1FXDA

Refined crystal structure of ferredoxin ii from desulfovibrio gigas at 1.7 angstroms
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
57
Chain Sequence
PIEVNDDCMAEACVEICPDVFEMNEEGDKAVVINPDSDLDCVEEAIDSCPAEAIVRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of ferredoxin II from Desulfovibrio gigas at 1.7 A.
pubmed doi rcsb
source organism Desulfovibrio gigas
molecule tags Electron transfer(iron-sulfur)
molecule keywords FERREDOXIN II
total genus 8
structure length 57
sequence length 58
ec nomenclature
pdb deposition date 1991-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13370 Fer4_13 4Fe-4S single cluster domain of Ferredoxin I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fxdA00
3MMBA 5BYQA 1JNZB 1D3WA 1G6BA 2FJAB 1H7WA 2O01C 4OMFG 3MM7B 4ID8A 2C42A 1XERA 1CLFA 2PDAA 4YDDB 4OV1A 1FRKA 1H7XA 1FRJA 2VPYB 3MMAA 2IVFB 1FRHA 1KEKA 1JNRB 3MMBB 2VPZB 1FDBA 4L6V3 3MMCB 1FDAA 3OR2A 4XDDA 2XSJA 1F5BA 1GTEA 3HKZD 2FD2A 3MMAB 1B0PA 3OR1B 5BYSA 5FD1A 3IR6B 1FD2A 1FXRA 3PNIA 4Y28C 1R27B 4DHVA 2C3OA 2C3PA 3GYXB 3MM6A 7FD1A 5CHCB 1KQFB 4XK8C 1BC6A 3MM7A 1Q16B 1K0TA 1BQXA 1F2GA 2V2KA 2Z8QA 2V4JB 1DAXA 3LW5C 1FCAA 6FDRA 3EXYA 2VPXB 1C4AA 1AXQA 4KT0C 1SIZA 1BD6A 3EGWB 3C8YA 4CI0B 1C4CA 2GMJA 3MM5A 1SIWB 2PMZD 2Y0SD 1SJ1A 3MM9B 5CH7B 1GTHA 1FEHA 2FJEB 1GT8A 4XDCA 1A6LA 3EUNA 1KQGB 2FGOA 1H98A 1PC5A 1G3OA 1IR0A 2FJBB 4RKUC 2VKRA 1JB0C 2ZVSA 2C3YA 3MM8B 1F5CA 3IR7B 3OR1A 2WSEC 2GMHA 1WTFA 1DURA 1Y5LB 2VPWB 3MMCA 1HFEL 2WSCC 7FDRA 1FRMA 1FXDA 5E7OB 1FDNA 2C3MA 5BYRA 2V4JA 2FJDB 1B0VA 1FRIA 2FDNA 6FD1A 2WB1D 2C3UA 3MM8A 1BWEA 1FERA 1FDDA 1ROFA 1Y4ZB 1H0HB 4AYBD 3MM6B 1B0TA 1FTCA 3IR5B 1DFDA 1FRLA 2PA8D 1GAOA 1IQZA 1BLUA 3MM9A 2XSJB 5L8RC 3OR2B 1Y5IB 3MM5B 2UZAA 1VJWA 1FRXA 1Y5NB 1RGVA 2WSFC 1PC4A 1FF2A 2WAQD
chains in the Genus database with same CATH superfamily
3TVKA 3R7SB 1ZA2B 4R5PB 4OMFG 3M6WA 4OYWA 3TUJC 2VFRA 4E8UA 5I3UA 3ZZ0A 4ILLA 3Q2TC 2X1GA 3GONA 4RW9B 1FT8A 3OQ2A 5DDRC 3GIIA 1B64A 1VISA 1ZAWA 3DMJB 1QDUB 1UVKA 3HX9A 4RLEA 1VQKS 1UFKA 2ILZA 2WVDA 5A8WA 2DEIA 5KFUA 2GVZA 4OYBA 3TP2A 2B9XA 4KH0B 4Z37A 2QV6A 2VC0A 3K5LA 2LXUA 5IM0B 1VFJA 3T5KA 1U45A 3KK3A 3DM2A 4IRCA 2I0XA 3PJWA 1YSJA 4IRKA 2BJ9A 4DR3J 1YZ7A 3LH2S 2XY6A 2XWXA 3JTOA 3TVZA 2R7QA 3LQVA 1X7VA 3I0SB 2HQDA 3BM7A 3D3CJ 5GVQA 4CDIA 4UQTA 2FHKA 4Q2LA 2ZE2B 2WVFA 2LECA 2IA6A 1CBKA 4G3IA 1S57A 3UVJB 1V9OA 2GNKA 1M90T 2LQ9A 2OTJS 2OPSA 2V8PA 2YX1A 3DXBA 4BBYA 4WF9Q 1NPRA 2B43A 2HHWA 1OIAA 5J1NA 2IYGA 4Y2KA 4BWMA 3WBZA 5SZTA 5DM6Q 3KLEA 1UEUA 2VOOA 1QAJA 3KK1B 2UXBF 3MM6A 3IP0A 4LRCA 2VBXA 3C2PA 3BDPA 2RVJA 4JI5J 3GV5B 3K5MA 1DTTB 1Z1ZA 5D4NA 1SKSA 3DLJA 2W2OP 2OPPB 4NLRA 2J6SA 2QSWA 3OTEA 1HHTP 4LF1A 1DZ5A 1UA0A 1NSAA 2YNGB 2ZDOA 1UFLA 1BD6A 1NHVA 4HLBA 2DR5A 5DDOC 2BBEA 3BS9A 4MKAA 1IKXB 4P2XA 4WIIA 4M5GA 3P96A 1N0VC 2HBZB 4MYTA 3KJVA 2XS5A 1ZTTA 2HWIA 2KM8B 2HWTA 3AD8C 4YN3B 2CQCA 4RJVA 3LP1B 2QMXA 3CVKA 3M8RA 4C8LA 1WWHA 4NLUA 2PA3A 3PW4A 2HMIA 2I9SA 1TVRA 1Y00A 2LMIA 1G3OA 5CD4H 1NKBA 3GR1A 3FFIA 2I8EA 2EC2A 2G0CA 1ITPA 3ELHA 1QAXA 1RWKB 2WHOA 2HK3A 2XHCA 3P5BP 2AJFE 5F0WA 2XWYA 3RB0A 3FSXA 5GADI 3T1HJ 2GMHA 1VBYA 1YG0A 2E7XA 1P1LA 1DURA 2BJEA 3EGNA 4B3SF 4WJBA 2VPWB 2I5JA 3RBEA 4M5DB 4OFZA 3HHEA 1AZSA 2B4UA 2PC6A 4DV7J 1KP6A 3MEGB 2EBGA 1B0VA 2IPOB 3PKMA 2A0FB 2H3EB 1EX8A 4RWXA 4KGZB 5J1EA 1KFSA 3FK4A 1CJKA 1O6XA 1WKKA 2BKPA 3MAHA 2CPFA 5THWA 3WX4A 4DLGA 4X2BA 3FZBA 3TUZC 5F3TA 1IR1A 2MQLA 3BGFA 3H4BA 3KTQA 1B0TA 1HBMA 1QUPA 3BBBA 4BDPA 2ZH4A 2LEBA 1NM2A 2KG1A 2PA8D 1JLAB 3K59A 2UVVA 1RWOB 3D5MA 4P7TA 3CJ5A 2D7SA 4CH7A 2HQFA 4HHHA 1D1UA 3RR7A 4NA3A 3CDBA 3H4DA 3NKYA 3JSYA 4CO5A 1HNZF 1IKYB 1FRXA 2K7KA 4PUOB 1X4HA 4WP3A 4ZP8A 3CO0P 1N52B 3TX0A 1OSCA 2ASYA 4WTOB 4F0MA 3EYZA 1RT2B 3DOMB 4I2QA 3M8SA 2X1AA 4AL7A 2P6SA 1IBKJ 2A18A 1H7WA 1TL7A 4ECUA 1HNIA 4NLQA 5H1SV 1YVFA 1XERA 4X62J 1IBKF 2WTFA 1CJTB 5KFGA 3M2UA 2ZVIA 1RHRB 2HNYA 2CPZA 2NYHA 4TQSA 3E51A 1FRKA 1RT1A 5FDLB 4DV2J 3DLEA 1T05B 3B54A 2DR7A 1FWLA 5E2QA 2OGUA 5DG8A 4AT1B 3MMAA 4DXLA 1M5VC 4DV4F 3KHHA 1KDNA 1NXIA 2WVEA 3NP5A 4MKVA 5HVFA 1XMOJ 2OJ3A 5A8KB 1S1VB 2HIYA 3NBPA 