1FX7A

Crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
230
Chain Sequence
b'MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IRON-DEPENDENT REPRESSOR IDER
molecule tags Signaling protein
source organism Mycobacterium tuberculosis
publication title Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
pubmed doi rcsb
total genus 73
structure length 230
sequence length 230
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain
A PF02742 Fe_dep_repr_C Iron dependent repressor, metal binding and dimerisation domain
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fx7A01
1.10.60.10 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Iron dependent repressor, metal binding and dimerisation domain 1fx7A02
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1fx7A03
2GXGA 3TO6A 1R36A 4HBLA 1MJAA 4D0PA 1KQ9A 4RGXA 1I6XA 2O03A 1RIOH 2NRAC 4HX7A 2E7WA 4YFKF 2QQBA 3BJOA 1T39A 1HBXG 2YR2A 3MFKA 5DCMB 4U88A 1J9IA 2PMHA 3KCCA 1TQMA 3JSPA 3IRRA 4Q47A 4E70A 2IP2A 3C1DA 2MLKA 4MGRA 2MBFA 2W25A 5BPDA 4EJOA 2TDXA 1SFXA 3EETA 1MKMA 3W6KB 1S8NA 2X4HA 4F7ZA 3V8JA 4RAYA 1QNTA 1OYYA 2KRFA 3FXUA 2ZMEB 1CF7A 2H6BA 4KYWA 4HF0A 5BOXA 1P4WA 2QYOA 2W85A 4EQQA 5BMZA 2D1VA 1J5YA 1O7FA 3BROA 2V1UA 2YX4A 2CW0F 4G7OF 2ESHA 3ZN1A 3P7NA 1KQ0A 1QW1A 4UVCA 3QU3A 3ISPA 4I98B 2CYYA 2L4MA 2UWMA 2IRFG 4LFUA 2E1NA 2C6YA 1O3TA 2B0LA 3WTYC 4ESFA 2W57A 3T1BA 2NS0A 1P92A 1ZRFA 2HKOA 3TQNA 1XCVA 4FHTA 4LB6B 4GXOA 3HHHA 1KU3A 1XGSA 2EFPA 2KIMA 2DTRA 4S05A 3F8CA 1ZG3A 2V1XA 3M7GA 3GWZA 3OOPA 3I59B 1HSJA 1Z05A 2EFOA 2K5FA 3BOQA 3JSOA 4HDVA 3HYIA 5HS8A 2ESNA 1YQAA 3EUHA 5FFZA 3E5XA 4PZJA 5D5XB 2OA4A 2IA0A 4R1HA 3K2ZA 2XKOA 5IT9Z 3GW2A 2L01A 4AD9A 5DV5A 4WXDA 3ERED 3ZMZA 4LMYA 1YS7A 2X0LA 4YIFA 3CLOA 2LNBA 4GYGA 1USTA 2RGVA 5LGUA 2FA5A 3ML6A 2FBIA 3O3KA 1F4KA 1TBXA 2VE9A 2NAZA 4I7HA 5HDKA 4HF2A 3FHZA 3HRUA 3KEOA 5DEQA 4CXFA 1IXSB 2EJRA 2QWWA 3GZ6A 3V7RA 1IN8A 1BI0A 1O57A 1QZYA 1QPMA 5FFXA 2FBHA 2JZYA 3KP7A 1PP8F 4LB5A 1PP7U 2HR3A 4QWQA 4EJWA 2IA1A 2W24A 4B8XA 4H0EA 4I02A 1SD5A 5LBQA 2M5WA 2A3SA 2HYFA 2R7FA 4HDUA 3GVAA 4KA4A 3ABUA 4RB0A 1ZAOA 4EMSA 5FLXZ 1K6OA 3V7CA 4I09A 3HTSB 3CUQA 4GO1A 4CICA 2FOKA 5ILSA 4IXAA 5ILUA 1YFHA 5CLSA 1MDMB 1ODDA 2CFXA 2VXZA 4RGSA 2H27A 4IRGA 3KEQA 3J80K 2K02A 3BY6A 1ZH5A 1VTNC 2M8EA 4HF1A 3REOA 5FD6A 1Z9CA 3M1EA 3GEZA 1XGMA 5KVRA 3HSRA 1TQIA 2F5FA 5DD8A 3DP7A 4HLXA 3VB2A 3LAPA 4G94A 1FNNA 2ZCWA 1U2WA 5K5QA 2QQ9A 3DXJF 4U0YA 3FWEA 3Q9VA 2FEZA 4A0ZA 3IRQA 4HA8A 3ZMSA 5EEHA 5E1XA 3ZMDA 3SXYA 1FP2A 3BP8A 3LA3A 1Z1DA 1Z7UA 3HSFA 4RAZA 4RS8A 4UHTA 4CZZA 4Y13A 1HKSA 2G9WA 2CGPA 2QVOA 3LQRA 2PFBA 1OKRA 4IPAA 2F5DA 2K5IA 4WWCA 2ZMEA 1XMKA 1XSXA 4ASNA 2A5YB 2VOOA 2A68F 3U9GA 1TNSA 3SZTA 4L9TA 2WC2A 3M9AA 1KU2A 3F6VA 1FT9A 3JW4A 1KU7A 4UVBA 1JXSA 3R0AA 2A69F 3O2PE 5E20A 1U5TB 1GXQA 1TTYA 2ZKZA 3F22A 1ZARA 1FSEA 3K1NA 1I1GA 5E18F 2Z9OA 2K86A 1HW2A 4I0AA 1XDSA 4FX0A 2BBYA 2K4JA 1OR7A 3LA7A 4EVIA 5ICFA 1G3SA 2J5PA 4A6EA 3HRSA 4AWXB 5L3CA 4WX9A 3T5XA 1FY7A 5IT9K 4LJZF 4AIKA 3V8KA 3HRTA 3T8TA 1REPC 2HGCA 3CUQC 4IJAA 4WCGA 3ZP5A 4LK1F 4ZYDA 3H3UA 1ZRCA 3WODF 2O3FA 4ETSA 5JFRA 1BJAA 1RUNA 2GA2A 3CUOA 1ZRDA 1B6AA 3KZZA 3DPTA 3HOTA 4KT5C 4DNCA 1TW3A 5LHGA 3FMRA 3DF8A 1GHCA 5H20A 1B59A 5DDGA 3HTUA 2DPDA 2KKOA 1YS6A 1U5TC 3R61A 1KYWA 2QBYB 2VBWA 4AIHA 1I5ZA 2RV8A 2O6GE 3QAHA 2BE5F 4MEYF 3E6DA 3RJPA 2ZFWA 4KUMA 4L0YB 3GYHX 2E1CA 2HDCA 1G3TA 2FMLA 3LA2A 4AIJA 4HAMA 1XB4A 1X3UA 2DLLA 2GIVA 3M8FA 3WGHA 4RGUA 2VN2A 4ZH4F 5J6XA 2BV6A 5HLIA 2EA4A 3I5UA 2HWVA 2JTVA 5D5VB 1GXPA 2MH9A 2MA3A 2XIGA 1V4RA 3DQVC 4XSZF 2IW5A 4OINF 2IA2A 2R7DA 3F8FA 3V4GA 2LKPA 2FF4A 1H9GA 3FX3A 1G3WA 4CO8A 1HXDA 2CO5A 2W84A 3TGNA 4IF4A 4JK1X 1QGPA 1MJBA 2FBKA 5DYMA 1PDNC 5LEKA 3F8BA 2V9VA 1QBJA 3D5LA 1BN5A 2K7LA 1SAXA 4HX8A 4O6JA 4P9UA 2CG4A 4HX4A 4I01A 2LF8A 5H6RA 3R60A 1GVJA 5L3BA 1W5TA 2LF7A 3GFJA 1KQ8A 5HDGA 4JBAA 3KP5A 2H3JA 2GAUA 2FU4A 2DI3A 1BC7C 1CGPA 1FBSA 2HOEA 2GCXA 3MWMA 2D2WA 4UNOA 1LJ9A 2PLYA 2WTEA 4MTDA 1FYMA 3HSEA 4XLPF 3R6SA 5ERIA 4U7BA 2F5EA 3K9TA 4GGGA 4M72A 1IN6A 1EH8A 2XAHA 4ZYHA 5LHHA 4G7HF 4L9JA 3H3ZA 4ESJA 1QO0D 3T0YA 4HQEA 1SD4A 3BJ6A 4CYDA 4LGWA 4L18B 2VT2A 4EJUA 3VFZA 4EM2A 2L3DA 4OIRF 5D6EA 4CGZA 4R8HA 4MQ9F 3TDUC 4CDGA 1D3YA 4ENMA 4MEXF 1HSTA 5CVVA 3IC7A 1R5HA 4R79A 1FP1D 1FYKA 4YG2F 4L9VA 3FF5A 2D1HA 5ED4A 1H0MA 5L3EA 1R22A 3C3WA 2GZWA 4EGZA 2DQRA 1YYVA 1B9MA 4UUVA 4O3MA 1O3SA 4DQ2A 2YSRA 1WKMA 1W7PD 2HQNA 5FD5A 3R4KA 2M1BA 2A07F 1U78A 4N9IA 1XGNA 2JPBA 1YW8A 4P55A 4G6QA 4RB2C 3RYPA 3OV8A 4YFXF 5EEGA 2ZXJA 2EV5A 2ADUA 4EGYA 2EA2A 2ISYA 2FSWA 4BHPA 1Q1HA 2P8TA 1IN7A 3KLNA 4OIOF 1KYZA 2ACJA 1J0RA 1ZN2A 3EDPA 1FBUA 1OYIA 1C0WA 4OIQF 4PCQA 2PI0A 3ZMTA 2QM3A 1S7AA 2BGCA 2MH2A 1LEAA 3GFMA 3ZN0A 2CWEA 1U6GA 1J7KA 4M73A 5HLHA 4A0XA 3EQLF 1TLHB 1MD0A 2HS5A 3TO9A 5E1WA 4ZYEA 3QPHA 3S2WA 5ICCA 3RI4A 1K78A 3F3XA 4UV9A 2HFHA 2L4AA 3DKWA 2VBZA 2EV0A 2DFIA 1RNLA 4EJTA 2QENA 3SZPA 3F72A 2ZBKA 3N4MA 2XAJA 3P9IA 1IZ1A 5D4RA 4RB1A 1D5VA 3DPLC 1HW1A 4NQWA 4HOBA 3MCZA 1DP7P 4FX4A 5LGNA 5BPIA 4A6DA 1JGSA 