQFA 3SWNB 3LA2A 3ZQLA 2CZ7B 1B72A 2DQRA 2ZO4A 1LNWA 4Y4RA 3BOQA 2D1XA 1KFZA 1KK7A 1RLQC 2HQAA 2L02A 5J8CA 1SD6A 1LJ9A 2IA0A 2LQ8A 1SD4A 4LD6A 3VS5A 4KMFA 3I5UA 2VJIA 1AVZC 4JK1X 1IRFA 5I2MA 2QCOA 2RAEA 1VQ4A 2JT1A 2DEUA 4F7UE 1MBGA 3CCLQ 4ZTJA 2GFAA 3OMYA 1K9MR 4LUDA 2VYTA 2LKSA 3CCEQ 1KU3A 1AKHA 1LCKA 3TL4X 1U06A 1ZGJA 1UJYA 4A0YA 1C6VX 4A0ZA 1T3SA 4ZZDA 2H27A 5LJ5j 2D0NA 2LKPA 2KIUA 2FEIA 3JCMd 2Z3YA 2O7OA 1VQ7Q 1Y56A 1E6GA 1BOAA 3HFNA 5IYCJ 3P5JA 4UUSB 3R60A 2X98A 4CC7A 2A3SA 3ZMSA 1RAIB 2IBDA 4BI3A 2DL7A 4C8QC 3CMET 2L7ZA 2D1VA 4XU0A 3ZQGA 2MWPA 3DEWA 2EV0A 5EEGA 2V7FA 2WA0A 4PK4A 4KULA 1JHFA 2YR2A 1ETVA 1VQOI 3H0DA 1M5Q1 2LDUA 2L9SA 2P84A 4MDWA 1YJ9Q 2EVRA 2HDCA 4AIHA 3UR3C 3PIOA 4BE2A 1KU2A 2YRVA 2VQLA 2ROTA 1YQAA 1VQ5T 4RTZA 1MMDA 1U0JA 2EYQA 4EMKC 1VQOT 3TMOA 3HTSB 1TTHB 2LF7A 4Z2YA 4ELZC 2F5FA 5FFXA 1IC8A 1M2VA 5FFZA 1A35A 1IN8A 2YSRA 5J47A 2E5QA 4C8QB 4DEXA 2QA4Q 1W7PA 3MEAA 4C92C 3HOTA 3DPLC 3F0CA 4UB8C 2EIFA 1JJ6C 2FRHA 1U1TA 4LXCA 3TQ7P 1A6QA 2ADUA 3PNYA 2RK2A 1PD0A 1UFFA 4LNPA 2O01E 2FPFA 1UMQA 2OTJT 4OIRF 4CXFA 2HMAA 1YNZA 3NWSA 4OMLA 4CC2A 1Z6TA 5LGUA 3WE2A 3OQ5A 2PMUA 2W4SA 2CKKA 5LJ5f 2VC1A 5FJ8J 2K9MA 2NVXJ 3HDDA 2HQ5A 3S2DJ 1ZQ1A 1STZA 5B1BH 2EZKA 1R0BG 4RGXA 2IPQX 4OMPA 4J9CA 4C92B 4R8HA 2CH0A 4BJ5C 1K8AR 5EEHA 3E9GA 2NYXA 1J9IA 1VQ9Q 4JPBW 1ZR2A 5D6YA 1YJNQ 4LMYA 3DBRB 4KICA 1IAWA 3CCRQ 2UV1A 1NJIR 2BZYA 2RI2A 1KC8R 4QPOA 3EG9A 4B09A 2NXNB 4MEXF 2PMZA 4IHWA 1OLTA 3AHUA 3BJOA 1H0MA 4KITB 2X4JA 1TBXA 2VQCA 3CCUQ 4LLGF 1X1DA 5L3GA 5KYUB 1ODDA 1YHQI 7AT1B 1SMYF 3F9KA 4Y3OA 2DD5A 4DYCA 2ED1A 5J26A 3KYLA 3CPWS 2O03A 1QVFA 5B66C 3F6VA 1QZEA 1GUUA 1IZ6A 2WSEE 3LW5E 4PFOA 4OMNA 5HLHA 2Q0OA 3FMQA 5J39A 1T0FC 2EGEA 1YHQT 2DCEA 5GADJ 1OCPA 1WVRA 2LK2A 4RB3C 2ZAEA 3J80Z 3H0HA 2KIFA 1I50J 2HS5A 4JX6A 2CYZB 4ABZA 2L0AA 1YITA 3DTEA 2CUFA 1V4RA 2R5YB 1DDNA 2C0TA 1KD1U 4HCCA 2RQPA 3ABLH 1MUZA 2KBTA 3OWTA 1A6IA 3GMEA 4EMSA 2VC8A 3U9GA 3X25B 1VQMT 2CSOA 3C18A 3BG5A 1TSFA 2HQXA 3LYIA 2RH2A 4A93J 1RL2A 4F16A 1FIPA 1YIJI 2KYBA 3J7AF 5DLOA 4KT6A 1UGSB 3VRYA 3L7WA 2PVOB 1LEBA 2HVQA 2X4WA 3A5ZB 1RAGB 4A3BJ 3L9FA 4XICA 3EH2A 2DTIA 2E41A 3HZJA 2R7QA 1VQ6Q 2RF0A 2OJED 2ZPIB 4M3BA 1G83A 4U87A 1FWZA 1JQQA 1JXMA 4EJVA 4A4FA 1U78A 5LHHA 1K78A 4PJOF 4Z89A 2HXOA 3CCQA 2FBKA 3DBLB 1MBHA 4ZYEA 3O8HA 4Q48A 3F22A 4W1UA 2GGRA 4M7AF 4HPQA 2EINH 4XU3A 2AQEA 5J1UA 3FLGA 3FIWA 3CUQC 3K70D 1GRIA 5FLVA 2NNNA 2K4BA 2R7OA 4XRSA 2PQ8A 1K83J 2E2JJ 3M0QA 4N0AC 1WI9A 3CLQA 2E19A 3I3LA 1ZUKA 1TUGB 3CJRB 1FC3A 3VYRB 4C0FA 3LAPA 1P6RA 1XS9A 3M53A 1K4US 2DBBA 3RTRA 4KYWA 1D3YA 2L5QA 4BXUA 4XTUA 2DDAA 2DXTA 3L2ZA 1VQNA 2EQJA 2QSGX 1OX8A 4HV6A 4BKXA 3JB9H 4JJDA 3QSUA 3FXKA 5GMKl 1B59A 2KRHA 3JTHA 1YP5A 2CQKA 2LD5A 2ISYA 1VQPT 2ECCA 3CUQB 2IG0A 4FQGA 2EA2A 3ZQFA 3TVTA 3OYIA 3FMRA 4BDYA 4UB6C 3CC2T 4IPAA 4MTDA 3CC4I 4ZDLA 3NTHA 1QCFA 3MEVA 4P5OA 3EH1A 4GBQA 2E7XA 3BZKA 1FOKA 1ON1A 3DLAA 3BPVA 2BTTA 3EGDA 2CQ7A 3LAJA 3A8MB 2KRFA 1I5OB 3FHZA 3OS0A 1M8VA 4BBRJ 1IG7A 1MDMA 2HVRA 3S1NJ 5ECAA 1FOXA 4EM0B 3CC4T 1Y71A 3I55I 3LA3A 5TRDA 1JTXA 4AWXB 2KK4A 4BGDA 3OB9A 4KH0B 2OA4A 3JCMX 1VQKA 4YELA 1ZELA 5IOYA 2MG4A 4X1EA 2DAOA 4C8QG 3ISPA 3HUGA 4HZFA 5EJCA 3VFZA 5HOOA 5EYRA 