4F0KA 4IOAQ 4IDKB 3I32A 3K58A 4WFNQ 1KWMA 1R31A 3RAQA 2VZ9A 1U6ZA 4Y2CA 4BWJA 3UQSA 3W9JA 2ZM6J 4JYAF 1NB7A 2YPYA 3BPDA 3OR2A 2EFVA 2VDHA 4WFZA 4ECTA 1ZETA 3QQCD 2VA3A 3B8HA 2CRLA 2AZ3A 5IM0A 2DD8S 2B5JA 1AUDA 2HW3A 4OZ5A 2D69A 2FLPA 1RT6B 3HHDA 2B51A 3CIZA 4LVNP 2CJBA 2G2OA 1HQUA 4OI2A 5A8WB 3F73A 1IM6A 1RTZA 1Q79A 1YBTA 2R2TA 3CJKB 2W8KA 1WG4A 1U02A 3G8QA 3ZTQA 2QA4S 5IQQA 5IC4B 3MTJA 1HHQA 3CC2S 2KKHA 1KQFB 4OHYA 1XQIA 1CJVA 1D9DA 3QWPA 1QSLA 3OV7A 4MIWA 1C0TB 1QM9A 2VG6A 4NLVA 2DITA 5D4PA 1N48A 2XMKA 3CCSS 2U2FA 3RR8A 2QGFB 3W3SA 5AE3A 4KGXB 2UXDF 3DRRA 3NMAA 4IQMA 3MCOA 1LW2B 2VQEF 3UCZP 3UCUP 1IBLJ 2DHHA 2XSFA 4HH0A 2CPJA 5K20B 1U25A 2ZWOA 1MLAA 1S6QB 5CH7B 1GTHA 2B56A 2FJEB 4Y6IA 5F9NA 4YB1P 4U67Q 2DO0A 3KUGA 5HQMA 2EK6A 1U1PA 4JI0F 1XIQA 2KL8A 2E5LJ 3GJRB 3QGIA 1KTQA 1SH3A 5ETLA 1J5EJ 4FNIA 3M8PB 2LLZA 4MMOA 3FZ2A 4ETZA 4ECVA 1YITS 2J7UA 4AFFA 4RW6B 2XQCA 2HLUA 2NSBA 2DH7A 3VAMA 3HULA 1MROA 1OSDA 4ALZA 1R43A 4O44B 1M5OC 5KFWA 2ATCB 2MKYA 3ILOA 4ID5A 4TN2A 3D6FB 2DIUA 3I9V9 5HROA 1JX4A 1IBCB 4DS4A 1S97A 1LV5A 2WB4A 4J9OA 1WTFA 3FCHA 4TNOA 3KLGB 2P9GA 1D9FA 2DCLA 4OV6A 3CCMS 2BXJA 1X4EA 5B0AA 1SC4B 3CC7S 4DMZA 1H38A 1R8BA 5ETKA 4M1KA 4DG1A 2QLXA 3I87A 2W7OA 4USHA 2RMLA 1BQNB 1HKAA 1C1BA 3ZZOA 5KFCA 4YB6A 3UN3A 5U47A 4WWSA 4BLGA 2LFVA 2EI5A 3GG1A 3P45B 2RHSB 2E29A 3MCNA 2EFNA 3AJ1A 2JFDA 4ZVOB 3JSRA 3LP2B 1UWBA 4F2RA 4PWUA 4B3OA 4P10A 5KFOA 5GMKa 2RHQB 1HR0J 3K5PA 3UI3A 1U1MA 2YQ1A 2V67A 4WFBQ 5C42B 1JJ4A 3NXZA 3IG1B 1GFWB 4OZ2A 2F7VA 4LF6J 5GMEA 1LEOA 1TUGB 4FBTA 3CCLS 2ZFHA 4LF9F 1N5QA 3Q83A 1WOPA 2VC1A 4MTPA 3S01A 3R5GA 2CQ3A 3FJ2A 2XB2D 4X4PA 1FF2A 4OLOA 4Q43A 3GFHA 1K9MT 1PBUA 3PYDA 5CAAA 3C16A 4Y00A 3HK2A 4P75A 1JNZB 1HQEB 1WJ9A 2E1AA 3J7YU 4FYWB 3H5SA 3PXGa 3SZ2A 4DQRA 2CQ2A 3K5OA 2KTQA 1MU2A 2B0GA 2QA1A 2C42A 3C66A 4H4OB 4TLRA 4DS5A 2CPYA 2IHR1 2V94A 3GFZA 1WC1A 1UVIA 5HLFA 1RA7A 4LBIA 3VVUA 3G6YA 2O66A 1N34F 1S99A 1D8ZA 4OL8A 3DRXA 2HS3A 2KXHA 2QFIA 4HACB 3CULA 1SPBP 3BO3A 3M1VA 2JZ5A 3AXKA 4JP8A 3GSIA 1NK5A 1VLOA 1RYRA 5KFAA 2Y1JA 3IGVA 3SFGA 3QJPA 4X4UA 2OMOA 3E01B 1RTHA 4RW7A 3NGKA 3RU0A 1KNZA 5K14B 2ALYB 5KT4A 4YP3A 1X4FA 5ETOA 4DSJA 4JUZA 1S49A 2YKMA 1RK8A 2NUUG 1DY3A 4XDDA 4DR3F 2GIFA 2R9LA 3M7VA 4JV5F 1I5OB 3T41A 2L48A 3H0PA 3T1YF 1MWYA 1WHYA 1B0PA 2AGQA 1FNOA 3WX8A 4USWA 1RHKB 4O0IA 1KVJA 4DV5F 1FXRA 2YQ3A 1IN0A 3QGHA 3NMRA 1REVB 5CYQB 1VRUB 1RU1A 2Q43A 1RHMB 3QFWA 3R7NB 2KT3A 2JWNA 5IS2A 2AP6A 2AU0A 4KFBB 3UNYA 1NK6A 1T3OA 5KFEA 3W7BA 3NL0A 4DV3J 2GW8A 1T7PA 3HVWA 3R8YA 5DQGA 2QT7A 4LSLA 4OX6A 3V6HA 2HHQA 1AB8A 2CG4A 2BW7A 2XYGB 2RQCA 2FTRA 2JEIA 3QO9B 2FY8A 2KG0A 1HBUB 4C48A 3TI0A 3DRRB 4PWDB 5KFKA 1R8HA 2V4QA 4OI0A 3MPDA 4ED7A 5M2PA 2Q66A 1SC1B 4MYUA 1A6LA 1VJQA 1F3FA 4V1Ak 2N82B 3PR4A 1WKLA 2HS4A 4DPOA 3CJ8A 4AQYF 1PC5A 2HK2A 5AXKA 3OL9A 3EVOA 5JMNA 2YNFA 2QFJA 2PEBA 2DNQA 4KGVB 1VK8A 4ZJOA 3Q24A 2CYYA 2CWXA 2ZVSA 4RPFA 2BJ1A 3THPA 5J2PB 2C2KB 2CJAA 3FGVA 1TQLA 4PRFA 3DDKA 5KG1A 2RQMA 4B02A 5AXLA 3NGTA 4W98A 4YDXA 3G4SS 2D3UA 4ECQA 4EYIB 3IN5A 1XMQF 1S6OA 3DCAA 4GO7X 2UU9J 5I3PA 4MK9A 4QIVA 3ZTSA 3KLGA 1FDNA 5LM7E 4DR6J 1NH7A 2LU1A 2HKEA 4LUBA 3MPYA 4WPAA 2UXDJ 4UF4A 4OYPA 2WB1D 3NCPA 1MROB 1RAJA 2KJVA 4Y0FA 5EX0A 2XMWA 1CG2A 2XCAA 3WHIA 4EZ6A 2HZVA 4EUVA 1KRPA 3DOKB 2LQ8A 1HWJA 3LANA 4KFBA 3UR3C 3UW1A 5DQIA 1K1QA 3IR5B 4EEYA 4L72B 2LQBA 2V63A 4O4RA 3PX0A 2E5JA 3SMZA 2H4WB 2C28A 1N32F 1KOHA 1SJRA 3MM9A 1JXLA 1HNVB 2BRKA 2OFGX 5HMXA 2BJDA 2HZAA 1FXLA 2IFXA 4DQSA 3PM9A 2OPQA 3UR0A 4DL4A 2UVWA 1PAUB 4DOZA 3QRPA 5DGBA 1M1GA 4M5IA 5CYJA 4YHHJ 3OTDA 1WOSA 4PUOA 2BE2B 3LAKA 3A8EA 3CJSA 4Z2XA 3U1NA 5KFPA 2HFVA 2ZH5A 3V6DB 2AD9A 3JYTB 1IKVA 4PQUB 5FIIA 1NHUA 2SXLA 5H9EK 4HI1A 4U6PA 3KNAA 5HANA 1HYSB 2VF3A 4ED0A 1PBAA 4CLTA 3KLHA 1XNRJ 4CLKA 1VBZA 1U1LA 1VHFA 2Q3PA 1NLKL 2BX6A 1CJKB 1F9HA 1MU2B 2WW8A 4PPDA 1S6PB 1KEKA 2CQBA 2RQ4A 2C2DA 4K4VA 1HQEA 4CO4A 4I6WA 5HQLA 4A8WA 3T9NA 1CQMA 2HRYA 2D9OA 1TTHB 4YEAA 2UXCJ 4OYMA 3N5BA 2W9BB 3EM1A 1FTRA 4L6V3 1SKRA 3TYTA 4Z7CA 1S1VA 3HD1A 1HI1A 4QR1A 1U6FA 3RYLA 3UN2A 4C9DA 4F7VA 4E98A 1I51B 4R8UB 2IIHA 1JJCB 3A1YG 1HNXF 3B78A 1KLMB 1U49A 