4M9XA 2RC4A 4KIBA 3LSTA 2OAZA 2P7CB 5AIPA 3WTWC 2DQLA 2STWA 4IRHA 3K0LA 2OQGA 2VC1A 4EM1A 4N9HA 5J8CA 2RDPA 4XSXF 2OD5A 2G7UA 3CO7C 1T6SA 5H6QA 5BS6A 2VBYA 1WQ2A 1LQ1A 3K1PA 3K69A 2GA1A 3JTHA 5LHIA 5LRSA 5F6FA 2MD5A 5CVJA 1R5GA 4M6YA 1MDMA 5D8LB 3IKVA 4RB3C 3TO7A 2G7HA 3JAMZ 2R3SA 3PQJA 3V7SA 3J7AO 1P4AA 3I64A 4UV8A 1SMYF 2A61A 1YIOA 3G3ZA 3WU1B 4BQAA 2NNNA 4KN7X 3IWZA 4G8XA 3TOAA 4U0VA 2FQ3A 4KFCA 3SHFA 5CVIA 3KFWX 3BPXA 5L3FA 3E6MA 4Q5SF 3RPQA 1YTYA 4BXUA 1R1VA 3N97A 5E1ZB 3F21A 4WK8F 1XMAA 5FB2A 1MJ9A 4WXCA 1XCBA 3KLOA 1FYLA 4L0ZB 2H09A 3WGGA 1IF1A 3HUGA 1SD7A 2P6SA 3ABTA 4FT8A 3BDDA 1T38A 2V1DA 1ZG1A 2VBXA 4KDPA 4Y17A 5K5RA 1DPRA 3FM5A 2IVMA 1R1TA 3MZYA 1R00A 4LLNA 1FX7A 2IT0A 2H94A 4HYEA 2EK5A 4BHBA 5HS7A 1IUYA 3IWFA 1DDNA 1LDKB 2DO7A 1QQIA 3IL2A 3GXOA 5HDNA 2VODA 2L54A 2ZNZA 5TJJA 2Q0OA 3MQ0A 2RN7A 2XROA 4L9NA 3E6CC 3BPVA 5E8GA 3ROUA 1LB2A 3WU0A 1KGSA 1IN4A 2GQQA 2XKPA 3WGIA 4M74A 4N0BA 3WG9A 4MNUA 2VE8A 4LG0A 2HEOA 3COAC 2LX9A 3KZYA 4PGGA 5L3GA 1BI1A 4I0BA 1ULYA 5CVRA 3ZMVA 1ZG5A 1XDUA 2PJPA 2Z33A 4JQFA 5HLGA 4KMFA 3RYRA 3KE2A 1BIAA 3WTTC 1FWZA 2DW4A 3RDIA 2XUBA 4HQMA 3GZ5A 3J81Z 1YO5C 1FBQA 1BOAA 1YG2A 3FM3A 4GYIA 1BBYA 3WE2A 3DV8A 4UVAA 1KA8A 4PGHA 1U3EM 2VONA 1FLIA 1ZLKA 3ZQ7A 1SD6A 2DK8A 2HTJA 1TQPA 1IXCA 2RKHA 3KP6A 1ZGAA 3MHXA 3VEPA 1S29A 2DU9A 2JSCA 1T98A 2VC0A 3KP4A 4U0WA 4BYYA 3H92A 1W4MA 3JTGA 1MGTA 3QPTA 2J5OA 3L09A 2XV4S 3MZHA 2CQKA 1BI2A 3W6JB 2K27A 5TRDA 3FZVA 3P9CA 5DCMA 1NHAA 3CO6C 4ENKA 1LDJA 1FOKA 3F8MA 3G73A 2IPQX 1Z6TA 2WV0A 1IW7F 3RIRA 2OU2A 2XVCA 2RNJA 2D45A 1KU9A 4MQVA 3CDHA 1ZLJA 1RI7A 5CVUA 5D8KB 4K2EA 1T0FA 4MTEA 1W7PA 1A04A 4RGRA 4IHSA 3SQNA 4Q4ZF 3WTXC 4I2OA 2OZ6A 2ZNYA 5JHUA 3I4PA 3B73A 3ZPLA 4BH9A 1S3JA 1J75A 1F1ZA 3I0TA 4HLYA 5AIQA 1YLFA 3U2RA 3IKTA 3ULQB 3WTVC 1ZREA 3ECOA 1P6RA 3KETA 5FGMA 2JPCA 2OBPA 3AAFA 3CUQB 4LD5A 5D5WB 4L5IA 2VT3A 1W7PB 2MC3A 2Y75A 5F1RA 1B9NA 4O5VA 2QUFA 1PUEE 3QOPA 1YW9A 1WWXA 2FMYA 4KMUX 1EV7A 2HQRA 2QZ8A 4ZZLA 3SFZA 4A12A 3P9KA 4OIPF 1OMIA 4Y15A 1IRGA 1JHHA 2XAFA 1HKTA 1XGOA 3E97A 2BEOA 1LDDA 3E6BA 3TOBA 1HKQA 4GCVA 1LVAA 1L3LA 1E2XA 2LDUA 4UXNA 3RKWA 1YW7A 4Q48A 2XASA 5ILVA 3L7WA 2E7XA 5CYVA 2P5VA 4EM0B 2PBIA 4KNYA 1O7LA 5HVQC 3HOSA 3TDZC 2PN6A 3QRFF 2EFNA 2CSOA 2L02A 4HV6A 5DUIA 4WF2A 3ELKA 3V8LA 4BNCA 2NYXA 3CJNA 4LK0F 3GUDA 1IN5A 4A0YA 4M9SA 1IRFA 4ESBA 4HW0A 2EWNA 2WWYA 3QP5A 5FO5A 3O6BB 3LAJA 4KIGA 1K7AA 2A6EF 4G9YA 5BQTA 1UCRA 1B4AA 2Z5UA 4LG0B 3F23A 1UFMA 1BI3A 2PEXA 2HTSA 3GFIA 2BYVE 3I54A 1XSVA 2Q8KA 1D8KA 1H9TA 5HS9A 3GX4X 1FSHA 4G6DA 3QP6A 4HV5A 5E17F 1USSA 4NB5A 2EV6A 1BYMA 5JVTA 2F2EA 2KJBA 3IHUA 2XAQA 1R1UA 3BZ6A 3KP3A 3C18A 4OU0A 1TNTA 3C7JA 3L2CA 1EH6A 1R7JA 3LFKA 2M30A 4HZFA 1G4DA 2EB7A 5DD4A 2PG4A 3WTUC 1R58A 3QU6A 2M87A 2STTA 2DT5A 1G3YA 3RPUA 2H6CA 1OPCA 1L0OC 3PFIA 6PAXA 2FNPA 2FNAA 1UHMA 4S04A 3HHGA 2ELHA 4ZYGA 2VOPA 4AVPA 1U8RA 2DK5A 4U7DA 4ON0A 2DPUA 1Y0UA 5KK1A 1FC3A 5D4SA 3NRVA 3RKXA 3VODA 4L5JA 5IT3A 5JI6A 3NEUA 1SFEA 3WTZA 5AONA 4LLLA 3JAMK 2UZKA 2AXLA 3FXQA 1BC8C 1J59A 3GO5A 2OZUA 5DCFA 1RZ4A 3BWGA 2Y48A 1Z91A 2V6CA 2XHKA 4XRFA 3RKYA 3NQOA 3FXRA 2GXBA 2HYGD 3I71A 1RUOA 2YPRA 1XN7A 1FZPB 2COMA 2A6HF 3DEUA 1TW2A 1AWCA 1LNWA 1W5SA 2Z3YA 3R0JA 3EYIA 2V79A 2Q2EA 5J8FA 3F6OA 3Q9SA 3L00A 2P5LC 4A5NA 1OYWA 2QBYA 3M8EA 5K5OA 4IRIA 4NHJA 1V3FA 3CTAA 2JT1A 2DAOA 3LQQA 5CJ9A 1UB9A 4IHTA 1R23A 2P4WA 3LWFA 5ICGA 1LEBA 2MLGA 1UHWA 4A2UA 1JHFA 3I58A 3F8NA 2ETHA 2HZTA 1JE8A 3PQKA 5LRRA 3GFLA 3DFGA 3MEXA 1MZBA 1ON2A 2M45A 1ON1A 1AOYA 3L9FA 3D0SA 1K78B 1STZA 4KICA 4ENNA 1SMTA 5ICEA 2YU3A 2Z99A 3J80Z 4OOIA 4M6XA 3I59A 4G7ZF 1P4XA 1T2KA 1XSDA 4M71A 2GWRA 5D6FA 2QLZA 2UXNA 5FLXK 4OMZA 5LLQA 3HRMA 2ZO4A 4PDKA 2EFQA 1HW5A 3FMQA 2O0YA 3I53A 4IVNA 1U5TA 1FPQA 1SFUA 4CHUA 5LEJA 3BJAA 1ONVA 1ZYRF 3ZMUA 1J2XA 1B1BA 4ZZDA 3J81K 4YFNF 1DPUA 2ISZA 1D8JA 1I27A 2QQAA 4P5OA 2XAGA 3ECHA 2FXAA 2K4BA 4BHCA 2O61A 4WXHA 1QZZA 4ENJA 5A2QK 1CF7B 1Z6RA 1F5TA 1WI9A 4EJVA 4A5MA 2HKXA 4OMYA 3VOEA 5K1YA 3E19A 4TV7A 3B02A 2K4YA 1EH7A 2FE3A 1HQCA 4BAYA 3GF2A 3TKYA 5D5UB 2KJCA 1P2FA 2EFWA 3K1MA 3HIFA 2PMUA 1QVPA 1O3RA 1F9NA 1ZHFA 4KIFA 3T8RA 1ZGJA 5LGTA 3KP2A 3U1DA 1DUXC 1BM9A 2PQ8A 2RVCA 1O3QA 2F5CA 2ZJ2A 2AS5F 2P6TA 2O8XA 2XGXA 5JR3A 4Z2YA 4XBFA 1S7OA 2XRNA 1WSUA 3E3VA 3WTSC 5L3DA 4XLNF 4M9ZA 2YX7A 1IAWA 5A2QZ 4MHGA 1S6LA 3MAJA 2FRHA 2UXXA 4P96A 2DBBA 2KIUA 2JRTA 5F64A 1IXRC 1G6NA 2P7VB 3E5QA 2IJLA 2P5KA 2LSOA 1WRJA 3Q5FA 1E17A 2KIFA 1XD7A 4EV0A 4KN4X 3EYYA 2Y0MA 5DUKA 2RQPA 2NNYA 3WE3A 1BIBA 2K5LA 5E8IA 1K79A 5HOOA 3RTRA 3FMSA 2OQRA 1I1SA 3GLXA 4LLGF 4QLCU 4B09A 3E5UA 4YIIA 4P9FA
chains in the Genus database with same CATH superfamily