4DOVA 2HYFA 1H3ZA 4RLFA 1M90U 2B8AA 3U21A 4XONA 1T6SA 2HXIA 2K3FA 3MVPA 5M5XJ 2GLOA 2PVGB 3OMCA 3QO3A 4KGZB 3ELKA 2F2VA 1BBYA 3EG1A 4OB0B 3PSIA 4ORZA 3BDLA 2IGOA 1P92A 3T5XA 2VB6A 4MEYF 5CKHA 1WH5A 2VBWA 3H5RA 4ZDOA 4QVDA 1ETOA 4XIDA 2BXZA 4A3DJ 4J9DA 2MW8A 5LFAA 1XJWB 2CO5A 2K79A 4R1HA 3MKYB 1HKQA 2MK5A 4E70A 1NG7A 4RM2A 1IDYA 5HLGA 1KGSA 1ZHFA 3OYMA 3D1NI 2ZB9A 5B1AH 1RIOH 1FP2A 2ZSHB 3TCJA 4J6WA 2P4TA 3TGNA 4A5NA 3E5UA 4C92G 3KFWX 4B1RA 1TXQA 3PFYA 4RDUA 2DX1A 4EDUA 2V1RA 3SZTA 4YRVA 1XSDA 4M75A 4KIFA 2VL8A 1BCMA 5GMKh 1S72Q 1M3CA 3CCMQ 1JUSA 3KEQA 2RNAA 5L23A 3LFUA 2H8HA 2BHYA 4L0ZB 2ECBA 2GBYA 2DTRA 1NG6A 3RESA 3I5RA 4UVBA 3GYHX 2Y30A 2QLZA 3ABUA 1FLIA 5C44J 2W24A 4B47A 2KJBA 2KPMA 1AA7A 1V3FA 2PEXA 2VBXA 1RQ6A 2KR3A 4KRTA 3B6CA 4KUDK 2RJFA 3CC7I 4XAXB 3OYYA 1GHCA 1Z7LA 2ICWG 3GTPJ 4CCKA 4E7ZA 4QSHA 3S15J 1YX3A 1X01A 2P0QA 4A6EA 2NNYA 3VWBA 1D1BA 4A4KA 4PJOD 1GBQA 3EGXB 1K9MU 1GL5A 3I9V2 3I59A 1FZPB 1YJ9A 1YS6A 3K4JA 3D5RC 3D5SC 3GUDA 5EG2A 5CK9A 1N9RA 4XR6A 4M7AD 4GXOA 4FW2A 2HEOA 1J2XA 1XN7A 3R6SA 2O2OA 3EGUA 3TSZA 3CCJT 3NFCA 1OU9A 1SFUA 3A0HC 1D0XA 2R7VA 5LJ3e 3CMEA 3E2UA 4Y33A 2VXZA 2DL3A 3HKZN 1V29B 1WXBA 1K73C 1X4OA 3A0BC 3LQRA 1ZSZB 1K6OA 4AIKA 2HDWA 4A4EA 1ZBJA 1O7LA 2E65A 2GFUA 4GLMA 1TC3C 2LX9A 3JCUC 3I5SA 2R0QC 2LFBA 2JA6J 3H9GA 4L59A 4M78D 1VNDA 3TDUC 2OAZA 3JCMg 2ETHA 3VS3A 1VQ5A 4IX7A 4KDPA 1LKXA 4XK4A 2XKPA 4IF4A 1KU9A 3R6NA 1QA6A 1PUFB 2H1KA 1VQOA 1W0UA 2PLYA 4FCYA 1IN4A 3JAMR 2COBA 4LDWA 4NQWB 4ENJA 2CV1A 4B6MA 3MCZA 4Q5SF 4AD9A 2XKOC 5FWBA 1R77A 3JB9F 1HSQA 2M0CA 3IL2A 3S6WA 3GZ5A 3QOPA 3GZNB 2MVTA 1NG2A 2ELKA 1ZBXA 3A01A 3QPLA 1JRIA 2Y0SN 4BY1J 5TGTA 4C2TA 5KYYA 2XAHA 5CQGA 4F7UA 4ZTFA 1HLVA 2OTJA 1PP8F 2IIMA 1ZA1B 4CC4B 4ZGJB 1XCVA 3CJNA 3KZZA 1H9GA 2HL5C 4IIOA 5M3MJ 1QVGS 1MKMA 1K6YA 3QPTA 2RC4A 5A2QZ 5E1ZB 3M0SA 2STWA 3U23A 3EUHA 2E71A 4CCNA 1KQSS 2Y0MA 1J5YA 1M27C 2R57A 1XG1A 4F3QA 1PD1A 6PAXA 1K8AU 3DXJF 4RA2A 1SAUA 1O75A 3N5BB 5DEQA 2VT3A 3WODF 1P7IA 3FHNA 4Y7NJ 3C2HA 2XK0A 3BCAA 3M9AA 5GTHC 4RTXA 1RAAB 1NJIU 1KC8U 2CJJA 2Z2SB 4R0KA 1FJLA 2PX9A 2XDBA 1WXTA 2F1LA 1JT6A 2KMUA 1YRNA 2AXTC 1NPPA 5F08A 3INZA 4J6YA 5EC7A 2F4OB 2P0WA 4IL6C 3H41A 4NC8A 1TWBA 3CMAT 2DFIA 5I21A 3HFOA 2CV0A 3G6ET 3EUAA 1ZRCA 5GAOq 4IKFA 1XGNA 1KQ9A 3PFIA 3G71T 5LEKA 3KYCB 3JB9I 2HYJA 4G8XA 1LOJA 4RKUE 4J01A 5LHIA 5EG0A 2A36A 2XMFA 3F8MA 1YHQA 3WXMB 2KRSA 4J9FA 3WVEB 3ZN0A 1RI0A 2NVQJ 2YT6A 2JTFA 4RAZA 2HBWA 2L2PA 3QJ6A 2XRLA 3EUKL 4JS4A 3VKIA 4NNJA 4CCMA 2ZNZA 4BHBA 2N8GA 4XBFA 1Y0MA 4P1WA 1HK9A 2EQMA 2R58A 1VQMA 1TL8A 1KYWA 1RC9A 4L9JA 4UVAA 4ENNA 4BHPA 1SEUA 5FLXR 2KRMA 2NVTJ 1BR2A 3BY7A 1YWPA 3CCSQ 4AT1B 1OCZH 2M4GA 2UUZA 3PIOF 1MSFC 3D5LA 2X85A 1UTIA 4Y13A 2YXYA 4JRQA 2VOOA 2EKOA 3MP1A 1WFWA 2DMOA 2EV6A 1YOVB 2MIOA 2CP6A 2CW7A 1QRYA 1TLHB 1YFHA 3H9QA 2HPMA 3BCBA 4RTUA 4E7LA 5CVIA 5D6EA 1PWTA 3G7ZA 1N8RC 3GBGA 1TW2A 4M6XA 3JREA 2J7IA 3T9NA 1X3WB 5GAOl 4GCVA 2A6HF 2K9NA 1Q1VA 2LNBA 2QQAA 1IZ1A 2CGHA 2K3YA 2O9VA 2CWEA 4PSWA 2B63J 1VQ4I 1DP7P 2XRNA 2KFDA 1OFCX 3HHTB 1G6NA 5E3NA 1YW8A 3M58A 1WI7A 4L5JA 4IO9F 2RQTA 1YYVA 4GYIA 1E17A 2QZ8A 4HQMA 5ICFA 2IXSA 1K1ZA 2DAQA 2SEMA 3QKJA 2E2HJ 4IUVA 1AWJA 2CP2A 3BTJA 3ME9A 2DK8A 2QYZA 