1QAYA 1M0SA 3LA0A 3QT6A 1LFPA 1YJWS 3TOQA 4Y28C 2BOPA 4TU9A 2X1FA 1NPKA 4NWBA 1ZOTA 3QAEA 4QPXA 5D3GA 4E0DA 4RW8B 3PV8A 1DLOA 2VBYA 2KXNB 4RNFA 1Y11A 5AJ3F 2DT9A 2KM8C 3KHLA 1GXTA 2XGQA 3QT8A 4YB7A 3ISZA 2VPXB 2ASJA 2HAIA 2UUTA 3MCSA 1TKTB 3MEDA 4K50A 4DUZF 3J7ZT 2C2EA 4KE5A 2RS2A 1XNQF 3DNCA 4IO9Q 3HSGA 2GMJA 3R2CJ 4I68A 4ZVRB 1VQ5S 4LF4J 2HFUA 4FPIA 1SJ1A 5AJ3J 4AQYJ 2WONB 3NCQA 1WHVA 4GKKF 5ETVA 2Z2ZA 1OWXA 2BYCA 1XR5A 1OYEA 1NB2A 1H98A 3HMJG 2WVCA 3AXMA 1A7GE 4C7QA 2B4OA 3UE2A 4RW6A 4ES1A 4I6AA 3HHLD 3S8SA 2CZVC 4RX6A 3QAUA 5ETRA 2OHDA 2R8HA 3HDSA 1Y3KA 5I4MA 3V4MA 1JLGB 2A2CA 3U27A 4G1QB 3T5LA 3CJ2A 4QYZK 2YWFA 3LP0B 4ZDNA 3CTRA 1LFWA 2AYEA 1QE1A 3L7UA 3MDFA 4I4BA 1X5OA 2J0WA 2WSEC 4OYZA 3GWCA 4HH1A 1YRTA 2B3TB 3I96A 2RD5C 4RWWA 4CH1A 1H2UX 1NHKL 3I0SA 1TAUA 4NEYA 1BGXT 2ZBPA 2M88A 4DZ6A 3HM9A 2DGWA 4F4YA 3G6XA 4LF7J 4QIEA 4CLSA 1H74A 5HAOA 4EI2A 3OVBA 3ET6A 4ZLNA 2RH3A 3O2IA 3KK3B 1YQHA 2C3UA 2DTJA 1JLGA 1A9NB 4I64A 4LRFA 5D3GB 4LR8A 1Y0HA 3HFVA 2EC0A 4IH6A 4ZCKA 5JUMA 2W7PA 4AL6A 4JI5F 4YFUA 3V6KA 3KLHB 3GV8B 5HBMA 3PW0A 1OQ6A 1UFWA 3A13A 1KOOA 2IAJB 5C25B 2N4DA 3CJ3A 2GAGC 4PG7A 2BA9A 1U7LA 1HQUB 3BR9A 2ZNZA 3G9CA 3AA9A 1RT6A 3CCZA 4TVAB 1FJCA 4R5PA 3S1TA 1IKXA 5JXSA 1N5TA 5EGYA 3AB4B 4ECYA 3D28A 1GX6A 3HCXA 4C3LA 3Q8QB 4DR1J 1YJVA 4WTYA 3MEDB 4U7CA 1VQMS 1WEYA 3QSYB 2BEFA 4CNZA 1T95A 4YS2A 2IDEA 1S9EA 3CJ4A 1NSQA 1JMTA 1HNVA 2ZNYA 2GO9A 3CT9A 2CNNB 4ID8A 4NLYA 5IWAF 3FKBA 3ZZZA 4QZVB 4ZHRB 4IO1A 4ER8A 1U48A 1PG5B 2DR8A 4M5KA 1S0OA 3JSMB 2VBWA 3DLEB 1T05A 4QYZJ 1H7XA 2C2NA 1GMWA 2X3DA 3H98A 4K8RA 1TV6A 1VYAA 1SJFA 3GPAA 4FVCA 1CVJA 3TA1A 4WP8A 1B70B 3MR6A 1I3OB 4UY8T 3JYTA 2AKWB 3NAHA 5A0YA 3FNNA 1N5YA 3OFGA 4OHZA 3U7JA 3MURP 1RT2A 2VPZB 1HIYA 3CCVS 1ZYQA 1VQ6S 1IVZA 5B0EA 5T41A 1RBOB 2Y1IA 2PGCA 3ONQA 3PEHA 1U6BA 5LMNJ 4IR1A 5G0RB 4WZQA 3PX4A 1V3ZA 3CPWR 2RIJA 2IBOA 1R7IA 2XSJA 4ZP6A 2KH9A 4IOCQ 1S9FA 2Y8WA 2CJYB 3GZ7A 5BYSA 2G2ZA 2JNJA 5A6PA 2XO7A 2QSFA 1G1XA 3TO8A 1BHNA 2N7YA 5H9FK 4LBPA 2DXEA 2ROEA 2BV3A 2HHUA 3HJVA 4LF2A 5KG6A 3KWMA 2GGPA 2N4CA 4X4SA 4HTIA 5DQHA 3K57A 2XMMA 2V9KA 2DIVA 2D1CA 2HQGA 2RILA 5A8RA 4LQ9A 4EBCA 2YWKA 3V6DA 2BE7D 5ETQA 5IV4A 2DY9A 4N56A 1FJ7A 1FCAA 2HBYB 2QYCA 4EZ9A 2R4FA 4J9QA 1C1CA 1C4AA 2BE2A 2HFNA 4O23A 2NZCA 4M5HA 4D3GA 2CJ9A 4YR3A 4DL7A 2FZKB 3ETOA 3SSRA 3OHBA 2D3ZA 4YR0A 2A6MA 4DSFA 1GXLA 1P8GA 1ZBTA 1RWVB 5DLFA 5HSPA 2GA7A 3DU5A 3OPKA 3BBCA 4KSEB 4K4ZA 3A4TA 4NLWA 1HBOA 2JL9A 3BN7A 2J9DA 1EJ7L 3H2LA 3P3DA 4ZVSB 3GCXP 3MXHP 1B7FA 2DJWA 4E2FB 5KT6A 1VQLS 2CA9A 4DV0F 4CLLA 4J9KA 1RT3B 2DHAA 5DDQC 2IM0A 2MSTA 3LTOA 4LFBJ 2GV1A 1HMVB 2W2NP 4QWBA 3SCIE 4EU0A 1N33F 3MAQA 2KVIA 1MWZA 3BBFA 3OTCA 3RB4A 3H2VE 4FYYB 4IH5A 1WKJA 2HLTA 2OD4A 4ELVA 4NI2A 1RTDA 2RU3A 2WSCC 1FRMA 3MHYA 4MFBB 2XZWA 4DUZJ 1HL6A 2PE8A 3EWGA 2HNDA 2LKZA 2HVIA 1X60A 5EUHA 2LQJA 3R5BA 3MM8A 3CW2C 3U02A 1BWEA 5D0GA 2RJZA 2F8EX 2WK4A 1BY9A 7AT1B 4LFAF 5IT9Y 2MGZA 2CVIA 4ED5A 2L9WA 3IRXA 3OUYB 1UVNA 3HLUA 4X4VA 1DFDA 2KT5A 2ZBIA 2ZUGA 5BR8J 4DZDA 5HJXA 4QWDA 2JHEA 5E0OA 2IYIA 1EARA 1S1UA 3G2XA 1XMOF 1UKUA 5A2QU 3M8WA 3JXOA 2EKNA 3R97A 3M6XA 5KFJA 4FP9A 5DDPC 2W9AA 2DH9A 4C8KA 2YKQA 2VB6A 2R8KA 3TR5A 1S0VA 2OSRA 3TX8A 2DNNA 3D3BJ 3IWLA 5ETMA 3UO0A 3MI7X 1RTJA 3R5CA 3KUEA 4LF6F 3KJNB 2M2BA 1PCAA 3O44A 4ED3A 4TY8B 4DL2A 5HP1A 1M1KT 4B9SA 3US5A 1EQMA 1DQ9A 2DHXA 3D1HA 4IFVA 1M5KC 2Y9HA 2V9WA 4RBUA 2E9ZA 4ES3A 4OLPA 5FLXU 3MFIA 2PDAA 1V3SA 3AFGA 3GG0A 4RNHA 2YWHA 5HLFB 2CZ4A 1TKZA 4A8MP 3TARA 2KRRA 2JH3A 2QLWA 1WDTA 4CT8A 1H2VZ 1SC3B 2G0IA 3HSJA 1KQKA 5AXNA 4O4GB 5LJ5Y 2C22A 2DH8A 1NKEA 4F8RA 4USVA 4ZPDA 4BC7A 3EGVA 3GIMA 2E44A 2Z58B 5D4LA 3O3LA 4H4KC 4ENOA 2CWKA 5T14A 3QSIA 3HVRA 1U1NA 1EZZB 3TAMA 4NLPA 4X4NA 4URQU 4X4RA 1LW0B 2OEKA 2V6AA 2HFOA 4KRWA 4V19X 2RDIA 2LYVA 2XS2A 4DLEA 4DR6F 2B9EA 1GH8A 2AJ0A 4X64J 3PHTA 1D09B 3JTPA 4O3NA 2WZ1A 2HHSA 1QUVA 1S1TA 1UJ6A 5F8MA 2NXCA 3IAS9 1X4AA 3LP2A 1K8AT 3EZUA 2HNZB 4B3SJ 4A8QA 1UTAA 3F44A 3UDCA 5IOLA 3CCRS 4DSLA 2VU5A 3ZZUA 3N9UC 1RT4A 1V3RA 2HRTA 1MMNA 1ZM4A 2E5IA 5DRKA 4RUAA 4J9SA 1X0FA 1YK9A 3LAMA 8RUCA 3G6ES 1D9AA 1FKOB 1PSDA 1RWPB 3Q8RB 1K73T 2YWEA 