2Q1ZB 2GXGA 5LJ5f 3TO6A 4F3QA 1R36A 4HBLA 2HQAA 1MUZA 1Q86U 1V1CA 2K9NA 1PCXA 1MJAA 4D0PA 2XGDA 4EMKA 1BKBA 1WHGA 1KQ9A 1H88C 3EG9A 2VKDA 4RGXA 2V9KA 1VQKQ 2ROTA 1I6XA 2O03A 4A63B 4LD9K 3CC7A 5IAYA 1R49A 1RIOH 1ZK8A 1S9HA 5CKTA 4ZDOA 1UJYA 2FZKB 2I2LA 2NRAC 1BA5A 1WHHA 3D1NI 2CSIA 3G1MA 2NYSA 4HX7A 2E7WA 2BHYA 3ZEHA 1VQ4A 4YFKF 2HQEA 3EGXA 2QQBA 3K4JA 2VV5A 5FKMA 2X4XA 3BJOA 2OF7A 2LMJA 1AHDP 3CMAI 1T39A 2L3QA 1HBXG 3M59A 2YR2A 1WJCA 3LMMA 4MFEA 1ETOA 3MFKA 1T8IA 1SF9A 5DCMB 1VIEA 4U88A 1J9IA 2FVUA 4AMCA 2PMHA 3KCCA 3CCQQ 1TH7A 1PYVA 2WV1A 4BGDA 5CQGA 1SVOA 4GLMA 1RI9A 1UFFA 1Y0MA 3CESA 1TQMA 2CQNA 2X48A 4M3EA 4XRMA 3JSPA 2BY1A 4A3GJ 4XL9A 2FL7A 3IRRA 5GAMf 4Q47A 4E70A 3L42A 2IP2A 2NLUA 3C1DA 4PJMA 4XTVA 2HQXA 1FOWA 2R4GA 2MLKA 2HVRA 3VYSB 1QA6A 3H5NA 3PSIA 2DA4A 2DIQA 4OVAA 4MGRA 2ZGWA 4Y28E 2CMPA 2MBFA 2EQIA 2XHCA 2DPPB 4M75D 2W25A 5J1UA 1N27A 5BPDA 1M3CA 1PVEA 3EH2A 4EJOA 1Q81R 2TDXA 2VI6A 1SFXA 4HKEA 1CQTA 1G59A 2BVLA 2L9VA 2F2XA 2XAUA 2EZKA 3PIPA 3EETA 4N4GA 1K76A 2NUZA 1MKMA 3M5AA 4RCCA 3W6KB 1IREB 4JZ3A 5B3SH 1S8NA 5GMKl 1WH7A 2J6KA 3PVLA 2Y31A 3UR3C 2ZJRF 1JKQC 4FW1A 5GANg 1MBEA 2QGFB 4QTRA 4QVCA 1X2MA 2X4HA 4F7ZA 3V8JA 1HDDC 1M30A 4RAYA 2DJQA 2LJ1A 2Y9ZA 1N77A 1QNTA 2I8DA 2BZYA 1OYYA 2KRFA 3FXUA 3GTQJ 2CT3A 5GJVB 3DWLE 3CPWP 3LLRA 1LOJA 1MNDA 5FJ8J 2ZMEB 1CF7A 4AYBA 2H6BA 5FLVA 3GZNB 4KYWA 1TWFJ 3IH4A 3C2GA 4UB6C 4HF0A 4IQ4A 5BOXA 4OB0B 1OPLA 1P4WA 2QYOA 3VYUB 2W85A 4IIMA 4IUTA 4EQQA 5BMZA 1RUWA 2D1VA 3M56A 1WIEA 1J5YA 3H9NA 1O7FA 1XG1A 2CV2A 1T3LA 3BROA 2F4MB 2V1UA 2YX4A 1GCQC 1BCOA 3A8LB 3A5ZB 1VQLA 2CW0F 4PSXA 4G7OF 2ESHA 1KQ1A 2V9PA 3ZN1A 3P7NA 2YLCA 4PLLA 1KQ0A 3OYGA 1YJ9Q 2JRMA 3M58A 1VQ9Q 1QW1A 4UVCA 2OCCH 4C8QC 1OV3A 3QU3A 1D3BB 3ISPA 1LE8B 4PL6A 2NUPB 2QTVA 3AG4H 3GTMJ 4NUBA 5GANh 1UAAA 2VUBA 4I98B 3CCST 1C0MA 2K57A 1UG0A 2CYYA 2IGKA 5A0GA 2L4MA 3KBGA 4M77D 2UWMA 2IRFG 1I8FA 1ETQA 4LFUA 2JS0A 4HNVA 1W0UA 1HLVA 4PJOD 2E1NA 2R0QC 2C6YA 2LQNA 3DKYA 1O3TA 2B0LA 3LNQA 2DXTA 3WTYC 4ESFA 5IYCJ 1RETA 4F04B 2W57A 3T1BA 3CCSA 2NS0A 4UUSB 2NXNB 1Y39A 1A5JA 1JUMA 1P92A 1ZRFA 2YUNA 2HKOA 1E3OC 2DL4A 3K4CA 4RG2A 3TQNA 1XCVA 2QDLA 2R7RA 4FHTA 4LB6B 3PO2J 4GXOA 2NWMA 9ATCB 3AG1H 1IV6A 2HPMA 1B7TA 2H8WA 4X34A 2VL8A 2VGNA 2GTOA 4M7AC 3CD6A 2CS7A 3HHHA 1KU3A 1XGSA 1ZKGA 2EFPA 2KIMA 2LTPA 1DU0A 1DP3A 1Y96B 3MP8A 3QWYA 2DTRA 1LJOA 4Z89A 4S05A 2DCEA 3F8CA 5HKCA 1ZG3A 3QUIA 2V1XA 3M7GA 3G71A 3GWZA 1M1EB 3OOPA 1WJAA 3QPLA 3AL0B 3P8BB 4XU2A 4AFUC 1KC8R 3I59B 1HSJA 4C3JJ 3UKGA 2VKHA 3EGUA 2UV1A 1YJ9A 1S7EA 2DMNA 1Z05A 2EFOA 2K5FA 3BOQA 3NPFA 3JSOA 4HDVA 2L2PA 3HYIA 4DBQA 5HS8A 4NC6A 4BUPA 3E9GA 1JKRC 1QVUA 1Q82R 2E34A 2ESNA 1YQAA 2Z0WA 3EUHA 5FFZA 3ONQA 3E5XA 2ZPGB 4XRSG 4C0DC 1KQSP 4PZJA 1RLQC 4DOZA 2HU9A 5GAGJ 2QA4I 4BJ5C 2GBYA 4JOMA 4MLOA 4F7UG 1ZBXA 5D5XB 2OA4A 1RABB 5B66C 3L2UA 2KR3A 2IA0A 1T95A 3CCVQ 3VJPA 4R1HA 4I99C 3K2ZA 2XKOA 3ZR8X 5IT9Z 1HA8A 1N5ZA 3O8VA 3S3OA 4V2SA 3GW2A 3RMSA 2VUMJ 2L01A 4AD9A 5DV5A 4WXDA 3ERED 3M54A 2MW8A 1V5EA 3OBYA 4JZ4A 1KC8U 3SB2A 4DYRA 3ZMZA 4LMYA 1YS7A 2X0LA 1X3ZB 1PKSA 2X9HA 4Y92A 3VRZA 4DEYA 1S72I 4YIFA 3KEYA 2DTZA 5I11A 2HCKA 3X25B 1BW6A 3CMEI 1UGPB 3CLOA 5J26A 1Z21A 2LNBA 4GYGA 3HSBA 1USTA 2X35A 2W1OA 4NC7A 2RGVA 1EX4A 5LGUA 3OYEA 3BG7A 4QPOA 3EG3A 4AG2C 1YI2T 2FA5A 3ML6A 2FBIA 3O3KA 1NPRA 3A0BC 2F48A 2BOLA 2DD5A 2OUMA 4FE4A 2LNVA 3B6AA 1K0XA 2G3RA 3QPSA 1F4KA 5KYYB 1TBXA 5GJWB 2VE9A 2E64A 2MSYA 2LVSA 2ECZA 1Q7YR 2NAZA 4I7HA 2Y2ZA 5HDKA 3G4SA 2V8KA 4HF2A 3FHZA 4NS5A 3HRUA 4D7NA 3KEOA 5DEQA 4CXFA 2YS9A 4JX6A 4JJCA 5KCOA 4Q5WA 1X1CA 3CF2A 1AHJB 2DTIA 1JTYA 2NVUB 1QVTA 1RC9A 1IXSB 5GMKi 1SFOJ 1VQNT 2K9SA 2EJRA 2QWWA 2SRCA 4IEJA 2EQUA 2ED1A 4PJOC 3DTKA 3RR6A 3GZ6A 4J9HA 1X43A 2QA4T 5E79C 3V7RA 1X01A 2KRNA 4PFPA 1IN8A 2OTJT 4JJDA 2I5UA 1FEXA 1RKTA 1OX9A 5FRNA 2M4GA 3QJYA 1BI0A 1EA3A 2WAEA 1WJQA 2JOYA 2ZCFB 1O57A 1QZYA 1Z7LA 2DMUA 4EPCA 1X6GA 1QPMA 5FFXA 4IOAF 1HSQA 1M9SA 1UECA 2FBHA 2JZYA 3FBNB 3KP7A 2HPIA 2JA6J 1PP8F 4LB5A 1PP7U 2HR3A 2NVTJ 4QWQA 3J7AY 1UEBA 2J6FA 2XDPA 4M75F 3MPUB 3A2KA 4EJWA 1A6QA 1B72A 2IA1A 2OTLT 3CC2Q 2W24A 3H5AA 4Y4RA 1M2VA 1O4XA 3FXOA 1Q86R 3P8DA 4B8XA 1X58A 1M1FA 3JB9F 4H0EA 2Q2EB 4I02A 3R6OA 1MMDA 2CGHA 4LDXA 2FOWA 1SD5A 3TL4X 5LBQA 2M5WA 3CMET 2J7IA 2A3SA 4KBMB 4XTWA 5ECAA 2HYFA 2R7FA 4HDUA 1BW5A 4OMOA 3G71I 2RK2A 2ELJA 3GVAA 1K83J 3CCJI 3OS5A 1SSFA 3BR3A 2X4JA 4KA4A 3I56A 5HNFA 3ABUA 3QZ9B 4FYVB 2E5ZA 2DMTA 4RB0A 4LUEA 3DBLB 1ZAOA 1ZSZB 2XPVA 4M75G 1UDLA 3CCLA 4EMSA 5FLXZ 3NARA 3V7CA 1K6OA 1LCKA 4FETA 4I09A 1OPKA 2RQVA 2GIZA 3N5BB 3HTSB 3U21A 5FLXR 3CUQA 4J9DA 4GO1A 4B48A 1W4SA 3SFMA 4CICA 2FOKA 5ILSA 4QW2A 4IXAA 4CH7A 5ILUA 4AC0A 4CCLA 1YFHA 5GAN2 1NYGA 2KZVA 2V4JC 1Z9QA 1QRYA 1ITYA 1K9MR 5CLSA 4S0HB 1MDMB 1ODDA 2CFXA 1S1NA 4RTUA 2VXZA 3JCMf 4RGSA 3QQAA 2H27A 1WJDA 3S1NJ 1E0EA 3PVQA 4IRGA 3KEQA 3J80K 2VPLA 2X4YA 2KDZA 3SJMA 2K02A 3BY6A 4A3JJ 1ZH5A 1K1ZA 1VTNC 4BE1A 3PFYA 3I4NJ 3JRDA 2A0FB 2E5QA 1SC7A 4ZJZA 1WNLA 3CPWA 2DT7B 2HL3A 3OSFA 2M8EA 1IGNA 3REOA 4HF1A 2DA5A 1K8AU 1VQMA 2HNIA 4AFQC 5FD6A 4C0GA 2QEXQ 1Z9CA 5GMKm 3CXCP 3M1EA 4M7AE 3GEZA 4KUDK 1SVMA 1XGMA 3I56I 1OU8A 5KVRA 2DF6A 3HSRA 3VYGA 1V76A 4C8QB 3J81E 1UELB 2BXZA 3ZQGA 1TQIA 2K2VA 2F5FA 2DA6A 1E3PA 5DD8A 3DP7A 1HDPA 4HLXA 2NUPA 1TWCJ 2X6OA 4XNFA 3SEMA 2FEIA 1VQOI 3CXCA 4KH1B 3VB2A 3I55A 2IG0A 3HC7A 3G4SI 1VQPI 4Y52J 3S2DJ 3LAPA 2AKLA 5A2QR 2L0KA 3PIOF 1AWOA 4G94A 1FNNA 3TP3A 2LDMA 2ZCWA 3HFNA 1U2WA 5F0CA 4RTTA 