2BY1A 4UC4A 1R9TJ 1G3WA 1I07A 2YSQA 3LNQA 2RN8A 3HJEA 2L3PA 2NUZA 3EYYA 1TT5B 2DIGA 4M77A 3CJTB 4AMCA 4LG0B 2RQUA 3ASKA 3QDFA 4WXCA 1GFCA 2XDDA 1LUJB 3BR1A 4C9YA 1S7AA 2J5OA 3ZP5A 3C1DA 1MNMC 3F72A 3QAHA 4PJOC 2E1OA 3GBQA 3EPZA 2OTLQ 3CC2A 5J4YA 1TQIA 4C8QE 2K2VA 3QZ5B 1X3ZB 1Z77A 5E17F 1WHMA 3FK7A 5LHGA 1M1EB 3I0TA 3V7SA 3S3MA 1T0HA 2DL5A 1V1CA 4HCKA 5DY9A 3DLLA 3M7GA 3CP8A 3F8CA 2EA4A 1LEAA 1H9TA 4IQJA 3OMGA 2LREA 4XRMA 5K5OA 1MMGA 3L2CA 3DP7A 4XKBA 3CC4A 1FMKA 1QWEA 2JN6A 2LJ0A 3Q0VA 4RB1A 5ICGA 3EG3A 5LJ3j 2EIKH 3WGHA 3WU2C 2EPDA 1R5ID 2E1HA 4A3MJ 3PVLA 1WHLA 4KBMB 4DZJA 1NPRA 3ZQQA 1GV5A 4M73A 4HRIA 3VODA 1R36A 3GTQJ 4HX4A 5IPAA 4PJOB 1UGVA 2WY8Q 5GANh 2PZ1A 3TBIA 1WHUA 3GZ6A 1PRMC 1ETXA 3ZR8X 1TQPA 3CO6C 2C0IA 4M7AB 4HQEA 2R7ZJ 1VFCA 3A8GB 3G4ST 4XLHA 1K9AA 3IHUA 2NUTA 3RJPA 4RAYA 4XORA 2JW4A 1RR7A 2E64A 3JCMh 1B7TA 2CW0F 1Y0NA 1YS7A 5DM6F 2OAUA 2Y9ZA 3H36A 2CYYA 4C5GA 3OSVA 4J9GA 2V1QA 2RJDA 1A36A 1HA8A 1ZRDA 4MZTA 3RR6A 3NEUA 4IRGA 5GAMj 3ZL7C 2ZCFB 5LL6S 2PVDB 4I09A 2EPFA 4OB3B 3MP6A 3HSFA 3T1BA 3QP6A 3OIOA 1HKTA 4CYCA 4S05A 1IW7F 5FROA 1HBXG 1QLYA 3F8BA 1MBEA 1NYGA 1MMAA 5F04A 4PFZA 2X1DA 3QYBA 4G7HF 5IT9R 1H92A 4PCQA 5J4VA 2M5WA 2WBMA 3BR3A 1UJ0A 1JTYA 1WQ7A 3EG0A 1FMVA 3JRCA 1FNNA 4P9FA 3L09A 1B3QA 1QVGA 2LQWA 2M30A 2QEXQ 2OBPA 5CVUA 2X6YA 3K2ZA 3TP3A 5LJ3f 5LJ5e 3H3UA 4MFEA 2M9UA 1YJWQ 3HOXJ 4OIQF 1KQSA 5IT9Z 4XN3A 2IS2A 2IVWA 9ATCB 1M30A 2KZVA 2ID3A 1NE8A 2JZYA 3S1MJ 4FTHA 2K9QA 1YITI 4DYQA 4BNCA 3A1YA 2FZKB 4JJCA 1VQPQ 1E3HA 1I1SA 3PUBA 2IRFG 4GLKA 4C8QD 2EIJH 1G3SA 4CH7A 4QQ6A 2DKGA 2ZPFB 2EAYA 2HZYA 3QUIA 3CCJA 1RNLA 5FU7C 3MKLA 1HD3A 2VKNA 3HRTA 4UUTA 2Y4XA 5FD5A 3CLOA 2HSPA 2WSFE 4M7DE 1WI3A 1MH4A 2VGNA 4D5FA 2CU7A 1WZ2A 4IEJA 3BG6A 1WHKA 2FZGB 5GAMf 3ABTA 3GFLA 3NHNA 4AUXA 3CCLT 3WU0A 2I0NA 2K9GA 3X20B 3CCQI 3CCET 3E6DA 5TJJA 1D1AA 2QM3A 3I58A 1VOMA 3BG9A 3Q0UA 1BA5A 1VQ7T 4HCBA 3UA7A 3ULQB 1C1AA 2HR3A 4J19A 3FWEA 1KG1A 1SD5A 2E6ZA 3RI4A 2EGCA 2HNIA 4C92D 2HTJA 1IUFA 3G2BA 5FU7B 5JLXA 1WGXA 2PN6A 2WAEA 1WJDA 4D7MA 3LMMA 1HF0A 5D8KB 3RMSA 3QZ9B 1W5SA 2W84A 3E0JB 2LLKA 1Z91A 1YJ9T 4B8XA 1VQNI 3I4NJ 4XTZA 3QWXX 5FKMA 4N4GA 1U9OA 3OYBA 3RQIA 5DS9A 2P5KA 4U7DA 2D9TA 1I1GA 2E3HA 3SEMA 1W1FA 5FKLA 5J6XA 1MBFA 1I0CA 2MH9A 4HLXA 2GNCA 1R8OB 1X1CA 5DCFA 2G6FX 5FRMA 1HKSA 2HL3A 1OJLA 5FU6B 1M1GA 4XK8E 1X4PA 1OOTA 2W0ZA 2EWNA 2QA4T 1IV8A 1FIAA 1P9QC 2VPRA 4VUBA 3OR2C 1RESA 5DTDA 3IAM2 2HZTA 4QLCU 1QVFS 1ZKGA 2ZPHB 2MGQA 2OV7A 5EEAA 4RB0A 1FTTA 2RJEA 3P9CA 3VS2A 3CBPA 2DA4A 2PJRB 3PT9A 3SHWA 3ECOA 1VQKI 3ZCOA 3VS7A 5GMKm 4CI0C 4D0PA 3WTVC 5E8IA 2HQHA 2F48A 3LSPA 4LDVA 1M1KC 3OR1C 4EJUA 3I56Q 4OINF 1ZN2A 3X24B 5GAN4 2XGEA 4RM3A 5IP9J 3I54A 1X1PA 5L3DA 1R4MB 2OPTA 3GFIA 3HOWJ 1YG2A 5H6RA 2JOYA 3FIFA 4J9EA 3CMAA 3PSFA 4HVVA 3L2VA 3G6EA 3DQVC 3G71A 4I99C 2JVVA 1U5SA 2W48A 2FBIA 2VKVA 4L9VA 1UG1A 1S7EA 4BHCA 4A54A 1VQ9T 2KT0A 4HNTA 2K9SA 1YJNT 1D3BB 1FYNA 2BZXA 1WHHA 4ON0A 3CCRT 2YDLA 5K1YA 2E3IA 2HFHA 3C94A 2RKHA 4XLFA 1X75C 1FSEA 2FQ4A 2DYSH 2Y48A 2WAQN 1XDSA 3CCUT 1HSJA 3OIPA 2O4XB 1KZHA 4RG2A 4BY7J 3M0RA 2QAZA 2OCEA 2MC4A 4QQDA 2LT4A 1BK2A 2WSCE 1NH3A 1BI0A 5TISC 2GIVA 4M3DA 3HOZJ 3KXTA 3H92A 2AT1B 3M1EA 4Y15A 4RGUA 