1RTDB 2P5VA 4U95A 3QJJA 2AGPA 1C4CA 2OP5A 4UW2A 3BDEA 3SCLE 1YTYA 4P71A 4ID5B 1GT8A 3PG9A 3QGGA 5HROB 3G96A 4B3MJ 2OFHX 2E1CA 2RKIA 1QVGR 4UOFA 1NK8A 3A3OB 4B9NA 3RRHA 1L3VA 3FSYA 2VKRA 3JTNA 3T1AA 4N76A 1ZAVA 1EAYC 3FMWA 2FVRA 4JI1F 1RHJB 2C3YA 2YY3A 1MWQA 1SUQA 3MTKA 1F5CA 1GQEA 4H54A 1K1SA 4DR2J 4ICLB 1EIYB 1S6QA 2JRSA 3PO5A 1V5IB 3JQMA 1RBLA 4N77A 1NRKA 2MPUA 4LSNB 1VQOS 4NXNF 3FDSA 1RLDA 2CADA 1JKHB 1GXUA 4PWDA 1X8DA 2B4PA 1HFEL 1HBUA 2XYPB 4A8KA 3T5JA 1JLEA 3B4MA 3MF5A 2GIQA 2Z30B 4DEZA 4F4AA 4JV2A 2VG7B 1SL1A 4YOEA 1MMLA 2E5GA 5BYRA 5AE2A 4J91A 3T1YJ 2ZHOA 3CD7A 1RAOA 2VD3A 2Y3YA 4O44A 1FK9B 3HI9A 3R9LA 4A8SA 4W90B 1UWAA 2OH2A 4ZVGA 1KVIA 3KJFB 3BN4A 4QWCA 4DV2F 4NLGA 4K2XA 4UUXA 4KV8A 3JAMU 1QSSA 2R42A 4J9UE 2HSEB 3EICA 4CTAA 1VRUA 4URGA 3ZNUA 4B17A 3MUMP 3RW6A 2WCXA 4XPCA 2N3LA 5G4DA 2DRDA 3QLHB 3OTOJ 4ZPCA 4ZVHA 4JI6J 4DFMA 4DU7A 2NR0A 2XSJB 1RAGB 4DCPB 2K1RA 3MM5B 2VONA 2KVQE 1SJQA 5BXIA 4PXDA 2I6WA 4F3QA 5F9LA 4N41A 1VQNS 1HWKA 2RSQA 3W5ZA 1WG1A 2CG8A 3GCWP 5CQGA 2O01C 2UUCJ 3EDQB 1R8AA 3GFXA 3L9ZA 3ZFVA 4F0HA 2X1BA 5D78A 1N88A 1TL5A 5HO4A 5KT3A 1VMBA 3RG6A 1KFDA 4AXIA 1KVKA 4I1TA 1H3DA 1I94J 3KOAA 2VDIA 4DSIA 3X1LB 2JEJA 1CJUB 3CCTA 2I1RA 2PT0A 2OO4A 2FLLA 3HVTB 4IKAA 4PXCA 2QX0A 1VQYA 2HS0A 4TU8A 4J9MA 3DOMA 1JXVA 2G2YA 1JNRB 4ETXA 3FVYA 4C8YA 1WD6A 4B3RJ 2K2PA 1RTIA 4X65F 2ZWPA 3P4UB 1NCLA 4DDFA 2F63A 2WOMA 1UVMA 4IDKA 1C0UB 2QL7B 3ZZTA 1DQAA 1IJFB 1T11A 5DZ7A 5A8KA 2W2MP 3WC2A 2NZ4A 2HQCA 3D0HE 5BJRA 2FJWA 3OFFA 3BYPA 3LPYA 3OR1B 3QT7A 1JLAA 4CO3A 4DV1J 1UETA 2MQ8A 3A12A 4JI8F 5DG7A 3SI8A 1S0MA 3DLHA 4JI4J 3C14A 5DZ6A 2XM3A 1TR0A 1HQ2A 1T94A 2PFDA 4ZVQB 1L3UA 3VAJA 1S72S 2MMYA 3C15A 3KUHA 1HD1A 1LWCB 2H5JB 4B08A 2MQPA 5EDWA 3VAIA 5CHCB 3R2DJ 4OI6A 2F4FA 5D0RA 3FBCA 3ET6B 1BQXA 2KJWA 1NO8A 2J8SA 4I2QB 3TAQA 2FC8A 5FLXY 3CMAS 1NJYA 4N47A 1NJZA 1SL2A 1F0XA 2YTCA 4N8NA 1NDLA 3M8YA 1ZA1B 1EETA 3Q8YA 1YKWA 2FPHX 1UZDA 3T9ZA 1WHWA 3TZWA 4LF9J 4MK7A 3DHWC 3QBCA 1Z2LA 2W7AA 2MKSA 4HYKA 1HBNA 1R0AB 4P2SA 4KO0B 1CULB 4J9PA 2MY7A 1NPPA 2BUNA 3G86A 3K5NA 4LF5F 2HHTA 4KAIA 5A2QY 3AAWB 1TK5A 4QPTA 4OX9J 1VK3A 2AYMA 4KKOA 1IWAA 1JB0C 2VFSA 2DK2A 2XHWA 1MN9A 5KFRA 3KLEB 2AJ4A 2RNEA 1U47A 4GRSA 1R0AA 3VAGA 1TL4A 2R3VA 2QLBB 2DGUA 4M63A 1LWFB 1NBEB 4DR5J 3VALA 3V81B 1VC6A 2ASLA 2ZH1A 2QG9B 4G1PA 3RGIA 1HNWJ 5LSOA 4M5DA 2HBRB 4NLXA 1QY7A 2KDOA 3KLIA 3AOBA 2P8IA 1FXDA 1NZ8A 3B6BA 3ISND 4GVBB 5MLCV 4JV1A 4CZCA 2MLZA 3FEYB 2FJDB 1C1CB 2OPPA 1U2CA 4LSZB 3BO4A 3HSZA 1RKJA 1C0TA 2VG6B 1UEVA 3OT9A 1N0UA 1CJVB 4QQBA 2MQQA 1FDDA 2OUGA 4CIOA 3G8SA 3MGJA 1N6QA 1OY8A 2DB1A 4WK1A 2ZH2A 1H0HB 4CM2A 3OD2A 5E3PA 3KG1A 2CUYA 3C14B 4OYAA 1RADB 2NXUA 5CXTA 5GAEI 2DNZA 3JSBA 4P9SA 2DR6A 1IQZA 2JLEA 4ZITA 2R7UA 1IUJA 3UDLA 2JVOA 4KH1B 3UVJA 1VQSA 4QBUA 4DR7F 3D68A 1T0TV 3EMTA 4EMDA 4RNMA 5JVGQ 3I31A 5H9FJ 1IBLF 3T6BA 4NZ6A 3BKTA 3MUTP 4LRAA 1YJ9S 5DGAA 1VJWA 2WOMB 3PTWA 2D41A 4PKDB 4R0JA 3PEJA 1ZPWX 1T02A 2DO4A 4IYQA 3NGDA 2OEJA 1JIHA 1E6VB 1PC4A 1RCXB 3AJ2A 3R5AA 2P2CB 4C0BA 1IQTA 1SKWA 2ZH3A 4AE5A 4DV5J 5F8HA 3DRSA 4CLPA 1X9WA 4FYDA 1LQ9A 2LA4A 3M05A 4DV4J 2CDQA 3MAAB 1WSRA 4AD6A 5IT9U 2MKKA 5F8GA 3MEEA 3QGPA 4NYPA 4DV7F 3RTVA 2IVYA 2GS8A 2R7VA 1AW0A 2PEHA 2DNGA 2ZKUA 3A3NB 1NSPA 4OX7A 2R2SA 4A8YA 1HPZA 5GMDA 4B3RF 1IKVB 4GVLA 4KQZA 3ZZPA 4M5NA 2V8DA 3DC2A 1KR4A 2OI2A 5HI7A 2GVDB 1SBRA 2V2VA 4ZMMA 2ZE2A 1GEHA 2DXFA 1KS2A 4OI1A 1XTZA 1KONA 2AT1B 2ZZNA 4C11A 3DLGB 4DUYF 4B9LA 1Q1KA 2HVZA 3CNQP 3KLIB 3TJAA 3VTIA 4LBHA 2CXEA 5C2CA 4ED2A 5H9EJ 2FUG9 2GJ2A 4H4MA 3NGSA 4FYXB 4WU3A 2GVDA 3P5TL 2NXEA 3HKZD 4ZCLA 2CNOB 4P73A 3HP6A 5ETPA 5L9XA 3IR6B 5HMYA 5E3RA 4CTAB 1F2HA 2M3DA 2CPDA 3NS5A 2IAJA 5B0GA 2J7KA 4PG4A 1NH8A 2ERRA 1I6JA 3C3LA 1UVLA 3UD3P 2GJIA 1LNQA 1WI6A 2NYIA 3DOKA 3GYXB 5HBMB 1VBXA 4OQJA 1W2IA 4PEOA 4HEA9 1BE4A 1Q16B 1UZHA 1PIEA 1F2GA 4RU2A 4HHUA 2V4JB 2EKYA 1DARA 3G82B 1S1XB 2CQ0A 3IWNC 1HD0A 2LEPA 2VG7A 4I7FB 1WEXA 3SCKE 4ZVFA 3G87A 1RT7A 1TMJA 4ECXA 3Q8VA 3W9HA 2PMWA 3OJUA 2VL1A 2F4VF 4ZA1A 3OLBA 1EETB 1T9YA 2I38A 2Q1LA 2ZITA 3N6NA 5LL6d 1N56A 3R27A 1S9GB 2E1MC 3RB3A 2Z4PA 5J2QB 2QZ8A 2FGOA 3LP0A 4USTA 1JLFA 3TW0A 