5IHKA 5K5QA 3CCJA 4ZDPA 2QQ9A 3CC2I 3IH3A 2L7MP 3C2BA 3DXJF 1H641 4U0YA 4YELA 2AIRB 4A69C 3FWEA 3Q9VA 3EGDB 2FEZA 2HL5C 3M4GA 5A0DA 4A4EA 3RQIA 4HCBA 2YUSA 4FQGA 4A0ZA 2DETA 1YJWT 3IRQA 2DFUA 2F6CA 2ZXIA 3ZOBA 3VKIA 4HA8A 5JLXA 4PJOE 4R0KA 3JV3A 3S32A 2R5AA 3CCEQ 3M07A 3ZMSA 5EEHA 5E1XA 3ZMDA 1S72T 3CCEA 3SXYA 1K4TA 1I39A 5LJ3e 2ZSHB 3JRCA 4AUXA 1QPIA 3H9JA 1FP2A 2QAZA 2EILH 1VQ4T 2VB6A 2KDOA 3BP8A 3LA3A 2KYBA 1AZEA 2QI2A 1Z1DA 1Z7UA 3HSFA 4RAZA 4RS8A 1YRNB 3OBWA 2BZXA 2LRQA 2FX0A 3Q3SA 4UHTA 3TEDA 1ENHA 1QWFA 5IY5H 2RHZA 2YU9J 2KQRA 3JB9H 4V19K 4CZZA 2MI6A 4Y13A 1HKSA 2G9WA 3OYYA 4XLAA 1ERDA 1OQKA 2QDYB 3TBIA 2CGPA 1WGSA 3VS0A 3VS7A 3O8GA 4ITVA 1RPWA 4M6VA 2QVOA 4FSSA 4L5GA 2E2IJ 1HK9A 3OYJA 4UB8C 2DO3A 3SEQA 2MVTA 3LQRA 2DOEA 2PFBA 2VJJA 1OKRA 4IPAA 2F5DA 2EQKA 2EYWA 1NK3P 3MP1A 1H3ZA 2K5IA 4WWCA 2O4XA 2RH2A 3QHSA 1Y57A 2HMAA 4U87A 4X0GA 4BY1J 5IOYA 3HP9A 5LJ3g 5EG2A 2LREA 1XMKA 2ZMEA 3G71Q 2RQUA 1XSXA 3PJRA 1GL5A 4IUQA 2KT1A 3KPHA 4ASNA 3BZKA 2P4TA 1B34B 2A5YB 2VOOA 2A68F 1IO2A 2PJRB 3MKDA 3U9GA 3HOXJ 1TNSA 4I76A 2C06A 5E3NA 3SZTA 4L9TA 2WC2A 2KDSA 3M9AA 1JKOC 3HJEA 2B7EA 1KU2A 3F6VA 2PUOB 1FT9A 3JW4A 3FIFA 1KU7A 5B1AH 3WHCA 1WLPB 4UVBA 3KX2A 2LCCA 4GLKA 3CC4I 1JXSA 3QYBA 1N75A 4A93J 3R0AA 2A69F 3HOVJ 3Q0VA 4N4NB 3O2PE 3UNGC 1SFKA 5CKDA 1VYUA 1Y56A 2AO9A 3VDXA 1K61A 2J06A 1LFPA 1TWHJ 4L5EA 2E3IA 4AG1C 5E20A 2R93J 3M9QA 2QKLB 4G12A 2DL5A 1X1PA 3NTKA 4M78A 3CCVT 3EFRA 2LK2A 1U9OA 2CU7A 1MNEA 1U5TB 1GXQA 3LSJA 4DBFA 2QEXI 1TTYA 5FROA 4Z02A 2ZKZA 3F22A 2BHZA 3FEOA 1ZARA 3QYGB 2MG4A 2EIMH 3AT1B 5GAN6 3Q0WA 1JTXA 3JRBA 3TP0A 1HJDA 5GAMj 1IGUA 2XSJC 4PUSA 2QASA 5CQYA 3PNWC 4IHXA 3GTKJ 3DPUA 1SAUA 2L89A 1RRJA 1PJRA 1I0CA 1VQOQ 5KNLA 1T08B 4FSXA 4LN2A 4M77G 3HOWJ 1FSEA 3K1NA 3NFCA 3CCRQ 4CA0A 1I1GA 5E18F 2Z9OA 3OS0A 2CSQA 2K86A 2D5VA 3HZJA 1QCOA 1XNIA 4C92B 1HW2A 4I0AA 2E1MC 1XDSA 1NYFA 4FX0A 3PFSA 4CUGA 2BBYA 2K4JA 1VQ8Q 4M7DE 1OR7A 3LA7A 1E6HA 1WQ7A 1YCYA 3HPWA 4EVIA 2DK3A 3WVEB 2YRDA 4ZYAA 3K6GA 5IYBJ 2JXBA 4PJOG 4XRSA 4PK4A 1LVKA 5ICFA 3GTOJ 1Q81C 4ABZA 5GAN8 1M27C 2DYBA 4KT0E 2Y9YA 5AYFA 1G3SA 3CC4Q 2J5PA 4A6EA 1N8RR 3HRSA 4AWXB 3OW2S 4DBRA 3QJ6A 5L3CA 4C8QA 4WX9A 3CEYA 2CH0A 3T5XA 1FY7A 5IT9K 4LJZF 1JI8A 1MBHA 4XQ3A 1BU1A 1EJ9A 3K4BA 4AIKA 3V8KA 3HRTA 1WX6A 3E2UA 3T8TA 1RAIB 4NNJA 1REPC 2HGCA 3AKZA 2GOMA 3JCMe 4DW6A 1AD5A 3BR1A 3CUQC 4IJAA 3IAM2 4WCGA 3ZP5A 4LK1F 4ZYDA 1WHKA 2A3LA 1UUEA 1UG1A 1YOVB 3H3UA 1QHHD 3OL3A 3OSSC 1JJ2A 5KCHA 1ZRCA 3HBLA 3WODF 2O3FA 4E7LA 1I4K1 4ETSA 5JFRA 1BJAA 1RUNA 4M78D 2GA2A 4PJ0C 1Y07A 1AKHA 5M5YJ 3ZQQA 2OC6A 3CUOA 3W2AA 3H3VK 2D8JA 1ZRDA 2DZ9A 3EHRA 3OIOA 3I55Q 3TSWA 4EDUA 1B6AA 1N25A 5KAIC 1OCTC 4HEA2 1E7OA 3HPGA 1YJWA 3KZZA 3DPTA 4RBOA 3HOTA 3CJQB 2BXYA 1WXUA 3I9QA 2ED0A 1ETYA 1H8KA 4DOWA 1K8AR 2FB7A 1XC5A 2JMWA 1IG7A 1LPLA 4KT5C 4DNCA 4M7AF 3PL8A 5HY6A 1YJNT 1QVGS 1KSWA 1ZUUA 2JZ2A 3BCAA 2DJNA 3E7LA 3MP6A 3RQ4A 1TW3A 1WJEA 3FMRA 3DF8A 5LHGA 1QCFA 4KGXB 1GHCA 4A3DJ 1RAAB 2A36A 3CXCS 3RESA 3M53A 1G5VA 5H20A 1B59A 5DDGA 3HTUA 4CSWA 2DPDA 2KKOA 2YSQA 4NQWB 1YS6A 1U5TC 2BE9B 1WZOA 3CCLT 2FQ4A 2M02A 4M3DA 3R61A 5E3LA 3OMGA 1KYWA 3UF4A 4A3IJ 2KRCA 4BU2A 3ERMA 3JCMQ 2QBYB 4CZCA 2VBWA 3C95A 5DY9A 3S8PA 5GANe 1VQNQ 4AIHA 1D0YA 3I5RA 5C4JJ 1I5ZA 2RV8A 2O6GE 1ZX6A 2XI9A 2WSEE 5KYXA 1J09A 1TWGJ 3QAHA 2BE5F 4MEYF 3E6DA 1N8RC 3RJPA 3HPHA 2ZFWA 4KUMA 3CCRI 2C0IA 2CP0A 3KXTA 4L0YB 3GYHX 5IP7J 1YCSB 1MBJA 1WHUA 2KRHA 2E1CA 4DEXA 2FPFA 2PQWA 2RPNA 3H0IA 4XIDA 1A35A 2K79A 2QQSA 3OY9A 1T0HA 2JM9A 2HDCA 3M0UA 1AA7A 1G3TA 2FMLA 3WU2C 2HDDA 3LA2A 4AIJA 2JJ9A 1V54H 4HAMA 4ZDLA 5EF6A 2YT6A 2E5NA 3ZCOA 2QSGX 1XB4A 1X3UA 2M0MA 3CBOA 2EIJH 2DLLA 2GIVA 3M8FA 3KIOA 3PM1A 3WGHA 4C2UA 4BXXJ 4RGUA 1TWBA 1VOMA 1R4NB 1RACB 2VN2A 4ZH4F 5J6XA 1OCOH 1F1BB 2KP6A 4IKFA 2EJFA 5KYUA 2BV6A 1MSFC 1X27A 2CT4A 5HLIA 3HDDA 3NAUA 4X9CA 2R5ZB 4XKCA 3HKZN 2CP7A 4J9GA 5GAEJ 5EZGA 5KYNA 2EA4A 2DA2A 3I5UA 3ZQHA 3S3MA 2PVOB 2HWVA 2JTVA 1XTAA 2X9DA 3B6CA 5D5VB 1GXPA 4LD6A 2MH9A 4HT8A 3A98A 5GAN3 5D6YA 2EH3A 2MA3A 3CQTA 1ETXA 1AWXA 2L9NA 2MFZA 3JRHA 2CH4A 4EMKC 1VQ9A 2XIGA 3MKLA 1M5Q1 1FMWA 2ZPBB 1BOBA 1V4RA 3DQVC 4F91B 3CCMI 1EZZB 2KBTA 3UA6A 1YHQI 1MV3A 2FYKA 1WI7A 3QDRB 4C5EA 4XSZF 2E10A 3S1QJ 2ID3A 2IW5A 2JUCA 1WJFA 2EQRA 2L9SA 4OINF 3CCSQ 2IA2A 2R7DA 3VV0A 2XB0X 3F8FA 1KQSS 1J3TA 2QSHX 1HOMA 3V4GA 3WHBA 2LKPA 2E60A 5GAMh 2F2WA 4E47A 2MGQA 2DX1A 2F5VA 4RKUE 1AEYA 2CV1A 4DYCA 2CUEA 4RAFA 1VQKT 2PU9B 2FF4A 1H9GA 3A4CA 3FX3A 4BD3A 4M7DC 1G3WA 2ZXWH 4CO8A 1HXDA 2CO5A 1ZTRA 3CZ6A 2AKKA 5K7HA 2W84A 4RDUA 1PD0A 3TGNA 3HOUJ 1YWOA 2R5YB 5D6XA 4XKBA 4E6KG 2P84A 3BQZA 4C3HJ 4IF4A 4JK1X 5FU7B 3JRZA 5CK9A 1QGPA 1MJBA 2O9VA 2FBKA 1M2VB 5DYMA 4XM3A 1SEUA 1UHCA 5J4VA 1PDNC 4RTXA 5GMKj 2M35A 4IX7A 5LEKA 4BE2A 3FLGA 3F8BA 4XONA 1JRIA 3EGDA 1VQOA 4HT9A 2V9VA 2FPDA 1QBJA 2P4RA 2HAXA 1GBRA 3NWTA 3JCMV 4JUVA 2WAQA 3MVPA 2KEAA 3D5LA 1BN5A 2K7LA 3DEEA 1LPQA 4J9CA 1YX3A 1VFCA 2DKGA 3CMYA 2PUKB 3AHUA 4KISA 1SAXA 1WXBA 4HX8A 2XG8D 3NTHA 1IRZA 4UUTA 4O6JA 3KYCB 1RAEB 4J00A 2DFHA 2TRTA 4P9UA 2CG4A 