1Q81C 3JAME 1YCYA 3A52A 4UVCA 1CKAA 2GXGA 2VN2A 3KE2A 2EFIA 4E7JA 2RHIA 4IUTA 4EJWA 2DYRH 3MEUA 4MQ9F 2HKQB 5HLTA 3MPUB 5A2QE 4HDVA 2Z1DA 3OA6A 1IB8A 2CS7A 1Q1HA 1OR7A 3BDDA 3KLNA 1QPMA 4L5EA 5IN1A 3ZPLA 2XAUA 3MMYB 2JMAA 1Y8RB 4IOCF 4A3LJ 3SFMA 5LJ5g 3OW2P 3LGLA 1TQMA 3KUFA 4BU2A 2FL7A 5CVRA 2ACJA 2LMJA 4EJTA 2QGGA 3CCVQ 2LCCA 3QWLA 3Q5FA 1KONA 1JKPC 1D8KA 3KFVA 3V7CA 5CR2A 2DERA 5CKEA 4Y91A 4F7UF 2VJJA 2NUPA 2EQRA 3OYJA 1VQ6T 3HRUA 1IN5A 4GDFA 2OQGA 3QHSA 5GANd 4M4ZA 4B44A 3EDPA 2EYZA 2KYMA 3FXLA 4A0XA 4K2EA 4E7KA 3R4KA 1C0MA 1OYWA 1K76A 1FOWA 2LYCA 1AKHB 3NTKA 4XTXA 4PJOA 4EMGA 2DI3A 3CMEI 4BXFA 4GFBA 3MWMA 3V4GA 3QODA 1ZUYA 5BOXA 4FSSA 1Q86R 4YIRX 4UUVA 1K61A 1U5TA 4EJOA 3CF5F 2MH2A 1T38A 2X9DA 2KT8A 2NLUA 3EFRA 2XD0A 5ERIA 1OISA 1RI9A 2IJLA 2GBQA 1BYMA 1VYTA 3J7ZI 1Q95G 2CH4A 2CZ1B 1T95A 4ESBA 3GF5A 1KIKA 3I4PA 3PGGA 4HCZA 4B3XA 2KHMA 1VQ5I 1FYLA 4NS5A 1XSXA 3FEOA 5F0HA 3IH4A 1JGGA 2ABLA 4N4HA 2R5ZA 1YX5A 1ENHA 3FXRA 4RTWA 3OOUA 3EQLF 1JKRC 2L01A 4RGSA 3L2RA 2R7XA 2YLCA 2QASA 3DTKA 3BR0A 3BG3A 2VXEA 2G0EA 2RA2A 2K85A 1IXRC 4HV5A 1N5ZA 4OB2B 4AVZA 1N6AA 4CC3A 1NK2P 3RDIA 1VQ8Q 3X2QH 2RVCA 5HNHA 3WGGA 1E3PA 1ZAOA 3NAUA 2JA8J 3UWNA 4UUSA 4A3CJ 3OSSC 1Q81R 3CD6A 2IGMA 5FLXE 3G1MA 2HDDA 1S5LC 1FXXA 1M2VB 4KMUX 2RD1A 2QVOA 2DT5A 1HCRA 1W7PB 3C2BA 2OTJI 1JJ2P 1H8KA 3G4SA 1MGTA 2M4KA 5IHIA 2IS1A 1JHHA 2CP3A 3LA7A 1SFXA 2H94A 3DKXA 5JI6A 2FXAA 2JMWA 1OCTC 3HC7A 4RTYA 2MA3A 3SHFA 1CGPA 1UJ8A 4BH9A 4J8OA 4LN2A 4OMZA 2CSIA 2NS0A 5AT1B 1TU0B 1WJQA 4EMKB 2PFBA 1U8RA 2DXUA 1OCCH 1ULYA 2J05A 2QI2A 2XU8A 1M1FA 1PCXA 2KKOA 3E5XA 3L1AA 3H8ZA 2ZMEA 2VASA 3B6AA 3IWZA 5IXBA 1O7FA 2XPUA 2CUJA 3FF5A 4A4HA 4FX4A 5DCMB 1FYKA 1H641 4Z6YA 3J7YJ 1ZGWA 3M56A 4FYWB 2Y69H 1PHTA 2DA7A 2JPBA 1IO6A 2DD4A 3KEYA 2EGAA 3ERED 2DMUA 2OQRA 1Y96A 3EG9B 4CZCA 1MNEA 5HNFA 4G6QA 2ENMA 2GZWA 5JR3A 3H0FA 1IGUA 2HKXA 2Q8KA 5CVJA 3P9IA 4G6TB 2Q1ZB 3V8JA 1M4ZA 1LDJA 3RPUA 4LE9A 4DNCA 1FBUA 2QKLB 2ESWA 3JCMV 1I3AA 1SEMA 2MAMA 2I10A 3CCMT 3R0JA 1RUOA 4IUPA 2RNJA 1F4KA 2W25A 3QYFA 2X51A 4JDSA 4M77F 1S6LA 2X1CA 2V1XA 1X2QA 4G12A 1TNTA 2ESNA 4D6WA 3JB9G 4XTVA 1YLFA 5K5QA 1VQMI 1QVPA 2JUFA 5D4RA 3SEZA 2BV6A 2ZJQF 3PTAA 2A69F 2CP7A 4Q47A 4EMHA 3S8PA 3VYHB 2DPDA 3N97A 2DDBA 1B8IA 2KDOA 3E7LA 2UXNA 3LH5A 1R0CB 5IOZA 5E1WA 4HF1A 5KYUA 5DD8A 3K4BA 2H1LA 2WTEA 3CESA 4JZ4A 2UZKA 4BS9A 4JQFA 3OS5A 2LBFB 3QU6A 1GLNA 1R5HA 1VF9A 3GCMA 3PJRA 3CCLA 2XAJA 3M3YJ 3CCEA 1WJFA 2F2WA 1Y1VJ 2GOXB 2MLGA 3IP4B 5LD2C 1MV3A 2MSYA 1RZ4A 3JCMb 1KJWA 2R7UA 2FEZA 4A69C 1VQ7A 2LMDA 2XDPA 1PYVA 1WJRA 4P55A 1Y8QB 1K78B 3M4OJ 5KYWA 3HTRA 1SSFA 4EV0A 2BY3A 4N4OB 5L3FA 4XKWA 3VSKA 4KNYA 2Z9OA 5FO5A 5HDNA 2LQKA 1MH3A 3J7AW 2NAZA 1G2BA 4JRPA 2MUNA 4XRFA 2K7AA 3S14J 1UGRB 2IGKA 2NS7A 1F5TA 2VWFA 2YWWA 4BY6C 3H5AA 4LUEA 3HSEA 1V54H 4FYYB 1OQYA 3SB2A 5HK3A 4RBOA 5LEJA 3J80K 2X3XD 3KP3A 4OMQA 1Q86U 2FX0A 4II3A 1W5CC 2X1EA 5FGMA 1LVAA 4CDGA 1M8MA 3KP2A 1S1NA 5IT9E 1ETYA 1TP4A 3IC7A 1S7OA 3ABMH 3CC2I 2KQWA 4IIMA 3W3CA 2QA4A 3NGPA 4TVRA 3U2RA 5C3EJ 2QUFA 1DPUA 4MNUA 1T0JA 3ZMUA 2DW4A 2BE9B 2PI0A 1Y6IA 2CT3A 4M7DA 4EM2A 2X6XA 3ERMA 4PJOE 2XSDC 4L5GA 4CRIA 2XI9A 2HGCA 4HSRA 2KXDA 2DLLA 1YCSB 2DA3A 4U0WA 4M7AE 3OL4A 1XMAA 