3MFHA 5C24A 4UQGA 1B3TA 3CMQA 3KHRA 1Q95G 2CIMA 3FRYA 3ZZRA 5L1JA 2K7JA 1YBUA 4CLFA 4YQWA 1F5AA 3RAXA 3CD6S 1N6QB 4N5SA 2W2QP 4OHVA 4GC6A 4BS2A 4JI7F 3OSNA 1X0PA 5CYMB 3OR1A 1AUSL 3PFEA 1U4BA 3FSIA 1LK7A 3NG8A 2WONA 5A6WA 3A3PB 2XZTB 3TJ8A 3SSSA 5IQ6A 3KJVB 4DR2F 3PW5A 4KTQA 1H72C 4WYLA 2FHJA 3MMCA 4X4OA 1S79A 4KHPF 1YI2S 2LP4A 1XR6A 2E7WA 3DGPA 1HWLA 4I6YA 6AT1B 1FJGJ 4ZCMA 3V81A 1FA0A 2VKZG 6FD1A 4NCGA 1CPZA 1CS4A 2EFQA 1T8EA 2JDJA 3VR1A 1WF1A 3N0VA 2H9ZA 2MKJA 4OZLA 4IRDA 1CJUA 1NSKL 2DNMA 3O8WA 3MM6B 3ZTRA 4WP9A 4NLOA 3H90A 1KSPA 3SDEB 1NJIT 1K47A 3PO4A 4MKBA 4A4JA 1U2RA 2QIFA 1HBNB 4GKJJ 2OPSB 3AQOA 4C8OA 4NLSA 5J2NB 1MSWD 2UUBF 1ULRA 5KFIA 4DR4F 1JQGA 1TMMA 3I5CA 1UVJA 1U0SA 5KG3A 4Q45A 4CO1A 3KHGA 2ZHBA 4MJKA 3KMQA 3DHXA 2JLGA 1BMQB 4FXDA 2V2ZA 1RAAB 3LO3A 3GTYX 3ITHB 2JX2A 4I2PA 2WAQD 4NLDA 1N8RT 3UDEA 4LVOP 4C8MA 4ED4A 4ZPVR 3AT1B 1D3WA 3UNGC 3V5RA 1J5OA 4FF2A 1EB0A 3ILLA 3CDUA 1R6VA 5T7LA 4KPCA 2EPIA 2YKOA 3H42A 3D67A 1Y3JA 3CWJA 1GMUA 1TKZB 3HVTA 4LF7F 4F3OA 3DYAB 4YDDB 3OFEA 5IZHA 3OBIA 2A3JA 3CO9A 3KXDA 5AT1B 1YHQS 1RKIA 3DDIA 3ZZYA 3DN9A 2CNLB 4Y65A 2X7IA 5SUHA 3J80U 2Z2MA 4CWBA 3FRZA 3I6PA 4XIUA 2ACMA 1DJ0A 3HPOA 1RUSA 3LALA 4DV1F 4PCQA 2YWWA 5KT7A 2ZOMA 3Q23A 1RWNB 1C0UA 2OLWA 2XI3A 3ENWA 2RS8A 2BR0A 4L3KA 2MDAA 2MLXA 3I82A 3S6EA 1UPMB 4DV6J 4LSNA 4KJIA 1OPZA 2OPRA 4ANDA 3E2EA 4OX8A 2POKA 2LDIA 2YXLA 5KOXA 1DTQB 2HURA 2R7OA 1EQ0A 4FPRA 1JXEA 2C3PA 4CRJA 4Q44A 3CD0A 3E3XA 3LWMA 4IFYB 1E6YB 2F40A 4DU8A 4WKRA 1BC6A 1XWLA 2KO1A 5D77A 4I67A 3CGIA 1FK9A 2Z8QA 2ZHAA 1BQNA 1DAXA 2J6UA 1JWWA 4C8NA 3M30A 6FDRA 1Q81T 4PQAA 3KK2A 4Q5VA 3IRWP 1K0VA 1SIZA 1X31C 2G0JA 2R8GA 3M2VA 2ADBA 1Q8BA 1RWXB 3DDNA 4DPTA 1T03B 4K4UA 2K1RB 1P6TA 5C5JA 3MR7A 3W2WB 2ATLA 4NCBA 2BJ3A 3M30B 3QLHA 1VC0A 4CLYA 3EUNA 3HZGA 2HBQB 1HNXJ 4KGMA 4LF4F 2MZSA 2MZQA 2OD6A 3NWGA 4OJGA 1T9TA 3M8PA 1Q7YT 3DRPA 1FI4A 1S1TB 2WBMA 2DCUB 5KFVA 2RAQA 5C24B 5C7PA 3EDRB 4ZS6A 4DL3A 1AT1B 4USIA 3GJTB 4RZRA 5K8OA 3VQSA 3JAMY 3ETMA 1TL3B 1NMEB 4RW4A 4IG3A 2LEAA 3T6JA 2CAJA 4H4KA 1LW2A 1JLEB 3D0IE 4PYDA 2AV5A 4ZPBA 2V68A 3BREA 2BZ2A 5KG2A 3ZXWA 4DV6F 2CJKA 3NGUA 4DV0J 4K4YA 2HFSA 4DCJB 2CZ9A 3H5YA 4UOCA 1BXNA 2H1YA 2VFVA 5F41A 3KKFA 2V4JA 3G82A 4EBEA 1FWPA 2XTJP 4N7TA 3C6TB 2AX1A 3IBFB 3BQ1A 5A8RB 4WZMA 2DEJA 3AA8A 1ROFA 1TL1B 4OIXA 1UAWA 3SSQA 4ES2A 4DL5A 1N36J 2HNZA 2LU2A 1UP1A 1HI0P 2DGTA 3OL6A 3J81j 2CQIA 1IWGA 3S7RA 2BOAA 1SB6A 3MUVP 2QTWA 2V50A 2WRMA 4DR4J 4B3TF 2KYZA 1WF2A 1H2TZ 3LGMA 4IH7A 4WE1A 3PW2A 1SL0A 3H5UA 2M70A 2ZUAA 4DI6A 4H4MB 3TEHB 1NDPA 3Q8PB 4JI7J 1JK9B 3IO1A 2DXDA 4Q0BB 3QNWB 3W8GA 2GZOA 4WXOA 3SV3A 2EG2A 2ILYA 1UCNA 1D8YA 3TA0A 2BQ3A 3KK2B 2MY8A 1RP5A 2B7BB 3B4DA 2PO4A 3GP9A 4Y34A 1Q4RA 2U1AA 1I1GA 3AD9C 3UFCX 1RT4B 4NRUA 5HVHA 2W8LA 2GCFA 2BQUA 4G65A 3TUIC 1VC5A 2AEMA 3SEOA 3W2VB 3M1VB 3W65A 1HPZB 3IA0A 2FHMA 2IJNA 1FX2A 2UVUA 1FJGF 2XY5A 1UMJA 2ADCA 4UZCA 4NYZA 1FJEB 1DTQA 2DGXA 4DX7A 2AJ2A 2R2UA 2VPYB 3SCJE 5K5MA 3V2UC 1LWEA 1TU0B 3T19A 3VGSA 5IWAJ 4IFVB 1TL7B 1LW0A 4NZ7A 3HKWA 3QMQA 4JBCA 3LUYA 4J9LA 1W2BR 1AROP 3GYNA 3QZ7A 4WCEQ 3OJSA 4NCGB 5HP1B 4YR2A 3M8QB 5DS7A 3UDVA 2XGPA 3QATA 4MFBA 4DR1F 3SYZA 1HARA 1TKDA 2YKAA 5ETNA 2LXIA 4OJHA 4X4TA 1HLWA 2YPZA 2KN4A 4NOHA 3W8PA 4BHQA 1S5ZA 5GAHU 2CDRB 4M8LA 4RO0A 5DM7Q 3M32B 4O4GA 3DXSX 3GIJA 2FLNA 2EFPA 3TQ1A 4YB5A 5C25A 5JVHQ 3SXLA 3HXMA 3I4PA 3OTBA 1TZ0A 3TJ9A 2F65A 1T9XA 2EXUA 3R6LB 4FZVA 4KC5A 2HQ3A 3ICLA 1IBMJ 2DGSA 3IRXB 2F8MA 5LSRA 3OUYA 3GQCA 2QA4G 2NS1B 3H8YA 1TKXB 4NEZA 4JI3J 2DGQA 2DR9A 3FBEA 3MM7A 1GMVA 4JI6F 1J5OB 3FBBA 3BGLA 1F1BB 3MEKA 3FQKA 2M7SA 3TZZA 5KFHA 3ITHA 4I2PB 1S9GA 2O3DA 3ZO7A 2XLJA 4B9TA 3C8YA 1VRTA 2DNLA 2RE1A 2F3JA 2V34A 4JOUA 2J0SD 1LWFA 1KTVA 3CJ0A 3CCJS 1WI8A 4IG0A 2B4VA 5F3ZA 3IBCB 2YWGA 2B7CB 4ZOSA 1PYSB 1KQGB 2EW9A 1SQFA 3OXGA 4NA2A 4RBTA 3SDEA 3WDOA 3PY8A 2J76E 4K5SA 1RI7A 3WIVA 4WK3A 4KKOB 4HDHA 9RUBA 1I94F 5BR8F 1S4FA 4X66J 3AY0A 1APSA 5B7WA 5B0FA 2IM2A 2XI2A 2Z2YB 2ALZA 2JC1A 2LCWA 2W4CA 3U1MA 2DNYA 4HL9A 4DPWA 3CIMA 2WVBA 2IA0A 3M8ZA 1WORA 1L3KA 2CQHA 1YLXA 1YRXA 3QFHA 5KFQA 3I5BA 4ZJLA 2MQMA 1ELOA 3GJSB 3VGTA 4F36A 1X4BA 