4HX4A 3SZGA 4KGVB 4I01A 2LF8A 2QQ8A 5H6RA 3QBYA 3R60A 1GVJA 5L3BA 2X4WA 3J80E 2CV0A 3RNJA 1W5TA 2EZHA 2VKVA 1YIJI 1Q82U 3BTJA 2AHJB 2OX7A 3BG9A 2LF7A 3GFJA 1POGA 2LR8A 4NBQA 2JA2A 2QEXT 1KQ8A 4BUGA 2EVRA 1VQ7Q 5HDGA 1IDZA 1ACIA 1QVFA 4JBAA 3BDLA 2ID6A 1TT0A 5IP6A 3KP5A 2M16A 2HI3A 2GAUA 2H3JA 1FIAA 1D1AA 5DM7R 4LIUA 2FU4A 2EQMA 2DI3A 1PSFA 1BC7C 4RA2A 1Z3XA 3A0HC 2RI3A 4F14A 1JQQA 1CGPA 1W1FA 4J8OA 3CCLQ 1W2BA 2ATCB 2RQWA 1FBSA 4A3BJ 2DE0X 2HOEA 2GCXA 4HCCA 4M7DD 3VYRB 4E2FB 1PUFA 1GVDA 3MWMA 4JPBW 1VQ8T 3M4YA 3CC4T 2EAYA 2D2WA 1I6HJ 4UNOA 4JRPA 1YJNQ 1LJ9A 3S93A 3OMYA 2V7FA 2B9SA 1XPXA 5DM7F 2WTEA 2PLYA 4MTDA 2LP0A 3L1PA 5CQXA 3H6ZA 4AT1B 1FYMA 4C8QF 3LSMA 3HSEA 4XLPF 2M4KA 3R6SA 5ERIA 4U7BA 3UA7A 5E3OA 2KMTA 1K4US 3OYNA 3OYIA 4ELYC 2F5EA 3K9TA 4GGGA 4KJZA 4M72A 5KYWA 1IN6A 1EH8A 2XAHA 2GBQA 2DTOA 4ZYHA 3GBGA 5LHHA 1JU5C 2IBDA 4G7HF 2RA2A 4Y3OA 2HSEB 1WCMJ 3BZCA 1NEBA 4CC7A 2ICWG 3H3ZA 4L9JA 3CLQA 1APLC 3C2HA 4ESJA 4JS5A 1VQ5A 3CCMQ 1QO0D 3T0YA 1VQPA 4HQEA 1SD4A 2Y30A 4BJTA 4A53A 3BJ6A 4CYDA 4WCIA 4LGWA 2EQJA 4L18B 1B8IB 4MFDA 1JUPA 3G1JA 2VT2A 4EJUA 3VFZA 1JXOA 4EM2A 3GTJJ 2R7UA 1KG1A 2L3DA 1VQ5T 4OIRF 2ZZDA 2PX9A 5D6EA 4PKCC 1JJ8C 3LSIA 2VASA 2NS7A 4R8HA 4MQ9F 3TDUC 5HNHA 1RR8C 4CGZA 4CDGA 1VIFA 2EIKH 4QQ6A 1D3YA 5EYRA 4ENMA 2NOJB 2AQEA 4MEXF 1P7JA 4V2GA 5F08A 1MHNA 5LJ3h 1HSTA 5GTIC 3H36A 4IL6C 5CVVA 3META 2LTOA 2V1QA 2DDAA 1R5HA 3IC7A 1FP1D 4R79A 3BDUA 1QVFP 3LL7A 4M3BA 1FYKA 1ZELA 4YG2F 1K8AC 4L9VA 1Q81U 2MAMA 3VS4A 2YRCA 2FRYA 4MZTA 2JMAA 3REBB 2HDAA 3OMCA 3FF5A 4IHWA 2D1HA 4XKWA 4HNUA 1UGQB 1W2BP 5ED4A 1ZQ3P 1KK7A 3CPFA 4RAGA 2OTLQ 3A01A 3FC3A 3CC7Q 1M1KR 3OYDA 1H0MA 5L3EA 1TUDA 2KI7A 5J1RA 1X75C 2XD0A 3RERA 1ZLMA 1VQPQ 1R22A 1MH3A 3GNGA 5IN1A 2X1EA 5FU6C 3QYEA 3C3WA 1KHIA 1ZR4A 4MDXA 2GZWA 2KMUA 1IB8A 3FDRA 2H1KA 4P1WA 4EGZA 2JA7J 1D09B 5D7UA 2DQRA 3K4NA 5GPCA 2DL3A 1YYVA 1B9MA 2R7OA 4UUVA 4O3MA 3CCUA 4P5NA 1O3SA 4CC4B 4DQ2A 3INZA 1NG7A 1WKMA 2YSRA 3CMAA 2DEUA 1U06A 1XTDA 2FD5A 1W7PD 2HQNA 5FD5A 2QGUA 2R92J 2FO0A 2GFUA 4H4KC 3R4KA 2FUG2 1U9NA 2AZSA 2HOSA 2M1BA 3ZXSA 2BKDN 2D8HA 2A07F 4BQQA 4JRKA 4LDVA 3I56Q 3CMEA 2O5RA 2EFIA 2D0QB 2KQWA 4KUIA 4C0DB 1YJNA 1YHQA 1U78A 1G2BA 1WHJA 1NG6A 4N9IA 4GFBA 5GPAA 3A8GB 1XGNA 2BY0A 4RM2A 4M77A 5CKEA 2CYZB 4FYYB 4OMQA 2JPBA 3S2HJ 1HD3A 2J05A 3DKMA 1YW8A 2M7AA 5D6WA 3GPLA 4P55A 5C3EJ 3J81R 4G6QA 1JB0E 1XOVA 3SWNA 4RB2C 3RYPA 4CCOA 4E4HA 3OIQA 3OV8A 1TTHB 4YFXF 4A3EJ 4OAZA 1NK2P 4M77B 5EEGA 3E0JB 5GAMe 2D6FA 4BE0A 1T0JA 3EHQA 4F7UA 1I5LA 2E2JJ 2ZXJA 1AZGB 2KYMA 2TCTA 4OP0A 3I55I 5KCMA 2EV5A 2ADUA 2ESWA 5IH2A 1DQUA 3G4SQ 4EGYA 2EA2A 2KVQG 4CRIA 2HD0A 2ISYA 2FSWA 1GT0C 2AXTC 3ZQIA 4BHPA 3G6EA 1Q1HA 2P8TA 7AT1B 1IN7A 3KLNA 3Q0UA 4B43A 1YNZA 2H8HA 4JDSA 4DZPA 3PIOA 2E41A 1YJNI 4OIOF 1X3WB 2K9LA 1ZA1B 1KYZA 2DBKA 2ACJA 2WY7Q 4GBQA 1J0RA 1ZN2A 2EKHA 3EDPA 1FBUA 1OYIA 4DIQA 1C0WA 2JWTA 4OIQF 4PCQA 2PI0A 3G6ET 3ZMTA 1W2BS 2QM3A 1S7AA 3DTIA 2BGCA 2MH2A 1LEAA 4N0AA 3R6NA 2Y69H 2P81A 4ATOA 1NBEB 1D3BA 4ORZA 1VQOT 2R7SA 1WZ2A 3BTLA 4CI0C 1ABQA 1KONA 3GFMA 3ZN0A 2CWEA 4OMPA 1U6GA 2W82A 1TXQA 1J7KA 4M73A 5HLHA 4A0XA 3BCBA 3EQLF 1KC8C 1TLHB 4II2A 4Z6YA 1MD0A 4FASD 2HS5A 3TO9A 4IIOA 4CC3A 5E1WA 3NGPA 4RLQA 2JK3A 4ZYEA 2DYIA 3RUXA 5IHIA 3QPHA 3S2WA 5ICCA 3RI4A 4KT6A 1SEMA 2ZPFB 3NHNA 3BQYA 3TW7A 2B8AA 2E6NA 4QIWN 2MPXC 1K78A 4M78B 2JA8J 1OISA 4XICA 1YFNA 2BVMA 3F3XA 3RZDJ 4UV9A 3X26B 2PVGB 1JUSA 2JVHA 3MKZA 2HFHA 2L4AA 3DKWA 4J6WA 5GAN7 1ETVA 2VBZA 2EV0A 2DFIA 1RNLA 3FXJA 3CCQA 1EF4A 3BR2A 2DXUA 1GV5A 3LSPA 4EJTA 2QENA 3SZPA 3DLMA 3OYBA 1D0ZA 1OQYA 4MMLA 3LSKA 1AVZC 2ZFUA 2ZBKA 2ZC2A 3F72A 1SVLA 2XAJA 3P9IA 1IZ1A 3N4MA 5D4RA 3SFIA 4G6TB 4RB1A 2MWOA 2PNIA 1D5VA 3DPLC 2RJFA 2WAFA 1VQMT 1SSHA 3PNTA 1HW1A 1ZR2A 1IJWC 3LX7A 4NQWA 3I3LA 1Z0XA 2VQHA 2IS6A 3V42A 4HOBA 3MCZA 4UC4A 2XKOC 1DP7P 3CCMT 1AU7A 1JBMA 3BG6A 4FX4A 3GTPJ 1R0CB 4GRIA 1PG5B 5LGNA 4LDWA 4N4HA 4E6RA 5HK3A 3CJTB 4A6DA 5BPIA 2WB1N 3KZIC 3M57A 3G71T 1M4ZA 4IO9F 1NPPA 1JGSA 1MMNA 4M9XA 3AG3H 4RTYA 2QGGA 2Z2SB 2RC4A 4KIBA 2E4HA 2RHXA 3LSTA 2HQ5A 2OAZA 5IXBA 2DXBA 4JRIA 2P7CB 3DBRB 3CCUI 4CCNA 4FYXB 2EZIA 1MBGA 5AIPA 1WJBA 5FU7C 2HOAA 5FKKA 3WTWC 3SD4A 1X1DA 2DTHA 1MIJA 5EG0B 2RI5A 1LFBA 3OYLA 3F9KA 1B72B 1VI0A 3TEEA 3CD6Q 3QZ5B 2DQLA 2X1DA 2STWA 1KQ2A 4D1QA 3L2ZA 2DOFA 4IRHA 3UPUA 3K0LA 2OQGA 3PO3J 2VC1A 3DLLF 1KJWA 5IOZA 4EM1A 4N9HA 4C92F 5J8CA 2MOXA 4OB3B 1DGWY 3D5RC 2RDPA 5DLQE 2BY2A 1X4OA 3G4ST 1GFDA 5K7FA 4XSXF 3JCUC 2OD5A 1E3HA 1GCPA 1RI0A 2XIDA 3SWNB 2G7UA 4JJBA 3FK6A 2LVMA 3CO7C 2OV7A 1T6SA 4C3IJ 5EGOA 3FJ5A 3CCJQ 1AWWA 1M3BA 5H6QA 1RR7A 5BS6A 2Z16A 3UWNA 3LW5E 2IGOA 4XR6A 2COZA 2VBYA 1WQ2A 1SANA 3K1PA 1LQ1A 3K69A 2YHTA 2GA1A 3EG0A 1XMXA 2F1LA 4M77E 3JTHA 1O9SA 5LHIA 5LRSA 2X3WD 3GTLJ 1VA7A 5F6FA 1UG2A 1U3OA 5C6SA 4F16A 2H3EB 3TSZA 2COWA 2MD5A 2BY3A 4XTZA 1V55H 2DAQA 4A4FA 1KD1R 1D5YA 3CC2A 3I9V2 3OOUA 1VF9A 5CVJA 4J6XA 4RTVA 5GMKe 3CCLI 3D7SB 4V2FA 1R5GA 4M6YA 3GNFB 2EBIA 2VKEA 2EJGA 2E5KA 4DGWB 1MDMA 5D8LB 4F55A 2DYRH 1KZHA 1ZUKA 2JUGA 1QVGA 4PFZA 5J1YA 4XOPA 