3BT9A 5CQEA 4EGZA 2LP0A 1POGA 3CCYA 3I53A 1CF7B 3EGDB 2VBZA 1ETWA 1GFDA 2RV8A 2VIXA 2FZCB 4X9CA 2A5WA 2JMCA 2DL8A 3M54A 4XOTA 5GPCA 1CQTA 9ANTA 1Y7XA 2YRDA 5K5RA 4ZZLA 1X69A 3ML6A 1SVMA 2D8JA 3GLLA 2XHCA 2DMQA 3GO5A 3HUGB 1AT1B 1N27A 2GQIA 4RTTA 2YPRA 1HDPA 3MAJA 3W6KB 2D5VA 4M78E 1YJNA 4G9YA 2HQNA 4KIGA 5DV5A 3CCRA 2O9LA 2EFQA 3KP7A 3E9FA 2KRNA 1UG2A 1H8AC 2AHJB 2O31A 3M8JA 4M75C 1ZG3A 2IW5A 2M45A 2DETA 1R00A 3KP4A 4D5CA 4F52A 1P4WA 1O3QA 2LTOA 4YTLA 2L9NA 4JYKA 3HOYJ 3CCUA 1LB2A 4EATA 2GWRA 2F5VA 5H2FC 2VPLA 1JXOA 1OPLA 1OPCA 1NEGA 1ZLKA 1Z9QA 5LGNA 3M55A 4KGXB 3JCMf 2V8KA 2BYVE 2JM9A 3KYDB 1D5VA 5C6SA 2COYA 2DPPB 1O4XA 2BOLA 1QGPA 2BEOA 2HPIA 4A3IJ 2GXAA 5HVQC 3GTKJ 3U1DA 1GVDA 1YO5C 5E18F 2E5ZA 1BN5A 2ZC2A 1NLPC 1WJ5A 4XLEA 1T3LA 2XAGA 2XC7A 4GYGA 1FPQA 2NOJB 5H6QA 2WV1A 1BB9A 1WNLA 1L0OC 3K0LA 4LB6B 3T8RA 3JRAA 2DMPA 1I5ZA 1XQHA 1W2BP 4HYEA 1Z3YA 3KP5A 1REPC 4XNFA 4ZJZA 2EJ9A 1IXDA 2ELJA 2KQRA 4PDKA 3E97A 2FHDA 3CPWP 4CHUA 1OX9A 3CCST 2E6NA 2EZLA 1MZBA 3AG4H 1OZ3A 3FB9A 2KIQA 4U0VA 4MHGA 1QCOA 1SKUB 3ZQ7A 3BG7A 5KHDA 2E12A 2L3QA 1DQUA 3PIPA 1TTYA 3PO2J 2DFEA 5K7ZA 4X34A 1BJAA 1W5TA 3M1CA 3RCOA 3UNGC 2AS5F 3S1QJ 1PSFA 1BL0A 2F5KA 4KGVB 4ZYHA 2MABA 4BI4A 4ZH4F 2BIVA 2EZHA 4XKVA 2P4RA 3CCJI 5E3LA 3REBB 1XB4A 4U88A 1GCQA 2KGTA 3K4MA 4HAMA 3FXQA 3I59B 1U8BA 1WYXA 4PL6A 2DTZA 5KVRA 4I0BA 5DD4A 3OYEA 3SYTA 2DO7A 1W0TA 1OYXA 2RHUA 4AFZC 1SVLA 2ZXWH 4XLAA 4IRHA 1V5FA 1XDUA 1BW6A 4HA8A 3CQZJ 4A3EJ 4IHSA 1IGNA 4BQQA 4F55A 3GW2A 4AYBN 4C2MJ 2E70A 3K4KA 3B73A 1S29A 1ORKA 2VXDA 2DRKA 2DJZA 2LDMA 2LH9A 3F21A 2J5PA 1UAAA 2XGDA 2MZ4A 4OIPF 2BVLA 3SZGA 3ONQA 4I02A 2NRAC 2OTLI 2HEQA 2GM4A 1N77A 1P2FA 4FYXB 1ZLMA 3JCMc 1VQLQ 2ECZA 3PL8A 1OI1A 1PP7U 2JZ2A 2BHZA 1OZ2A 1YI2Q 3CMYA 2K3XA 4BXXJ 2OTLT 1UEBA 4II2A 1UFMA 3B02A 3BR5A 1T33A 5DUKA 4E7SA 2C6YA 4IHXA 2GF7A 2R7WA 1K4TA 4ME7A 5I11A 4XRSG 1YIJQ 2J6OA 4K11A 2F5EA 3EUHC 4GGGA 5JFRA 1Q81U 4LITA 2BXYA 3GFMA 4ETSA 3WTWC 3OY9A 1E0EA 2X4XA 4CUGA 2RN7A 3U1KA 2K27A 3HP9A 5FW9A 2Y2ZA 5GAMe 3I56A 1ZSZA 2R7SA 5GAOp 2X3WD 3BJ6A 3ZOBA 3BP8A 3S93A 4E2FB 2K4JA 3VYSB 2F69A 5KYYB 3DCFA 1XSVA 4JS5A 3MQ0A 1EH8A 5D5WB 2D2WA 2XHKA 4DBRA 4BE1A 2MD5A 3JAMZ 4HDUA 2M1BA 4JX4A 4HXJA 2ZNYA 4J9IA 3OS2A 3DKMA 4C5IA 3V8KA 5LLQA 4FW1A 4DQ2A 5F1JA 2CUEA 1GV2A 2ME6A 1ZGAA 3WGIA 3FBNB 2PQWA 3TEEA 3QBYA 4B3AA 3FJ5A 3K9TA 3EFOB 5HS8A 1HDDC 3TO9A 1ZREA 4MGRA 4BQAA 1OEBA 2YHTA 1AU7A 2E1MC 3G3ZA 2LTPA 5LGTA 3SD4A 2L54A 3DF8A 3CMAI 4IQ4A 3G6EI 3ZEHA 3G71I 1LDDA 2VODA 2QXFA 3HL8A 4AFQC 3IH2A 4MTEA 3HEFA 3VS4A 4ZGDB 1YRNB 1SRLA 3DB3A 3M8FA 3EETA 1UGQB 2E4HA 2K3BA 4DBHA 2HU9A 1O3TA 4XTWA 5GAN8 2E10A 1K73R 3E19A 3CCMA 1BI2A 1WPKA 1O3SA 3GTMJ 1I1JA 1UB4A 1E2XA 3X28B 5IP7J 5ILUA 4RUGA 3BDUA 2AXLA 2PU9B 4BI8B 1ONVA 5EG0B 3ZQIA 1PSEA 3FXUA 1QP3A 5B3SH 2VC0A 1PG5B 1VIEA 2K02A 2P8TA 1AEYA 2EFNA 3I55Q 1I81A 1TNSA 3OYLA 2XG8D 8ATCB 2QEXT 1U3OA 2LVMA 2YUOA 4DGWB 1RUWA 4J6XA 4OP0A 1WRJA 1YJWT 5A2QK 1X43A 1XGSA 3K1NA 4IUUA 2DPUA 1UG0A 2L7KA 3CJQB 3NQOA 1PKSA 3C95A 3FK6A 1RETA 1BR1A 2DOFA 2Q2EA 2QQ9A 4ZN1A 2VE8A 4FE7A 3BR2A 2DMTA 5LRRA 4CO8A 2B9SA 1WQWA 2LZ6B 3QIIA 2ELHA 1BCOA 3E6BA 2OU2A 3DU5A 4BJ6C 1GDTA 4M75G 4RTVA 2DZCA 5IH2A 2X9HA 5GAN5 3OOPA 