1RWMB 2A2DA 3GFYA 5EX3A 5M2UA 1NK0A 3CEDA 2GO8A 2KRBA 2LDYA 5K9FA 5GAGU 1SH0A 3L7OA 2COLA 1GMWD 2IMOA 2IRYA 2YNIA 1ZZNA 1RHQB 2XY7A 3AQPA 2FVQA 4OJ3A 1NZAA 2BW2A 4P52A 4P6QA 1RT5A 2XNQA 1DTTA 3K7RA 3N5FA 2APOA 1JJHA 1Y9OA 1FERA 1WF0A 3LOUA 1V5VA 1VCTA 2JVRA 5EWGA 1C2PA 3FUYA 2BKOA 1XNRF 3QZ8A 5I42B 1FTCA 2FIUA 2UUWA 3OXLA 4DQIA 2HG4A 3D66A 1JLFB 1YJ7A 3UWTA 5J1PA 1YRUA 3AH6A 1S10A 2VBZA 5KFBA 2DRBA 2BDPA 1F9EB 2N7CA 3QRRA 4QWAA 2YH0A 1VR6A 2ROGA 3TAPA 3CMES 1UL3A 2XC9A 3TZYA 2ZEJA 1UW9A 3PCOB 2VHGA 4DUYJ 1E6VA 2MSSA 3JQJA 5D0EA 4C2MA 2VQFJ 1HR0F 3PRVA 1WTBA 1NU4A 3R5JB 4CCHA 2OAUA 3FBFA 4ATNA 2E66A 1HHSA 2YNHB 2ZC3A 3W5YA 4BC9A 4RNNA 4LF5J 3PR5B 3IS9A 2B8QA 4G6VB 2J9DE 2BJ8A 3RBZA 2BE9B 5KT2A 2H54B 4I56A 1HYSA 1QD1A 1TV6B 3BGRA 3DMJA 2HYIB 1RT1B 4URSA 5FDLA 2MKIA 3KMSA 2HNYB 2MEWA 5LT5A 4RW9A 4DR5F 1CJTA 3R1LA 3NS6A 3AJDA 3RUBL 3EPIA 2XULA 1XR7A 2AX0A 2ASDA 2HFZA 1LKZA 2LA6A 2UV8G 3MMBB 2H5EA 2XLIA 1FDBA 1UEKA 5L1KA 4NA1A 4J37A 4Y2MA 4GVBA 4C11B 4PG8A 2RDDA 4RR5A 4DWIA 4QYRA 1UW4A 1FVSA 1FDAA 2EWHA 1FWKA 2CQDA 4DPXA 3CC4S 1SQEA 4ED8A 4JI2J 1O8BA 1WG5A 4A8XA 1QE1B 2J0XA 4KR0B 5I3QA 2DNRA 4DFKA 3HJFA 4J9RA 3GIKA 4F67A 3D6HB 3DLKB 2YKPA 1HI8A 4KV8B 4F3MA 1QSYA 3VZIA 3V6JA 4P7VA 4X4QA 2JEGA 4CH0S 3TANA 2IJFA 1SH2A 4ZHRA 3TUPA 2L41A 1RWUA 4KO0A 3BGOP 1JLCB 1VI7A 4MAKA 1XMBA 4MK8A 4ECRA 3A8JA 3CJQA 3LW5C 1LK5A 3EXYA 3FCWA 4KBIA 3GR0A 3IM9A 4MH8A 5LOQA 2NSCA 3MEGA 1L5UA 2PN6A 2VQFF 1AZSB 2C2MB 3M6VA 4MIBA 2KHCA 2XEXA 1PKUA 1VRTB 3VGUA 2ZDPA 3KJQB 4B9VA 2AIRB 4P2MA 2PMZD 3QT5A 2RDJA 1TFWA 2DPIA 3AD7C 2NXJA 1Q8KA 1QAIA 4F4WA 3MOJB 2HHXA 2GQ2A 2M52A 4NE9C 5L38A 2DKOB 4GC7A 4HHJA 2UUCF 1M5SA 3BKFA 1CQNA 3D7SB 2EK1A 1DLOB 2O1PA 2BRLA 3ZTOA 5KFDA 3PIPQ 3Q22A 2VJUA 5I42A 3NY0A 4FF4A 2H51B 1YWXA 4DL0C 1VDHA 1Q8IA 2NUHA 1OY6A 1U1KA 1KN6A 2FYXA 3R5DA 1M5PC 4QU6A 1SC6A 2PSZA 4ZP9A 2HMIB 2V8VA 4GO5X 4JI4F 3QIDA 1RU2A 1XK8A 1WDDA 2XZDB 1Y7PA 1OQ3A 2ZJRQ 1L3SA 2GMLA 2Q79A 1J27A 4CO2A 4HT5A 4EK2A 4UUWA 1QVFR 2AW0A 1K44A 3VCDA 3VAKA 1S12A 2RRBA 1RB0A 4OYIA 1N5VA 4F26A 1RTIB 2F1FA 2YNGA 1FRIA 1A0OB 2NCKL 2K3KA 4Z7YA 4TQRA 2JEFA 4ELTA 4F2SA 5F0UA 2BMBA 4ANEA 5LMUJ 1FKPA 1T9WA 2OEMA 3D2WA 3J7A1 1Y4ZB 4F50A 4UOGA 1SCJB 1FNMA 1SV5B 3C19A 1CC8A 1RAHB 1HW9A 1REVA 3DI6A 3PYGA 1KBRA 5JJBA 4L75A 1S0NA 2V8GA 4ANCA 1S1WB 1O5JA 3PW7A 2BANB 5LXYA 1S59A 3DOLA 5LMUF 4PQUA 3ENQA 3BSCA 3OFHA 1GK8A 3TAMB 1RJJA 3GV7B 2P9CA 3O5TB 4DF4A 2PD1A 4DX8H 1X5PA 5EHHA 5EN1A 3BJYA 2WSFC 4CLUA 1KD1T 1VLYA 1W26A 2ZOFA 3GJQB 2PI4A 1XNQJ 1T9VA 3PFOA 1LXNA 4KGKA 4OYXA 3CE8A 3E8OA 5KFTA 1VQ4S 3MM7B 3IGNA 2ZC4A 1TKXA 4NX9A 4O3OA 2D9PA 2L9DA 2IC3A 2EBEA 3CDAA 2LQ5A 1CLFA 1RSCA 3PKYA 3KDNA 2MQOA 2GFFA 3MECB 3PIOQ 3CCES 2G9OA 1FRJA 3ISNC 1RAIB 5D0HA 2QYGA 1KLMA 2JSXA 4H4OA 3W9IA 1M5HA 5GADU 1FE0A 1TL1A 1URRA 2QA2A 3IS9B 1GNKA 2YVSA 2ZBCA 5E41A 1U09A 3QPIA 1N32J 3HHLA 4EFAC 4XO0A 4KHPJ 3PRBA 4EWTA 2E9RX 2LXFA 4O3PA 3SFUA 1N34J 3ZC4A 2GQQA 3M8QA 4C98A 4A8OA 4NLTA 3BH6B 5CCMA 1TUWA 3OL7A 1ZTWA 4OI3A 2H65B 1TL3A 3HT3A 4QCLA 4ICLA 5L1LA 4DCOB 1FD8A 3KG4A 4B9MA 1SUQB 3R7BB 2MKCA 1EP4A 5ADZA 1L3TA 2DGVA 2R8JA 4ZVTB 4K4WA 4NXMJ 3M2RB 2Y8YA 3L09A 3IAM9 2B9WA 3F56A 3Q8UA 4NL5A 7FD1A 2UUBJ 4OHWA 5KFFA 3BF4A 1REGX 4LR7A 4WFAQ 1AYEA 1CC7A 2RUGA 1ZM3A 2V2KA 1R8CA 2OSQA 2HNDB 3RW7A 3TWZA 3H40A 3RBDA 4FKYA 4CYUB 4DG1B 1AXQA 1VS3A 4KT0C 4UT4A 3TVYA 1T3NA 4CLWA 2J0QD 3EGWB 4TYAA 1T03A 4USUA 2IMWP 2IJRA 3RJMB 4ZPWR 4C6AA 1FKOA 4QIFA 4M95A 3QYYA 5KG0A 2ZD1A 4XDCA 2O67A 1WELA 3SV4A 2QE5A 3DLLQ 3X3UA 1ACMB 1Q78A 1RT3A 2VICA 4TYBA 1N54B 1JLQB 3UCGA 5HJYA 5HN0A 3VQTA 4QWEA 2FJVA 4IFYA 4CO0A 4HVZA 4MT1A 4RKUC 3I9ZA 2ACYA 4XAKA 3UN5A 4JI0J 2C1EB 1HA1A 3JQKA 1U8SA 5KG4A 4C3KA 3PACA 1FESA 3GB0A 3IR7B 4X64F 3TZXA 1N5SA 1GX5A 2ZD1B 5B0BA 1VBKA 4OZNA 4ED6A 2DHSA 4LJMA 2R7TA 3NOCA 2HHPA 1PJ5A 3THVA 2BM0A 2LVWA 4DPUA 1AFIA 4FXVA 4DX6A 1JKHA 4IR9A 4PPZA 2D3OR 4OZ0A 2HGNA 1WC5A 1YJRA 2W2PP 1U8WA 4FYVB 3VWSA 1N36F 2QC3A 2BKNA 5F8IA 4DFPA 3SQGA 4WXWA 1ZM9A 3F41A 2RRNA 5J2PA 3POTA 2FY1A 2GGPB 4DFJA 2HHHF 2DRAA 3DRPB 4HACA 5KG5A 1VHIA 2F5GA 3MD1A 5KOWA 4K59A 4OX9F 1EP4B 1Q5VA 3SQOP 3BKUA 4WIQA 2NXNA 