3KYDB 1VQ8I 4QPQA 4ZGJB 4XTUA 3OB9A 3J7ZI 5F04A 1M8MA 2WBMA 1BR2A 1M1GA 3IKVA 4RB3C 3TO7A 3QO3A 2G7HA 3JAMZ 2R3SA 3PQJA 3M0PA 5GAOl 3V7SA 2DMPA 3OS2A 3J7AO 3OYHA 4XAXB 1TU0B 3BW1A 3OYCA 4W97A 2M1HA 2KT8A 1WHMA 5FWCA 1UHFA 1P4AA 1W0TA 3I64A 1VQ4Q 4UV8A 2EINH 1SMYF 5CQEA 4BACA 4C8QD 4C5GA 2X6YA 1BR1A 2HKQB 2A61A 1YIOA 3G3ZA 3VSKA 3WU1B 4BQAA 1C6VX 1WJSA 2KRSA 2ZAEA 2DA3A 2IVWA 3HL8A 2NNNA 1IHWA 1IRXA 4JS4A 3P5JA 4KN7X 4QKUA 4BQNA 5J39A 3IWZA 3IQLA 1CKBA 4G8XA 4BY7J 1GDTA 3FB9A 3MEUA 4DOVA 2XGEA 3CQZJ 1K4SA 3TOAA 4U0VA 1OJLA 2J6OA 1TT5B 3CD6T 1Y8QB 3PMTA 4HXJA 3BT9A 5I2MA 2FQ3A 4KFCA 2QQRA 3PGGA 3SHFA 3GTGJ 2LX7A 2YUOA 5CVIA 4C92E 1DGRM 2IAIA 1YJWI 1ACMB 2M8GX 3KFWX 1VQNA 4I6ZA 3TCJA 2JTEA 3BPXA 2QF7A 1BCMA 2R5ZA 2G0EA 2D0NA 4JJNK 5L3FA 3E6MA 4Q5SF 2FJ1A 3PNYA 3WVDB 3RPQA 3A8MB 1YTYA 3FISA 2PTKA 4BXUA 1K9MU 1R1VA 3N97A 5E1ZB 2EGEA 4M77F 3F21A 3PE0A 4WK8F 1XMAA 5FB2A 1MJ9A 3BTIA 2A05A 3CCEI 3OYFA 3A01B 4IUVA 2ZPEB 4LE9A 4WXCA 3QDFA 1XCBA 1FTTA 2IIMA 5CKHA 1VQPT 1YI2A 2R7QA 2JJ7A 5H2FC 2VIXA 3KLOA 5K7ZA 1FYLA 4L0ZB 2R7ZJ 1B3QA 1I81A 4FIBA 4B6MA 2H09A 5GANd 2K6DA 1W1WE 3WGGA 1OCZH 4PJOB 1R77A 3SDGA 1X2NA 3HUGA 1SD7A 2P6SA 1IF1A 3VRYA 1Y8RB 3ABTA 3JCMh 4WTOB 1QVFS 4FT8A 1KIKA 2QTXA 3BR0A 3BDDA 2K85A 1T38A 2V1DA 4XN0A 2R7WA 1ZG1A 2VBXA 4OWRB 4KDPA 1X6BA 2P0QA 2XK0A 4Y17A 2HVSA 1QMCA 4Y91A 2IPOB 5K5RA 3CC2T 1DPRA 3CJRB 1TS9A 3DB4A 4RTZA 3THKA 1WVRA 3JCMg 1GXIE 2DA7A 3MO8A 2DA9A 3FM5A 2CH4W 1ETWA 5GAN5 3H8ZA 3MMYB 4X1EA 2Y0SA 4RG8A 5HCKA 4RMOA 1ABOA 2IVMA 2W48A 1IDYA 3BG5A 2O8KA 1R1TA 3CD6I 1WDXA 2WADA 1YI2I 2JMCA 3MZYA 1Q95G 4F93B 4LITA 1R00A 1VQ5Q 1YITA 5F0HA 4LLNA 1FX7A 1Z9ZA 3A8HB 3ASNH 2LRDA 4BXFA 3LH5A 2L7ZA 3GF5A 4VUBA 2IT0A 3EH1A 2E12A 1UGRB 2RM4A 3BR5A 4OMLA 2H94A 2GF7A 4HYEA 4ZGDB 2EK5A 4BHBA 1UMQA 1K9MC 3DLLA 2AQFA 2X6XA 5L23A 5LJ5h 3L2QA 4QT7A 3OW2A 1YITT 5HS7A 2DOAA 1QCNA 3M1CA 3IWFA 4EATA 1DDNA 1IUYA 4C8QG 5B1BH 1LDKB 5M5WJ 2E36A 3MKWB 2LC2A 1LFUP 2H8RA 2HOTA 1HYOA 2DRKA 2DO7A 1QQIA 5E3MA 1I3QJ 3IL2A 4IHVA 3JAMR 1VQLT 3GXOA 1RQ6A 3SEZA 5FKOA 1QKXA 3A8OB 5HDNA 1TUCA 2KIQA 2YWWA 3KUFA 2VODA 4LDUA 1XS9A 2OTJA 1NZ9A 3VUBA 1NM7A 2F69A 2L54A 2ZNZA 2KL4A 1NH3A 2KAFA 2M0OA 3FKJA 4F7UF 1LE8A 2DODA 3LSHA 3S1RJ 2DIGA 5TJJA 3JRIA 4CCMA 2FG0A 2R57A 3ZFJA 3LGLA 3JAME 3HUGB 1A36A 2COYA 2Q0OA 2GTJA 3BE3A 5CCAA 4YEJA 5GAOn 2KZGA 2RN7A 3MQ0A 2XROA 1AKHB 3AL0C 4M7AB 5KE3A 4L9NA 3J7AW 5A2QE 3SDBA 1R4MB 3UT1A 3E6CC 1N78A 1OX8A 2GQVA 3BPVA 5E8GA 3ROUA 3KYLA 1TL8A 1LB2A 3EG1A 3WU0A 1KGSA 1IN4A 3VWBA 1QP2A 4J6YA 5I2SA 2WSCE 1WFXA 3E9FA 3DBHB 4C92D 3HGGA 2GQQA 4HG2A 4PFOA 2BTTA 2XKPA 1D0XA 4XQFA 3WGIA 4M74A 4N0BA 3WG9A 1UB4A 4MNUA 4R56A 2VJIA 2VE8A 2JUFA 3HOYJ 1KFZA 4LG0A 3W3CA 4M7AD 2E6ZA 2DDBA 2F2VA 4RMNA 2HEOA 5FKLA 1MMSA 1QLYA 3COAC 2LX9A 5M9OA 1VQ4I 1UJ0A 3FHNA 2O88A 3KZYA 2X98A 2O9SA 2P0KA 2AHQA 1VQKA 2XF5A 4PGGA 2WB1A 1BI1A 5L3GA 3H5RA 3OQ5A 4I0BA 1P9QC 2K3PA 1ULYA 5CVRA 3H35A 5CKFA 2RJDA 2XRLA 4NL2A 2ZPIB 3ZMVA 1ZG5A 1IO6A 4B9XA 2K2MA 1XDUA 3LFUA 3OL4A 1T0FC 4XLEA 2LCSA 2PJPA 2KRMA 2XMFA 2Z33A 4N4IA 4JQFA 1VQ6A 3M4OJ 2CZ7B 5HLGA 1MH4A 4KMFA 5KAFC 4B47A 2O9LA 3S16J 1ZSGA 1UJ8A 3ULRB 3RYRA 3URGA 4C92C 3G6EI 2HVQA 2RB6A 2KNBB 3KE2A 1BIAA 3WTTC 1FWZA 2DW4A 3RDIA 4E7ZA 3GBQA 4FW2A 2V1NA 2XUBA 4XU3A 4HQMA 4QSHA 1TG0A 3GZ5A 3J81Z 5IT9R 2JNGA 3CDLA 1YO5C 1FBQA 1BOAA 1YG2A 3I4MJ 2B86A 4KULA 2LOOA 2M34A 3FM3A 9ANTA 4DBHA 3JRGA 2XDDA 3S3NA 4BI4A 3S15J 4GYIA 3MEAA 4PJLA 1JT6A 4OB2B 1BBYA 2QG9B 4OGEA 3WE2A 3DV8A 4UVAA 3VS3A 1KA8A 2XF7A 1ZSZC 4BBRJ 2DXIA 2GNCA 2RO0A 4PNOA 4PGHA 2ELKA 3WG7H 1U3EM 3VPRA 4R55A 2VONA 2GLOA 2O7OA 3RZOJ 2Z1DA 4IQJA 1FLIA 3L2WA 1ZLKA 1R6RA 8AT1B 4M7DB 2HNHA 2ABLA 1M1KC 3X28B 3ZQ7A 4M7DA 5JLWA 4Y7NJ 1SD6A 5GANf 2DK8A 2HTJA 2ECCA 1TQPA 1R71A 1PM3A 3OR2C 1W70A 1UZCA 3D5SC 1IXCA 2RKHA 3KP6A 1ZGAA 5C0MA 3CCUQ 4C9YA 4B3XA 3VEPA 2P0TA 1OCPA 2LNHB 3MHXA 1S29A 4PJNA 3JREA 2LT1A 2DU9A 1NG2A 2JSCA 3HB9A 4C8QE 1T98A 2MC4A 2VC0A 3KP4A 2ZSIB 4U0WA 2W7NA 3W6VA 3K10A 1O75A 2JVVA 2R7VA 2YXYA 4BYYA 3H92A 1SG5A 3S1MJ 3G7ZA 3M0TA 4RTWA 4EMKB 3A52A 1W4MA 3JTGA 3FBIB 1U0JA 1MSEC 1MGTA 3QPTA 2A7YA 2LD5A 4X6AJ 2WSFE 1U5SA 1VNDA 2J5OA 2VC8A 1M90R 3BC8A 3FJPA 1KD1U 3L09A 2XV4S 3K2AA 1K9AA 4NC8A 3MZHA 1R8OB 3JCMW 3JB9G 1X1AA 1GRIA 3TREA 2CQKA 1BI2A 3EUHC 4XLFA 3W6JB 2RD1A 1I5OB 2JM8A 4FM4B 4BEHA 2K27A 5TRDA 2C0TA 2EBPA 3FZVA 1WJ5A 1NE8A 3FK7A 4JX5A 1QWEA 1B34A 2CFOA 1YP5A 3P9CA 2A08A 2FZGB 2M0YA 2CW7A 1H89C 1H8AC 2ZMEC 5DCMA 3FXKA 2E3HA 1TUGB 4FT2A 1NHAA 3CO6C 4ENKA 3JCMJ 1LDJA 1Y0NA 2PZ1A 1FOKA 4W1UA 1AWJA 5I21A 3ABKH 3F8MA 2ZJPF 3QXEB 3G73A 2IPQX 5C44J 1Z6TA 2WV0A 1IW7F 5BNGA 5LJ5g 2PMZA 1KQSA 3RIRA 1OZ3A 2MCNA 3QOEA 5CR2A 1JGGA 2OU2A 2XVCA 2RNJA 2L7FP 2D45A 1KU9A 1R0BG 1CKAA 1JT0A 1WA7A 4M78G 2CP6A 4MQVA 3CDHA 1OZ2A 1ZLJA 1RI7A 5CVUA 5D8KB 4K2EA 1T0FA 3K4KA 5FW9A 2DL8A 1ETKA 1G8XA 4M7DF 4MTEA 3CCSI 1W7PA 4B1RA 4D5FA 2PJRA 1RAGB 3SDZA 1Y1VJ 4J9IA 2COBA 3PIPF 4A4GA 3PUFA 2GFAA 1QU3A 2LCLA 4A3CJ 3SHWA 1A04A 1YHQQ 4OMNA 2EYQA 1IXDA 1NLPC 4FL6A 4J9EA 1UGSB 1T56A 3CCRA 4RGRA 5TGTA 4XU0A 