1NEBA 2K2MA 1AD5A 1I4K1 2RQVA 2BVMA 4YFNF 3OYDA 2ISZA 1N9SA 2A08A 2A5YB 1WA7A 3M0TA 3RKQA 4ASNA 5FLXZ 2B86A 1LJOA 1LE8A 4M77C 3PM1A 2ZKZA 4EIKA 1BM9A 4FETA 5H20A 3W2WA 2K5IA 2H3JA 3BTLA 3JSCA 1FP1D 4Z02A 2IT0A 3HTUA 2M9HA 3CBMA 2FUG2 4X0GA 1QKWA 3DB4A 2QSFX 2WB1N 2DO3A 3QPSA 3HKZA 2RO0A 1NK3P 2OCCH 4M9SA 5J40A 2IS6A 4FT2A 4CSWA 1EX4A 2MOXA 4A53A 4DOZA 1Q86C 4R55A 3HPHA 4YEJA 4I7HA 5CKFA 2M8GX 3CDLA 3H3VK 5LJ3g 2K4YA 2V1DA 5GMKe 2FRYA 2BW3B 4M77B 2HOTA 3TU4K 3MHXA 2AKLA 3BPXA 3TQNA 4MMKA 1LDKB 1YBYA 1RABB 2V6CA 3GOXA 3CC7Q 3JB9D 4OWRB 1MJ9A 2RPNA 3LSKA 3E1SA 2HKNA 5GAGJ 4LD5A 3RKYA 2HZDA 2GTJA 3P8DA 1FT9A 3AL0C 2H8WA 2A07F 4HSTA 5AYFA 2OAWA 3F8NA 3GXOA 1FSHA 2M0OA 3CUOA 3O3KA 2Y0SA 2G7HA 1UZCA 2LRDA 2DA6A 2ZCWA 3OYKA 1O57A 2B0LA 3CD6I 1UUEA 2DJQA 2VE9A 2JK3A 4FE4A 5FB2A 1OU8A 2DNUA 4QKUA 1EIFA 2I8DA 5GAMg 1BOBA 4AG2C 3SFIA 3J81R 2EW3A 1ABQA 1MGQA 3G4SI 1XC5A 1EKEA 1ZARA 5CJ9A 4ZDPA 2JUCA 1WJCA 2DEQA 4XU1A 3CD6T 2FBHA 2ZJPF 3LSMA 1YIOA 4M74A 2L9VA 2EYWA 2HCKA 4D8DA 3ZMZA 3AL0B 4AU7A 2GAUA 3L1PA 4C92E 3S2HJ 4LFUA 4L18B 4F7UG 2CT4A 4W97A 2PTKA 2XGCA 3I56T 2TDXA 4FL6A 1QVGP 3M57A 2NUTB 3J81Z 5CVVA 1NYFA 5F27A 3M4GA 4XLCA 3CDIA 3JR9A 5HY6A 4XSZF 1N8RR 3OSFA 4DJAA 3P8BB 2V8IA 2H09A 2E60A 2VUBA 1I39A 3VDXA 4C3HJ 1RKWA 3FJPA 1KD1C 2RM4A 2RDPA 3F23A 4BL0B 2DA1A 1VUBA 4FSXA 1K0XA 3URGA 1HSTA 3ER0A 4KISA 4OGEA 2E5NA 4M7AA 1WZOA 2CMPA 1IHWA 3Q9VA 1WDXA 2M7AA 3ZQHA 1BI3A 2GXBA 2MF2A 3TP0A 4X6AJ 2Y9YA 1DU6A 2MD0A 1GXQA 4LLLA 2BUDA 8AT1B 3WTZA 2DTHA 4KUIA 2RHXA 1Z0XA 3HPGA 3SZPA 4C0ZA 3CCSA 3I4MJ 2QBYB 1TUDA 1V76A 2WC2A 2R92J 2DL4A 5KH6A 3BTIA 4A3FJ 2LT1A 2JRTA 1QMCA 3Q9SA 2RHZA 1DP3A 1QVUA 2EH3A 3WHCA 2H3EB 3I64A 4M78A 5D6WA 4F17A 3S3NA 1SVOA 2M2EA 2Z16A 4WF2A 1NLOC 3P8HA 5CQXA 3GTOJ 1W1WE 2M87A 1BC7C 3CCVT 4PJNA 2JM8A 4OU0A 2YX7A 5I22A 2LJ1A 2W85A 1VA7A 2QQRA 2YUNA 5BQTA 2DJIA 1W7PD 3LOCA 3K10A 5EF6A 5EGOA 3OYCA 2JA5J 2M16A 2C06A 4M7DF 3ESWB 3CXCP 1QNTA 3CCLI 3CO7C 4OOIA 3S32A 3OBYA 4C0DC 2Z5UA 3CCEI 1XPXA 2E36A 2NS8A 3OYFA 2XB0X 1Q7YC 3RDVA 5KYXB 2F5TX 4E6RA 3CP2A 4PJ0C 3LGFA 2RQRA 1VQ7I 2VKHA 4AIDA 1OV3A 2KAFA 1DGWY 3FXMA 2RMOA 1WCMJ 1R1TA 2EZIA 2LY1A 2DBMA 2DVJA 3M5AA 4RG8A 4ZN3A 3SJMA 2FU4A 1A04A 1JE8A 1GBRA 1KQ1A 2EIMH 3BE3A 4ZC3A 4XQ3A 3HRSA 4BAYA 2E35A 2ESHA 2UXXA 2HSEB 2MYSA 4IJAA 2CRGA 4HOBA 3RIRA 2OTLA 1YJ9I 4JLGA 2AK5A 2EQIA 1JU5C 5GAOr 4JP0A 3COAC 2X6OA 3PQJA 2JN0A 1LPQA 5LJ5d 5IT9K 1AZEA 1BIAA 1MJAA 2W82A 4G6DA 3RSNA 3KLOA 4C0GA 2P5LC 2COZA 3E5QA 5I2SA 4FT4A 5HCKA 4FASD 1KQ8A 1BKBA 4XSXF 4J00A 3HPWA 3L00A 2AO9A 2DT7B 3LSGA 4KFCA 1IUYA 3BTCA 4NL2A 1M90C 2QA4I 5FLMJ 1GT0C 3ZGKA 1SSHA 1M3BA 4RGRA 3MJXA 2F4IA 2FJ1A 1FMWA 4I01A 2OI3A 4DEYA 4M77G 4D7NA 1Z3XA 2EBIA 2ZJ2A 4MO7A 4OMYA 2COWA 1MW7A 5GPAA 4JRIA 5KYNA 1A5JA 1CKBA 3C7JA 1VQ4Q 4KN4X 1HW2A 2M7BA 4F04B 3S3OA 3FRNA 1EV7A 2G7UA 2IA1A 3HIFA 2QGUA 3W6JB 4D1QA 3WVDB 4M75F 3O2PE 5LRSA 4NBQA 4RS8A 1Q82C 4Y92A 3PE0A 3F3XA 2P6SA 2STTA 1J7KA 1D1CA 1RI7A 3BZ6A 1VQ8T 3AT1B 2P7VB 3I35A 2FOWA 2FSWA 2BY2A 3MZ8A 3TKYA 4XU2A 2EFWA 2WY7Q 3L2UA 5GMKj 2LNVA 1PUEE 1X19A 2DU9A 4GRIA 3WTUC 2HTSA 2DTOA 3VUZA 3PIPF 1VQ9I 4CGZA 3REOA 2O88A 3JRGA 1W36C 3NPFA 1YJNI 1AWCA 1X2KA 2IAIA 2W57A 4M3EA 2ZSIB 