2YQ0A 2QRRA 4UY85 1SKUB 3K8WA 3AOCA 5ETTA 4CP5A 4ZN3A 1WC0A 5HL7Q 4P2FA 4N8OA 2XS7A 3C16B 5E3QA 2XNRA 2YX7A 3EXCX 4PWWA 4RBVA 3M2VB 2CVEA 4OJ1A 4YY3F 3HO1A 4LF8F 2E9TA 4XTTA 2CJQA 3PNIA 2KZZA 1ZZFA 3AODA 2A6OA 5A0YB 4RUCA 3W63A 3G71S 1N5YB 2AHOB 3PJXA 1NK4A 2EVZA 3OVSA 3H2UB 1LWEB 4GMKA 4L3NA 3KLFA 2RF2A 3M2RA 2UXCF 2XMUA 2MGZB 3EE3A 2IC3B 4B3OB 4ZIVA 1S76D 3CDWA 4FKXA 4ECZA 1X9MA 3KFWX 3OW2R 2KB2A 2OELA 1FKPB 1FO1A 1RXOB 2OPRB 1FRHA 2AF6A 2K3IA 3CSKA 4FXWA 2FQQB 4FBUA 4U96A 1FE4A 4LFBF 1S9EB 3A8IA 3BB5A 1TP7A 1YX2A 4WBFA 5D6GA 4LIRA 5LXRA 1G2EA 1G4CA 2XCPA 2RT3A 5DETA 1IKYA 2FVSA 4YMEA 3HHLB 3K17A 1XJWB 4PZVA 1KKHA 2UVRA 3WZ0A 1B7YB 2MQNA 1FX4A 1OPIA 3DOLB 1N4LA 2W4PA 3I55S 2XO6A 3PRDA 3JS9A 4F04B 4ZVPB 4TU7A 2ZM6F 2VJVA 2G4BA 4DHVA 4LFAJ 1YDLA 3CDEA 3Q8SB 5IFMA 5KG7A 1UWBB 3HFKA 3LF0A 3FCVA 1HBOB 4DR7J 4KIAA 3MOZA 4Y2IA 4PYAA 1S48A 5GAEU 4PXBA 1PO6A 3AB2B 4EO8A 3L7PA 4YY3J 2BVZA 4IQXA 2C2OB 2M5YA 1WC4A 2RUSA 2ABYA 4R25A 3NCRA 4QR0A 2AWZA 3WIUA 3J7YI 3H7HB 4WYWA 1RT7B 3MR3A 4FS2A 5KFXA 1X4CA 4I7FA 2FC9A 1FEHA 3IG1A 2RU9A 4RL1A 2EFGA 4RW4B 4O3RA 4C8ZA 1MNEA 3CJRA 3CD5A 2CPXA 3IFEA 1QJHA 4DX5A 1S1WA 1P9QC 2MHEA 3J7Z5 2GC8A 4P72A 1JLBA 2M4MA 4C4WA 4UZBA 4A47A 1ZM2A 1HNWF 1Q82T 5KFSA 1HWIA 4EYHB 1RHUB 2K8GA 3N01A 1XN9A 1JLQA 4AXJA 1R3NA 3TNVA 3PYEA 5KFZA 8AT1B 4JI8J 2DBBA 2JFKA 1DBDA 5DJBA 3W64A 3Q0AA 4K4SA 1NKCA 2CQGA 3CCWA 2FGCA 3TA2A 4YUDA 1VRQC 2MLYA 3D1QA 4W4MA 1S7HA 2NLWA 5G0RA 3SBMA 1RCOB 4J9VA 5AXMA 3T3FA 4L73A 2OKQA 5E7OB 4QW9A 2VFUA 2ZH9A 4LR9A 2CKWA 2FDNA 1JLCA 5CYMA 3NS7B 4CYUA 4RU9A 2V4RA 3V4IA 1D0EA 1ZH5A 4RW8A 2JC0A 1LXJA 3BYRA 1Z2ZA 1FEEA 4F4XA 3W60A 3KK1A 4MKYA 2GHPA 2ZBQA 4AYBD 4KPYA 2K06A 2MXYA 3PX6A 4USKA 5KFYA 2R7WA 1RQ0A 2BM1A 3HVAA 3CJKA 3JSMA 2C2ZB 1ZPVA 1FRLA 3D1OA 3EJMA 4PG5A 2QN6B 1FNXH 5J2QA 1GAOA 3NNAA 1V6HA 5IC6B 1YJUA 2DYAA 4O0NA 1NNDA 3HF5A 4K0KJ 2FLOA 4DQQA 2JOQA 3VAFA 2YNHA 1S6UA 2G1DA 3ENVA 4PXEA 5CCLA 1WOOA 4ZLJA 3OSPA 1Q86T 4Q8FA 5ETSA 2Y1LB 1XMQJ 3HHNB 3M9NB 2Y1RI 4FDFA 3IWXA 5KFLA 4D3HA 2EFOA 4KHMA 3NBPB 5BYQA 1G6BA 2H48B 3EVWA 1PYTA 2VG5A 4QJVA 3OTOF 3KLVA 1RAFB 1B99A 1KHWA 2J7WA 2ZOGA 3OXFA 1SJ3P 4UOHA 4A46A 3CJTA 1KC8T 3NNHA 2E5HA 2PMHA 3IC1A 4OV1A 4NYOA 4J7CA 2AYGA 3MECA 2J9EA 3DYAA 4Q2MA 3HFZB 1YBAA 3BEGB 4K4XA 5DO2A 3DU6A 1LWXA 2M9KA 2E7VA 2B5JB 2VG5B 4FN5A 5T7LB 1HNIB 5CD4A 1S7IA 5J1EB 2VODA 3HHKA 2XMJA 3O6QA 4DBQA 3KDOA 2YBVA 1RABB 2KFYA 4F02A 2YNIB 4IOBA 2PFFB 3ILJA 3WC0A 4ZKAA 3AOAA 4AL5A 2I5JB 5IT0A 2KXFA 3B82A 3LGNA 3L3CA 3M9MB 4HTJA 3J81Y 4U7UD 1F5BA 1GTEA 1R0CB 1TK8A 1RZMA 2CFXA 3H5XA 2FD2A 1WEZA 2DNHA 3MMAB 1Q8LA 4QIGA 3G8TA 4DV3F 3D6TB 3P8BB 5J2NA 2HGMA 2KFZA 3HSDA 4G1QA 3HT0A 3FQLA 3EZOA 1R27B 3ZTPA 1IXKA 3BGRB 1TELA 3N79A 4EO6A 5K8PA 4X66F 4ECWA 3MPWA 5HMZA 5D8HB 3MEEB 1FFWB 3N6MA 1OMSA 1TVRB 3MAAA 1XBWA 3SIPB 3R6GB 4UTGA 2EG1A 2GHVC 4X62F 1QTNB 2HQIA 3DRSB 5HMWA 1K0TA 3QJLA 4LREA 1VIOA 2XMVA 2MJNA 1CS4B 2C2RA 1SI9A 1NK9A 3OVAA 2B8PA 4X84A 1U1OA 3MPVA 2GX8A 4LRBA 3TRGA 3DGPB 3D4JA 2QLFB 3HZEA 4DPYA 2R8IA 3OHAA 3W66A 1PGZA 3KYLA 4QU7A 2MZRA 1TKTA 3KG0A 2HHHJ 2IRUA 2CPIA 3OL8A 5D4OA 5E5NA 3C6UB 1BWVA 2MJUA 3LWLA 2R7XA 2ZZTA 3RZAA 4JI2F 2HVEA 2IM3A 4B9UA 2HRUA 4M94A 5L1IA 1HBMB 2YNFB 1IBMF 2Z2LA 1NJXA 3FFIB 1JLBB 3NLCA 3RAMA 4NXNJ 3A8KA 3GYGA 4C97A 1JJ2R 2DY1A 2V69A 1RACB 1IM4A 1RT5B 2A10A 4PABA 2VFTA 4IG0B 5HK4A 1FKAF 3LPEA 1FFSB 1WACA 1PILA 2CQ4A 2RB7A 3M32A 3C6UA 4P74A 4DUTA 5B0DA 2WW4A 3M6UA 1LOUA 3P49B 1AFJA 2QLJB 2P6TA 3QO9A 3K89A 1RA6A 1TUVA 1FFGB 2MZJA 4DJBA 5KTQA 4PG6A 4R0EA 4C0HA 2B6AB 3ADAC 4K4TA 2J6TA 1S6PA 5HVGA 1F60B 3R3TA 2ZH6A 2QO3A 5DLGA 2GVZB 2VQEJ 1IR2A 1ZAXA 2VUGA 3NGRA 4L74A 5KFNA 5LJ3Y 2ZKTA 5A76A 4EBDA 3RB6A 3UD4P 2KZMA 2W25A 2DGOA 2V2QA 4EGLA 1X4DA 1YIJS 5F8JA 3PHEA 4NPOA 5MAOA 3BPSP 3DLKA 3LP1A 5HQ8A 3IBWA 2W9CA 3G6VA 2AJQA 1RWWB 4I0WA 1F3VA 1P9YA 1G7CB 1SQGA 2ROPA 4OHXA 2AYBA 1W25A 4QW8A 4DQPA 3GIRA 3EZ5A 2UZAA 1P1TA 1OY9A 4OZ1A 3ULHA 2RRAA 5C2GA 1Y5NB 1WC6A 1O51A 3PDNA 4U8YA 2E1PA 2BACA 3VZHA 2F8HA 3MMBA 3Q86A 3MCMA 4CT9A 2VASA 1VOMA 4TXSA 3F0NA 3RRGA 3TQEA 3NEKA 1NK7A 1PYOB 4DF8A 1Y10A 1U0HB 1EKSA 2DHGA 2W1BA 3KNGA 3OLAA 