4IHSA 2F5KA 1W36D 3SQNA 1G83A 2D1XA 4Q4ZF 1XQHA 1YJWQ 3WTXC 4I2OA 2OZ6A 3HXLA 2ZNYA 3ASOH 3QYFA 4A3MJ 2HZYA 2DMQA 3BFMA 3CC4A 5JHUA 4DJAA 3I4PA 3B73A 3ZQCA 1W6XA 3ZPLA 2E35A 2DXCA 4BH9A 2RK1A 2VQCA 1S3JA 1Z67A 1OCRH 5IT9E 1J75A 1F1ZA 3HGYA 3GLLA 1MMAA 3ABMH 3I0TA 4HLYA 2CUBA 2E65A 5AIQA 1YLFA 2K3XA 4ME7A 2LG4A 3U2RA 5F1JA 1K6YA 3IKTA 2F5TX 3CCRT 4BEHB 3EG9B 3ULQB 3WTVC 3HM5A 3REAB 1ZREA 1IV8A 2JQ7A 2DZCA 3ECOA 3AG2H 2DMOA 1P6RA 2LBFB 2KY9A 3OYMA 1IHVA 4HVVA 3KETA 2JPCA 2OBPA 1WH5A 3CUQB 4LD5A 5FGMA 3AAFA 5D5WB 4L5IA 3X2QH 1QQJA 2OJED 5FKNA 3RCOA 2A37A 2RN8A 5KYUB 1ARKA 4B9WA 2LLKA 2HDWA 1ZSZA 4LNPA 1GV2A 2XDVA 2VT3A 5F0FA 3EUAA 1W7PB 1PNJA 3CCVA 1GBQA 2JN0A 3OIPA 4IZZA 2MC3A 2LQWA 2Y75A 1K73R 1FIPA 1B9NA 5F1RA 4YIRX 1WFWA 1WI3A 4O5VA 2QUFA 2E1HA 2L3PA 2NUTB 5GTHC 2NVXJ 4MZMA 3JB9I 1JEGA 4BJ6C 1ZQ1A 1A6IA 1PUEE 2I0NA 3QOPA 1YW9A 5EG0A 2CQXA 3H0DA 2XB5A 1OYXA 1WWXA 1PSEA 2XGCA 2FMYA 1Z3YA 2QK0A 3CCMA 5LJ5e 1YE9A 4HVWA 3OSGA 4HVUA 4N0AC 1MBKA 1LKXA 3H1CA 2L7KA 1EV7A 2HQRA 2E1MB 2QZ8A 2Y0SN 4KMUX 4XN3A 1W5CC 3SFZA 4A12A 4PLIA 3O8HA 2OPTA 3P9KA 5GAN4 3GIBA 1VQ6Q 4OIPF 1OMIA 1PC0A 5GAOr 4Y15A 1IC8A 1JHHA 1IRGA 2JW4A 4CCJA 1VQ5I 2XAFA 1HKTA 1E6GA 2CKKA 1XGOA 3E97A 4A4HA 1EFNA 4C5HA 4F17A 2BEOA 1LDDA 5J47A 3QG1A 4E7IA 5LFAA 4UUSA 3JCMc 5FLXE 3E6BA 3EUKL 3TOBA 2CP5A 1HKQA 4GCVA 3OA6A 1LVAA 3HKZA 4ZTFA 3X20B 3CMAT 5FLMJ 2JTFA 2CUJA 2FZCB 3VS6A 1OFCX 3JCMX 1X19A 2CP2A 2CJJA 2VGMA 2LY2A 1L3LA 1E2XA 4B3AA 2E19A 2LDUA 1MV0B 4A3FJ 2ZJQF 4UXNA 3RKWA 2RREA 1BBZA 4JLIA 4L59A 1ZBJA 1VQ9I 2OTLI 1YW7A 4Q48A 2XASA 5ILVA 2FPEA 5JHFA 3L7WA 4ZN3A 2YDLA 2LJ3A 4E7HA 5KYYA 2E7XA 4XMYA 5CYVA 2P5VA 5CPRB 3EFSA 3JSCA 3UATA 2EKOA 4EM0B 2PBIA 4KNYA 2KGTA 3SYTA 4FYWB 1O7LA 3MN2A 5J40A 5HVQC 3HOSA 2IS1A 1WQWA 3P8HA 1VQ7A 3PT9A 3TDZC 2PN6A 3QRFF 1JJ2S 2EFNA 4BI3A 2L9RA 2CSOA 1XX5A 2L02A 3NWSA 3X24B 4HV6A 5DUIA 4WF2A 1X2KA 3ELKA 5GAOm 2X85A 2KLOA 2DN0A 3I55T 3V8LA 1VQLI 1U1SA 2ZPHB 2LH9A 4BNCA 2NYXA 2HQHA 1OEBA 2CS3A 1V29B 1U1TA 4JYKA 2NVQJ 2LY1A 3HKSA 3VS5A 1TSFA 3CJNA 3QWLA 4M75C 3CMMA 4LK0F 1EIFA 3RBBB 5IHNA 5A0LA 5M3MJ 1S72A 3VS1A 1JKPC 3GUDA 2R58A 2R5MA 3F0CA 1YITQ 2MUNA 1IN5A 3LSRA 1RLPC 3T9NA 4A0YA 1MMGA 4M9SA 3ZRGA 2IXSA 1YX5A 1BK2A 3MEVA 4L6V5 1NJIR 4MZPA 1IRFA 4LDYA 5LL6S 3ZL7C 3DCFA 4ESBA 5FRMA 4HW0A 8ATCB 2OTLA 2EPDA 1YIJT 2EWNA 4J5YA 3DEWA 5IXFA 3QP5A 2WWYA 2ME0A 1CSKA 5FO5A 2HSPA 2WY8Q 2QCOA 3FKIJ 3K4LA 2A6TA 3O6BB 2MZ4A 3AFHA 4E7SA 3H0GJ 4YRVA 4KIGA 3RPUD 3LAJA 3L1AA 4XTXA 1K7AA 5LJ5j 4OMFB 2LKSA 4KGZB 2A6EF 3UDCA 4G9YA 2L5QA 3PSFA 1UCRA 1B4AA 5BQTA 2Z5UA 1Y96A 4X9DA 5HLTA 3F23A 4LG0B 1X69A 2GQIA 1UFMA 2M9HA 1SHGA 2PVDB 4QQGA 2AZVA 4ZC3A 2DJZA 1BI3A 2ROLA 2PEXA 2CREA 1Z77A 2VXFA 2HTSA 2DFFA 5CO7A 3GFIA 3H9GA 5EC7A 2BYVE 3I54A 2O2OA 4IOCF 2R7TA 4D5CA 1WGXA 1XSVA 2Q8KA 1PRMC 4XLHA 1D8KA 1H9TA 3CCQT 1N8RU 5HS9A 5TISC 4AVZA 2DRMA 3OW2P 4RUGA 4PJOF 3GX4X 2BE7D 1M90C 3RSNA 5GAHJ 4TVRA 1FSHA 1S72Q 1QZEA 1N6AA 2DVJA 3HEFA 2GOXB 3DTEA 4G6DA 4D9JA 2HBPA 2RNAA 3U1KA 2ECBA 2LYCA 3ZQFA 3QP6A 1TC3C 4Z8AA 4HV5A 2VJ5A 4ZZLA 5E17F 4M78E 3IAS2 1VQMI 1HC8A 1D1CA 1USSA 4NB5A 2EV6A 1BYMA 5JVTA 2E1OA 2F2EA 1A31A 2DM1A 2KJBA 4OMMA 3QODA 3TQ7P 3IHUA 2XAQA 1R1UA 3BZ6A 3FIWA 1B8IA 5KHDA 4MO7A 4XORA 4C2TA 3ABLH 1IZ6A 1M1KU 2K9QA 1MNMC 2DERA 2L3SA 1S5LC 3KP3A 4CYCB 3C18A 4OU0A 3E1SA 1TNTA 3C7JA 1RAHB 3J7YJ 2JN6A 2WAQN 2EGAA 3L2CA 1F43A 4M3FA 1EH6A 1R7JA 3LFKA 1UGVA 2OCEA 4DZJA 2KROA 4M4ZA 3WXMB 2BIVA 2M30A 4HZFA 4II3A 1G4DA 2EB7A 3J80R 4EMGA 3CF5F 1RKWA 2V1RA 2E70A 2P0WA 5DD4A 2GM4A 2DL7A 2PG4A 3WTUC 5L8RE 1R58A 3QU6A 2DA1A 3MKYB 1BJZA 3DLAA 1VQ7I 2DBMA 1WPYA 4MDWA 4AFSC 1VQ7T 4M7AG 2M87A 3RDVA 2STTA 1NLOC 2CUDA 3PMIA 2DT5A 1H3HA 3BR6A 1G3YA 2LFBA 1V5GA 3RPUA 4X1VA 2K40A 1ZUYA 2AT1B 3VUZA 2NOGA 2H6CA 1OPCA 4C92G 5CAIA 3K7AJ 1L0OC 3ME9A 3A1YA 3PFIA 3F70A 6PAXA 2RI2A 2FNPA 4XKVA 1FTZA 2JTMA 2FNAA 5M3FJ 1HCRA 3IH2A 1FMVA 4J7IA 2DVEA 1UHMA 3GP8A 4PJJA 4S04A 5DM6F 4KH0B 2HXIA 3HHGA 4M77C 2K9GA 2ELHA 4ZYGA 2VOPA 4AVPA 1U8RA 2HBWA 2LKXA 2G6FX 4EEFG 4ZN1A 1X6OA 1HF0A 5DTDA 4QQDA 4C5IA 4ZNXA 3TVTA 1YHQT 1I50J 2DK5A 3BY7A 1YIJQ 2X6WA 4M75A 2K3YA 5LJ3f 3ASKA 2VLAA 1VQLQ 1IGQA 1ZA2B 2P0PA 3I35A 2V8JA 4BQOA 2LQKA 5EEAA 3Q1JA 1JXMA 2RF0A 4XK8E 2K3FA 2M0CA 4U7DA 2XC7A 4ON0A 1OU9A 4KRTA 2DPUA 1Y0UA 5KE2A 3EFOB 5DS9A 2XU8A 3I56T 2KHMA 5KK1A 3EGXB 3S17J 1WHLA 1FC3A 2JSPA 3MJXA 2VWFA 5D4SA 4OF1A 4M3GA 4A3KJ 4BL0B 2QSFX 4F92B 2HKNA 5CKBA 2HEQA 3PTAA 3NRVA 3RKXA 3VODA 1YJ9I 4L5JA 3M0SA 2M7BA 5IT3A 5JI6A 3CDIA 4J7FA 5F27A 3NEUA 1SFEA 3WTZA 5AONA 3IUOA 4LLLA 3JAMK 3H41A 5J4YA 4BDZA 1AT1B 2UZKA 2CUZA 3N05A 2FHDA 2AXLA 2F4OB 3VYHB 4AIDA 3FXQA 3OSVA 2QEXA 2LMDA 2DD4A 1BC8C 2JT4A 2HXOA 4BKXA 2MYSA 1RAFB 2LP5A 4LG3A 3KFVA 1J59A 4EIKA 3GO5A 3CC7T 2OZUA 5DCFA 5M5XJ 4XTYA 2RJEA 1RZ4A 2ENMA 5IP9J 3BWGA 5EGOB 2F4IA 1EKEA 2MIOA 1MBFA 3LYIA 2OTJQ 2Y48A 4AFZC 2QA4Q 1Z91A 2RQQA 1FJLA 3QKJA 5GAOq 2V6CA 1YN8A 2XHKA 2DILA 3JB9D 4XRFA 4YTLA 1WYXA 3RKYA 3C12A 5KH6A 3NQOA 5KYWB 4DYQA 3FXRA 2GXBA 2HYGD 3I71A 2AK5A 1UE9A 2EPFA 3W2WA 3ZBDA 1RUOA 