5CKTA 5AONA 4EM1A 3CCRI 2BZ8A 2JNGA 3O8VA 1JO8A 4F92B 1Z21A 2A6TA 2L3DA 1R71A 1K73U 5JHUA 4B9WA 1IO2A 4L9NA 2OJ2A 1TWFJ 3CCUI 1ZG1A 1UHWA 1LFUP 2JJ9A 2R5AA 1UCRA 4QVCA 2IVMA 1EFNA 3H0GJ 4FISA 2PJRA 1RKTA 2R93J 1OR7C 2CUZA 2K86A 1U1SA 4E7HA 2K9LA 2QEXA 1C0WA 3EYIA 3ULRB 1TWHJ 1ZUUA 3MKZA 5KAFC 3BQZA 1IRGA 3P9KA 3K7AJ 1YJWA 1K9MC 1VI0A 1MNDA 2ZPEB 3RBBB 2P81A 1X2MA 4EPCA 3CMMA 4F93B 4KIBA 2NVUB 3F70A 2AIRB 2FF4A 1Y0UA 3UDCA 1JXSA 3SDZA 2DODA 1FBSA 5HDGA 1I3QJ 4M71A 5D6FA 2G9WA 5K7FA 1AOYA 1VQPA 1TT0A 1Y1WJ 4LJZF 4BEHA 2DFHA 1UE9A 3JB9J 2FMYA 3HBLA 3OSGA 4L0YB 2QTVA 4F14A 2PMHA 5GANe 4ZYGA 3JW4A 3JSOA 4IOAF 1RACB 1YE9A 1Z7UA 4IRIA 1XMKA 3RQ4A 3WU1B 1D5YA 4JZ3A 4LLNA 2JPCA 3O5ZA 2XSJC 1QKXA 2W00A 1VQ6I 2O4XA 4U0YA 3J7AY 2PMZN 1U5TC 3JCMe 4KJZA 1Q82R 1FOYA 2HQEA 4F91B 1B72B 5E1XA 2CW8A 2LOOA 3VOEA 2DMNA 2CREA 4MFDA 2NUPB 4ZGEB 2X35A 1V55H 1Z9ZA 4R79A 2F5DA 3LSRA 1OKRA 2CZ6B 3RKWA 2EFOA 5F64A 3H9JA 1M1KR 4FHTA 2MC3A 2XUBA 1B34A 1K7AA 2D6FA 4NDLA 4I2OA 3WTSC 2HDAA 5CIUA 3EHRA 3QOEA 4WWCA 1W70A 4CA0A 1CSKA 2M02A 4DIQA 5JLWA 3D0SA 4LOCA 2JSPA 2M35A 2MPXC 1U5TB 2MI6A 2PNIA 1PC0A 3RMQA 3GVAA 4HNVA 3DKYA 3SQNA 4IURA 3SWNA 1BIBA 1Y39A 4C5EA 1A0NB 3PO3J 1MBKA 2BGCA 1YITQ 1GXPA 4ITVA 4XLPF 3Q3SA 1KA8A 1QVTA 2EQKA 5D5UB 1XTDA 4HKEA 4AFSC 2LKXA 3GTGJ 2R5ZB 5CAIA 1QU3A 3QXEB 2JTVA 3FM3A 3WTTC 2A28A 2Z0WA 5BPDA 1K8AC 4LG3A 1F1BB 2XPWA 4C30A 3HOSA 2A7YA 3KIOA 2CUBA 2LC4A 2KZGA 5DYMA 3PNWC 4M75D 2PUOB 2CQQA 1NJIC 4GO1A 1KC8C 1JBMA 2KROA 2JTEA 2XVCA 4DW6A 2H6CA 4OB1B 1XX5A 4CICA 3OW2A 2HAXA 4H0EA 1SRMA 1RAFB 2QF7A 1VYUA 4XKCA 4FU6A 1V5GA 3LSJA 5EDNA 2GIZA 2PBIA 2ZMEC 3CCQQ 5C4XJ 5IXFA 4KUMA 3MFKA 4B48A 4A12A 1G4DA 1HOMA 3ZMDA 2W1OA 1ACIA 1XGMA 2X48A 3FBIB 5ILSA 2VLAA 5DDGA 1E3OC 3IWFA 3Q1JA 4JRKA 4Q5WA 1W4SA 2HBPA 1J75A 1DUXC 3H1CA 2HKOA 3S1RJ 2FA5A 2LSOA 1IRXA 5ILVA 3VS6A 1N8RU 5AIPA 3KETA 1BU1A 2M0MA 4LIUA 1ZG5A 2LNHB 3VB2A 5GJVB 1QVFP 3BR6A 3HYIA 4RMNA 5M5WJ 3VJPA 3NMZC 2K40A 4RCCA 3CTAA 3CEYA 4N9HA 1I6XA 1VQNQ 2BKDN 2NWMA 3VUBA 2ZMEB 4C8QA 3DLMA 3M9QA 2CZ0B 1IGQA 4WK8F 2OZUA 2R7FA 3S16J 3M07A 4O6JA 4BACA 3W2VA 2OZ6A 4I6ZA 1X58A 3HG9A 2JS0A 2KI7A 3LWFA 1T39A 2YLBA 2HOEA 2WAQA 4I76A 4F7ZA 1Y96B 3JSPA 5CYVA 2FG0A 1S72I 4Y17A 3CCMI 2ZPBB 2QKMB 1WJBA 5J1RA 2HNHA 3IH3A 4LGWA 3A02A 5D5VB 3L2QA 2JS2A 1X6GA 5FRNA 2P0PA 2DA5A 5E3MA 5BPIA 3OYHA 4II1A 4EMKA 4PLIA 4CZZA 4BBSJ 1U6GA 4E4HA 3LL7A 1M2OA 5FWCA 5KE3A 4DZPA 1QW1A 1S72T 4Y28E 2VKEA 3UATA 1VQKQ 3HSBA 2COMA 2H8RA 3JCMW 1FY7A 2LC2A 3DU6A 4ATOA 2XB5A 3CCVA 1WWXA 4C92A 4HF2A 4S0HB 1AWWA 1USSA 2BBYA 1O3RA 5DCMA 1ZLJA 2V9KA 3ZBDA 3GNGA 3WG7H 1PKTA 4HX8A 4N4IA 1WHJA 1JJ2A 1Z67A 3KCCA 4UXNA 3TW6A 3IV5A 2FO0A 2ZFWA 2LQNA 2RK1A 3MEWA 2FRWA 2YU3A 2JA2A 1B8IB 4KA4A 1W2BS 4XTYA 4QWQA 5LJ3h 2DOAA 1D09B 1LNXA 3J80R 1ZSGA 3UA6A 5GANg 1QZZA 2L89A 4BB7A 1G8XA 4XN0A 1B07A 3DLLF 3J81E 2ED0A 3EHQA 4HEA2 3GNFB 5DUIA 1EJ9A 3HHHA 2L0KA 3DPTA 1OYYA 1JT0A 2GQVA 2CGPA 1JGSA 3I9QA 4QIWN 1LFBA 1E6HA 4RCBA 1R4NB 3KEOA 4I0AA 1ZR4A 1J59A 2V1NA 4TV7A 2O8KA 1WIEA 1K79A 2YUQA 1UHMA 1J0RA 4PZJA 3K4LA 2EILH 4FT8A 1DPRA 3MKWB 1VQLI 3BWGA 1A31A 3RUXA 5KYWB 2M34A 5D5XB 4M77E 1MSEC 3FX3A 1ZK8A 2PJPA 2DFUA 2R5YA 1X1AA 4HLYA 1YI2I 2HI3A 4M7DC 