4D6WA 2GXAA 1IUFA 1XN7A 2YPRA 3OS1A 2JA5J 4FE7A 1FZPB 2COMA 1T3SA 2KFDA 3H0HA 3PUBA 2A6HF 3DEUA 5IPAA 3CC7I 4JRQA 2CQ7A 4JX4A 1VYTA 1TW2A 2LQ8A 5IYDJ 6AT1B 2LJ0A 1AWCA 1LNWA 1W5SA 1VQMQ 4OAYA 4MIMA 3G2BA 2Z3YA 2DFEA 3R0JA 3EYIA 2K7AA 3HHTB 2V79A 2Q2EA 3A03A 5J8FA 3F6OA 2O4XB 2OAUA 2E71A 3Q9SA 3L00A 2DEQA 2P5LC 4A5NA 4CYCA 3DB3A 1OYWA 2IGMA 1YRNA 1FMKA 3EAEA 3QIIA 2LY9A 2QBYA 1OOTA 4C0ZA 2R7XA 2CW8A 2X51A 1M90U 1WJRA 2MD0A 3M8EA 5K5OA 4IRIA 4A3LJ 1JJ2P 3M3YJ 4CC2A 3G1OA 3CBPA 1BL0A 1MGQA 2UUZA 3S6WA 4NHJA 4A54A 1V3FA 3CTAA 1AOJA 2X1CA 3EPZA 2CZ6B 2JT1A 4LOCA 3K4MA 3DU5A 4FTHA 2DAOA 4RM3A 5CIUA 1ZHIA 4D8KA 3LQQA 5HK0A 3DU6A 5CJ9A 1UB9A 4IHTA 2FRWA 2E2HJ 3IP4B 4C92A 2KK4A 1R23A 2CZ1B 5GP9A 2P4WA 4EMHA 4D8DA 3LWFA 1B07A 3CCVI 3H0FA 5C4XJ 2W10A 5ICGA 3CCET 1LEBA 2MLGA 1UHWA 4A2UA 1F36A 1JHFA 3I58A 3F8NA 4FCYA 1M2OA 1DU6A 2ETHA 3BLYA 1OCCH 3OWTA 2K9MA 5EDNA 2HZTA 3IV5A 2M51A 1D1BA 1JE8A 3QSUA 3PQKA 1GCQA 1LUJB 3K70D 2KSSA 5LRRA 4II1A 3VU3C 5GAOp 3GFLA 3CMEQ 1VQ9T 2CZ0B 3DFGA 4OB1B 5FWBA 3MEXA 1MZBA 1ON2A 1OR7C 2M45A 1RL2A 1BB9A 1UTIA 2RAEA 3C0CA 4J01A 2V6EA 2YUQA 1ON1A 1OI1A 1YWPA 3CP8A 4LXCA 4FU6A 4OGCA 1AOYA 1M8VA 5GANj 3L9FA 3D0SA 1K78B 2N8GA 2L2OA 3MZ8A 1OULA 3LH0A 5DLOA 1NTCA 3JCMd 4HCZA 1STZA 4KICA 2X3XD 4ENNA 1SMTA 3GCMA 5LJ3d 1P7IA 5ICEA 3OYAA 2YU3A 2Z99A 3J80Z 4OOIA 5LD2C 4Y33A 3M0RA 2VJ4A 4HSRA 2RQRA 2PMZN 2VVKA 4M6XA 4BS9A 2O31A 4NOYA 3LWIA 3I59A 2C0OA 4G7ZF 1WXTA 2HYJA 4HRIA 1TZLA 1P4XA 3ESWB 2KE9A 1TWAJ 2K5CA 1T2KA 3JCMb 2CUFA 2JVGA 1XSDA 1X4PA 2GWRA 4M71A 2KISA 3DKXA 2QLZA 5D6FA 2LC4A 1T33A 2A5WA 2UXNA 4XK4A 4NDLA 5FLXK 2LT4A 3BG3A 4IHYA 4OMZA 5LLQA 3HRMA 4XU1A 2ZO4A 2RQTA 2VQGA 4PDKA 4AU7A 1I1JA 2EYXA 2MWPA 2EFQA 1HW5A 1R9TJ 1SHFA 4QVDA 2LZ6B 4B4CA 2RJCA 3M55A 2QKMB 3FMQA 2O0YA 3TW6A 1FOXA 1MW7A 4CCKA 1Y7XA 3NMZC 4J9BA 5LJ5d 3I53A 5B5EC 4IVNA 5J3LA 1U5TA 1FPQA 4E7KA 1SFUA 4CHUA 5J3BA 5KYXB 2MF2A 2W0ZA 1FYNA 4M75E 5LEJA 3BJAA 3K70C 3JB9J 1ONVA 1ZYRF 2CP3A 1A0NB 3C4SA 2VPRA 3A02A 3ZMUA 1QKWA 1W36C 1KD1C 2CRGA 2MMPA 1J2XA 2K3BA 3ER0A 1B1BA 2BW3B 3BTCA 4ZZDA 2YLBA 5GAMg 4J83A 3J81K 2GGRA 4YFNF 1DPUA 2ISZA 2QYZA 1GFCA 3GOXA 1D8JA 3C94A 5HODA 4PJOA 1I27A 3FXLA 3HFOA 3HL2A 2QQAA 1WPKA 2HZDA 2NVYJ 4IUPA 2YUPA 4P5OA 2M2EA 1M3AA 2QXFA 2XAGA 3ECHA 2FXAA 4HSTA 3MCAB 2K4BA 2Y4XA 3U23A 4BHCA 2VKNA 4BBSJ 4C2MJ 2O61A 4WXHA 2NS8A 1QHGA 3CCUT 1QZZA 3EFOA 4ZGEB 4ENJA 5A2QK 3M8JA 3FRNA 1CF7B 3SWNC 1Z6RA 4M78C 2CQQA 1F5TA 3FDYA 1WI9A 1V5FA 2NUTA 3CP2A 4FT4A 3OYKA 4MMKA 1K73U 4EJVA 1Q7YC 4A5MA 1U8BA 4AYBN 2HKXA 2IS2A 2QA4A 4M75B 1Y6IA 4OMYA 4E7JA 3VOEA 5K1YA 3TU4K 1VUBA 3E19A 3HOZJ 2RNGA 4JP0A 4TV7A 2XICA 4Z88A 2IEKA 3LWHA 3B02A 1C1AA 2K4YA 2MABA 1NJIC 4F7UE 1PWTA 1EH7A 2FE3A 5EZHA 1SKUB 2VYTA 3TMOA 1HQCA 3JR9A 3MEWA 4BAYA 3ZGKA 2BUDA 5GADJ 1YIJA 2MK5A 3GF2A 3TKYA 5D5UB 4ELZC 4GY5A 4KITB 1N9SA 2KJCA 3W2VA 1P2FA 2D9TA 1YBYA 2BW3A 4HNTA 2ZB9A 2EW3A 2XPWA 3LOCA 2EFWA 4HCKA 1N9RA 2RHYA 1VQNI 1KHCA 1RADB 5I22A 3K1MA 1SRMA 1R5ID 3G1LA 5LJ3j 1PD1A 4PSWA 1VQ6T 3RMQA 2DT6A 2A28A 4XLCA 3HIFA 2PMUA 4BY6C 4BI8B 2BZTA 4C0FA 1QVPA 4N4OB 4LIVA 1QVGP 3QYHB 1O3RA 3VYTB 3HTRA 1VYVA 1F9NA 1ZHFA 3PNVA 2JS2A 2DLPA 1I3AA 1NJIU 2IGNA 2Y4YA 4KIFA 3QWXX 2DYSH 5JVGF 3T8RA 1ZGJA 3JRFA 4J9FA 4ANJA 2CDTA 2DJIA 4FISA 5LGTA 2VXEA 3FXMA 2ZXHA 2VXDA 2EJ9A 4BB7A 3KP2A 1PUFB 1FOYA 1X1BA 2L0AA 1Q86C 4M7AA 3U1DA 3CCYA 1OLTA 1BM9A 1ORKA 2PQ8A 1DUXC 1PRLC 3VS2A 2RVCA 1K0SA 1JJ6C 2IS4A 1Y71A 1Q1VA 1SRLA 1I07A 2RHIA 4F7UB 1Q7YU 4DA4A 1O3QA 1VZ0A 1NEGA 3L2RA 1VQKI 4XOTA 4NL3A 2F5CA 2ZJ2A 5GMKh 2VQLA 2P6TA 2O8XA 2XGXA 4B44A 2AS5F 2EGCA 3VSLA 2DNUA 5JR3A 1TP4A 4Z2YA 2W00A 1GLNA 2M3AA 2H1LA 4XBFA 2YRVA 2KXDA 1S7OA 2XRNA 1WSUA 3E3VA 3WTSC 3G6EQ 1YJ9T 5L3DA 4XLNF 3HG9A 1BR4A 2KT0A 2YX7A 4M9ZA 1IAWA 5A2QZ 1Y1WJ 2BZ8A 2V26A 4C30A 1VQ6I 4JLGA 3EG2A 4MHGA 4UY8I 1PKTA 4M78F 3J7AF 3O5ZA 1ZGWA 1S6LA 3A1PA 2R5YA 1RESA 3MAJA 2WACA 2XSDC 2FRHA 3GMEA 2UXXA 1VQ8A 3CCQI 4M7DG 1UHSA 4P96A 2L3RA 2B63J 1JO8A 4IURA 5FU6B 2OI3A 2DBBA 2KIUA 2JRTA 5F64A 3CMAQ 1IXRC 4ESRA 4RLFA 3M0QA 4LUDA 2OJ2A 3LGFA 2I10A 2EIFA 1G6NA 1K73C 4AM3A 1PHTA 2P7VB 3I5SA 4HPQA 2L8DA 1SPKA 3LSGA 1LNXA 2RMOA 3E5QA 2KPMA 3CBMA 2IJLA 4IUUA 3CCJT 4A4KA 5AT1B 2P5KA 4F52A 2OTJI 2LSOA 2EYYA 4BY6B 1WRJA 3Q5FA 1E17A 2KIFA 1GUUA 5EJCA 1XD7A 4EV0A 3NTIA 4RCBA 2M9UA 4KN4X 4QVZA 2LBFA 4J19A 2EYZA 3EYYA 3JRAA 4K11A 2Y0MA 1XJWB 2OAWA 1YITI 2RHUA 2XPUA 1QP3A 3L2VA 5DUKA 1G2HA 2SEMA 2KXCA 1H92A 2RQPA 2NNYA 3ZQLA 3WE3A 3H9QA 1FXXA 2V8IA 1BIBA 4BDYA 2Y90A 2K5LA 5E8IA 2ME6A 2XF6A 1K79A 1YI2Q 2W4SA 5HOOA 1DJ7B 5GAMd 2EZLA 3RTRA 3S14J 3CPWS 3FMSA 4D7MA 2OQRA 1I1SA 1X2QA 1TOVA 4ZTJA 1Q82C 3MD2A 2O01E 3GLXA 4LLGF 4QLCU 2XDBA 3JCMP 2WA0A 4P9FA 4B09A 4GDFA 3E5UA 4YIIA 3OR1C 3RKQA
chains in the Genus database with same CATH topology
2GXGA 5LJ5f 3TO6A 1R36A 4HBLA 1Q86U 1MJAA 4D0PA 4EMKA 1BKBA 1KQ9A 4RGXA 1I6XA 2O03A 4LD9K 3CC7A 5IAYA 1RIOH 2I2LA 2NRAC 4HX7A 2E7WA 1VQ4A 3ZEHA 4YFKF 2HQEA 2QQBA 2VV5A 2X4XA 3BJOA 3M59A 1T39A 3CD6A 1HBXG 2YR2A 3MFKA 5DCMB 1VIEA 4U88A 1J9IA 2FVUA 2PMHA 3KCC