4PJLA 2RI3A 2XIDA 5GAMh 1P7JA 5GAOn 2DXIA 1ZTRA 4XLNF 1EZZB 4KH1B 5GANj 1VQLT 1QHHD 2LBFA 3JRHA 4WTOB 2DK3A 2DIQA 5J3BA 4KN7X 2TCTA 3E6MA 2CS3A 5KK1A 5M5YJ 1R5GA 1U2WA 2YS9A 5GAOm 4V2GA 1YI2T 3HOVJ 3LWIA 3RERA 1Z05A 4N9IA 4XMYA 2YX4A 4LB5A 4HVWA 1T0FA 4DBFA 1VQ8A 1HJDA 3T8TA 2LRQA 3RZOJ 1YIJT 1N78A 2LY9A 3AAFA 5M3FJ 2I2LA 3C0CA 4X9DA 2V79A 2V9VA 3R0AA 3OV8A 4E6KG 3VPRA 4AG1C 4M72A 2R5MA 4OMOA 4M7DB 4R56A 2QQSA 2QSHX 3LWHA 2CUDA 1SF9A 3META 3TO7A 4A4GA 4BY6B 2EV5A 3EG2A 2JVHA 4BUGA 4WX9A 3FMSA 4M6VA 2R7RA 2KSSA 4QT7A 2NYSA 2L7FP 3PUFA 3UT1A 2V6EA 2A3LA 3CMEQ 2FPEA 1WLPB 1UHSA 3CDHA 1MDMB 4RAFA 1WQ2A 5ICEA 3WG9A 2Z33A 2DYIA 4HT9A 4M78F 2VJ4A 1DJ7B 1Q7YU 1G59A 4G7ZF 3E3VA 3K1MA 4RAGA 2GA2A 2EB7A 2XV4S 3HGGA 3V42A 3QWYA 1I6HJ 3CUQA 1LPLA 2E1CA 1TG0A 3QRFF 1VQ5Q 3LSTA 1VQOQ 1Y07A 4N0AA 1RRJA 2DM1A 5F1RA 2P0TA 1SFOJ 5GANf 1K0SA 1MIJA 3PMTA 2RQQA 3BQYA 3HRMA 1CF7A 3S17J 4AVPA 2O6GE 3C4SA 3P7NA 1G3TA 1S72A 2JUGA 1YTYA 4NUBA 4BUPA 2ZJRF 1TWGJ 3MO8A 5J8FA 1JEGA 5E20A 1VTNC 2QENA 2MWOA 2VQHA 1ACMB 4J5YA 3F6OA 4J7FA 4JOMA 2CFXA 1OULA 5GJWB 2P0KA 2OTJQ 1NHAA 1DGRM 4CYDA 2KNBB 4AM3A 4M77D 3OIQA 1WFXA 1PM3A 3A8LB 1SMTA 1R22A 3I55T 3CCSI 1FYMA 1FX7A 4M75B 2V9PA 3G1LA 1OCRH 4JX5A 4JBAA 1GCQC 4V19K 4MDXA 4IHVA 1MD0A 3IUOA 3RPQA 1X27A 2P4WA 2RHYA 1YW7A 1MHNA 1MV0B 2CQNA 5HS7A 5GAN6 2M8EA 4E7IA 3JRDA 1FEXA 1TUCA 1Q82U 2RI5A 1IN7A 3DPUA 2ZXJA 4FYVB 4MZMA 3DV8A 5GAEJ 2L8DA 1SANA 2XDVA 3MEXA 5CQYA 5L3BA 1V5EA 2KL4A 2W10A 2NOGA 4FX0A 4NHJA 2FVUA 3LQQA 3WTYC 1SG5A 5M9OA 1M1KU 4A3GJ 2LVSA 3KZIC 1I27A 4EVIA 2OF7A 4N0BA 4UV9A 4DBQA 2DZ9A 3K4CA 2DILA 1UELB 2HOAA 2JVGA 4PFPA 2M51A 4M9ZA 3LX7A 5FKKA 1YHQQ 5KCMA 3RYRA 4ESFA 3PNTA 1X6BA 3IAS2 1XTAA 4ANJA 5KYXA 1J09A 4IUQA 5F6FA 1QP2A 1OQKA 3OBWA 2FD5A 1T98A 5DM7F 2VT2A 1ZSZC 2A0FB 1I5LA 3KZYA 5E79C 1TW3A 5CKDA 2P6TA 4NC7A 4L6V5 1VQMQ 1RR8C 3M0PA 3GPLA 3NRVA 4LD9K 2D8HA 2MLKA 1PDNC 1JUMA 1IXSB 1S3JA 3MP8A 4ZYDA 2EKHA 2D0QB 4DA4A 1N75A 3TW7A 2A05A 3EGXA 1SFEA 1PJRA 4Q4ZF 2NVYJ 2VQGA 4MQVA 1WHGA 4A5MA 3CC7T 6AT1B 1M3AA 2XASA 3L2WA 3JRFA 1IRZA 1NZ9A 3MCAB 2K7LA 1W2BA 1KQ2A 4WXHA 1RAEB 4ZNXA 3FDRA 2CV2A 2DE0X 3PQKA 4EQQA 1O9SA 2JWTA 2QGFB 1ZH5A 1OCOH 3O8GA 4ENKA 1HYOA 3OYGA 2EBPA 4D8KA 5HK0A 3FC3A 3Q0WA 5BMZA 4J83A 1XCBA 3A2KA 4G7OF 3VRZA 3RNJA 5IAYA 3CPWA 2LY2A 3FZVA 3JCMQ 4J9HA 3A01B 1TZLA 3ZFJA 4OAYA 5IY5H 1XOVA 1FTZA 2FYKA 2P7CB 2Y4YA 5D7UA 1EH7A 4F7UB 1S8NA 2H6BA 4PNOA 2KLOA 3BROA 4YG2F 3FKJA 3SDGA 2XAQA 1GCPA 2LCSA 2K6DA 2ROLA 3GX4X 4NL3A 4HF0A 3ECHA 3RZDJ 2VUMJ 2MFZA 2C0OA 1MJBA 4RMOA 1QQIA 4UHTA 2FE3A 2JA7J 1EF4A 4M7DG 1PUFA 1G3YA 1ARKA 4XOPA 5J1YA 4A63B 3QYHB 5LJ3d 2EJRA 3M8EA 1M9SA 1PVEA 1HW5A 2K5CA 2QQBA 4NQWA 4RB2C 2DLPA 3LH0A 2QK0A 5CPRB 1IDZA 5A2QR 3NWTA 5F0FA 2MMPA 5C0MA 2XIGA 1T8IA 2KVQG 1ETQA 4C5HA 1VQ6A 2DRMA 2X4HA 4O5VA 3TOBA 3CC2Q 2O61A 2KXCA 3D7SB 3JRIA 3BY6A 2CP0A 3VYUB 1Y57A 2KP6A 4AFUC
chains in the Genus database with same CATH topology
5JVTA 3OYAA 5HDKA 3JTGA 2D45A 2V1UA 3V7RA 5LJ5h 4A2UA 3A8HB 2DQLA 1ZRFA 2P5VA 5GAMd 3MZHA 2XKOA 4HT8A 1BC8C 5GAN2 3JCMP 3IRRA 1G5VA 3JAMK 2KDSA 4QVZA 2XROA 2WV0A 5A0LA 2IA2A 1GVJA 4L9TA 2QDYB 3NTIA 3QPHA 3IKVA 4M6YA 1WKMA 1ON2A 3QU3A 5AIQA 1WPYA 4QW2A 5DLQE