3CF5Q 3K0JA 1J5EF 2RF2B 2UXBJ 3PVXA 1R89A 3KLFB 2E5LF 3W2VA 2W01A 1CSJA 5KFMA 1RDRA 1WSVA 2AMCB 2UV8A 1OO0B 1R8PA 1S4EA 2E1RA 2GQCA 3FEZA 4U7UK 4QR2A 4R8UA 1UPPA 4NASA 3W62A 3C6TA 3BQ0A 1WUUA 1MMDA 4DN9A 4ILMA 2IBKA 4O3SA 2R7RA 4ELUA 1QTMA 1PJ7A 2F9JA 2W9BA 3K8VA 2HZCA 2PI5A 1SVDA 3RRKA 4NXMF 1TFYA 3MMJA 1X9SA 1DQ8A 3PYFA 3DM2B 3Q2SC 4ILRA 1KHVA 2F9DA 2FHJD 1Q53A 2W24A 3J81U 1UA1A 1IKWA 2QEXS 4WE1B 4HI2A 3K2YA 4ZVUB 3HD2A 5FD1A 4KB7A 1NJWA 1DRZA 1VQ9S 3FMBA 1FD2A 2OIHA 2MB0B 3WQPA 5EWEA 3BSAA 4RUHA 5B08A 2NPFA 1U2FA 2Y0BB 4FS1A 5L46A 3VHQA 5I3UB 3SQGB 3I5AA 3AHPA 2MKHA 5J2MA 2QJ3A 1BQMA 2J8AA 3BGUA 3I0RA 2AGOA 3HHLC 3V4IB 2WBRA 1X5TA 4JI3F 3J7AN 3QRQA 2UU9F 1ICEB 4PAAA 4IUFA 2FVCA 1VQPS 2OPQB 4KY3A 1KLNA 2HVHA 3MM5A 3IM8A 1SIWB 3DGVA 5F8NA 4WKYA 1Q0NA 5FJ4A 3MM9B 4K5RA 4JV5J 2L9NA 1PJ6A 4LSLB 3W1YC 4KYZA 3BO2A 4CM0A 1O0PA 3H59A 1OJ4A 2VV5A 3VV2B 4WFXA 2FJBB 1IR0A 2FZCB 2F4VJ 5B0CA 2KYXA 1SJ4P 2NREA 4U9RA 3ZNJ1 4USMA 1PAEX 3T1HF 3QWUA 4NCAA 3PJ9A 5CZXA 5F8LA 1Z4UA 1CULA 4TY9A 5KT5A 4J9NA 2XMTA 3L4BC 4OYOA 5L9NA 2BQRA 3BV8A 3JB9k 5KAKA 1EKRA 4ZVEA 1U1RA 4ERDA 2AZ1A 4HR2A 2AJ1A 3DFEA 3CCUS 3D0GE 2YKMB 3DRYA 3R1HA 2HHVA 7FDRA 2YH1A 3M4XA 4F4KA 4ED1A 4DSKA 4NMLA 4IG3B 1RTHB 3J80Y 1QLNA 2VH7A 1XC9A 2AEFA 2X3GA 3I56S 1VIXA 3EVMA 4Y2AA 2HWHA 4WFYA 2ZJQQ 2M8HA 2YKNB 3MR5A 2HVDA 2MZTA 2XYHB 5GAHI 4F4ZA 1Q5YA 3NNCA 5E3CA 3DLBA 3FEXB 1YGYA 3N6LA 1U24A 1KQSR 4HKQA 3QIPA 2Z0GA 3O1LA 4JB8B 5EWFA 2H4YB 1LWCA 4ITSA 2RQKA 5K8NA 3EX7B 1T9UA 3C15B 2ZZMA 1RISA 3VGVA 3GU0A 3N28A 2HPUA 2MHNA 4JV0A 2KI2A 2VIHA 4NRTA 2EEYA 3H20A 3D54A 2OMLA 4CNYA 1NDKA 5IV3A 3OR2B 1Y5IB 2QMUB 2KU7A 4G1IA 1RTJB 3MZIA 4ZN1A 3PZPA 2FVPA 4JI1J 4RNOA 2ZBRA 3GLJA 4MIAA 5DG9A 2D3O1 3GILA 3D9BA 1RGVA 2UUAF 4LRDA 4C0OC 4TLQA 1NEEA 2FJAB 4J5OA 1RBAA 1U26A 4ZK7M 3H25A 4Q8EA 4GKJF 2ZH8A 1VGYA 2FB0A 2AQ4A 1URNA 4F25A 5ITHA 1NDCA 4OI4A 3M9OB 2GHWA 2KHDA 3I4HX 4J90A 1AA1B 1YZ6A 1R6YA 3NOGA 5CYQA 3M2UB 2D74B 3MWBA 1U0HA 2QL5B 5D15A 4A48A 1HW8A 5RUBA 2H5IB 4TKTA 2CJXB 4V19J 1H73A 3VAHA 4K0KF 3RBXA 2NQPA 2L08A 2KFNA 1F9FA 5E33A 2IVFB 2QL9B 4HDGA 1TK0A 2PIIA 3MPUB 2I2YA 1OS5A 3VF0B 4B3TJ 2MTLA 2FHOB 2G13A 2YKNA 1M1HA 5IT4A 4LFCF 1C1BB 2V8HA 1YJNS 5L39A 4M5LA 2CNKB 4OZ3A 2HAFA 3BZQA 3BH7B 1NAQA 5K14A 1RYSA 3CB4A 3E01A 4RW7B 1SXLA 4QOTA 4NMXA 2J5AA 3MMCB 4FNHA 1HWUA 3THTA 2ZJPQ 2M8DB 2DVIA 2CPHA 4B3MF 4Q0BA 4U8VA 1MN7A 1RE1B 4ZPTR 4ZLLA 5GAGI 3C46A 1MG7A 3BSNA 4LFCJ 2BANA 5B09A 2W9CB 2CPEA 2NPIA 4LIWA 2BJ7A 1HMVA 1TAQA 2FZGB 2A1BA 2HIQA 3TEGA 3ILIA 2XG8A 2GIRA 9ATCB 4ZP7A 3MR2A 1SV5A 2C3OA 3DI6B 3ENAA 4NZ0A 3VVTA 3BQ2A 3DKDA 2P9EA 3BR8A 4ZIWA 4XPEA 4Y3CA 4XK8C 2IVMA 4TY8A 4HT7A 4Q7AA 3D6MB 3EGZA 2KT2A 2B9YA 3POTB 2N3OA 2W4DA 4LT6A 2OTLS 2B6AA 8ATCB 3EPGA 1WHXA 5IXUA 4KHRA 2XLKA 1BUXA 4DL6A 1RLCL 2V5HG 1YJTA 4CI0B 4DSEA 2UUAJ 4ZPAA 4YHHF 1FHTA 2DPJA 4X65J 2Y0SD 1ZS6A 2ZH7A 2MZ1A 1H6KX 4PR6A 1S1XA 1S1UB 1UJ5A 1BQMB 2HEKA 3I0RB 3U1LA 5C42A 5CABA 4K7QA 2IRXA 5K8MA 4LMZA 1P27B 4JYAJ 4BCAA 5HATA 2YX4A 2FJXA 4K2JA 2M0GB 2GAHC 1IJEB 3QIPB 2DISA 2GJFA 2XBPA 2JJ4D 5CA5A 3LGHA 4ECSA 2RKIB 2DNKA 1VQ7S 4WU2A 1HNZJ 3L95X 3MM8B 3N4WA 2UP1A 2VOPA 3NAIA 4OZJA 3UPFA 2Z57B 5M2RA 2MYFA 1OYDA 4QIWD 3NRBA 3W2WA 2G1HA 3FC9A 4LQ3A 5CZVA 1Y5LB 4NI2B 2IDLA 4CQ1A 2XMAA 2HGLA 3IMQJ 3W5XA 4DN0A 4I69A 4ZCIA 3CCQS 3DLGA 1W7WA 2Z56B 3BSOA 4O3QA 3CUNA 1DHMA 1FVQA 1B4SA 2C3MA 2DNOA 3GSDA 3Q89A 4CLZA 1U1QA 2J9CA 4ZJQA 1Q7LB 4GKKJ 2BABA 5J2MB 3W61A 1X5SA 4M5JA 4FF1A 1S77D 1UJ4A 1EHWA 2V0NA 4M5MA 2Q6BA 4RUBA 3UD5A 4W92B 1RAEB 2DNPA 3IXQA 4L76A 3P6YC 1VQ8S 1E6YA 2AEJA 2L3MA 5LSLA 2IM1A 2VA2A 4LF8J 4FF3A 1WNEA 4FVMA 2QMWA 4AUKA 2R7SA 1X4GA 1BLUA 1CEZA 2IY5B 2CQPA 4USJC 1MW7A 1F6TA 4C3MA 2O5DA 5L8RC 1R0BG 1IKWB 4S0MA 4A8FA 2Q6CA 1N33J 2CQ1A 3NWRA 1XEZA 5AE1A 3T5HA 2X51A 5LMNF 1J2VA 1NUEA 2JLFA 3GMGA 1WC3A 3MD3A 4ZLPA 2R2RA 3GE9A 3CXCR 5E3AA
chains in the Genus database with same CATH topology
3TVKA 4R5PB 4OMFG 3M6WA 3TUJC 4E8UA 2VFRA 5I3UA 4ILLA 3ZZ0A 3Q2TC 2X1GA 4RW9B 5DDRC 1FT8A 3OQ2A 3GIIA 1B64A 1ZAWA 3DMJB 1UVKA 3HX9A 4RLEA 1VQKS 2ILZA 5A8WA 5KFUA 3RB0A 3TP2A 1U4BA 4Z37A 2B9XA 3K5LA 4K4SA 2QV6A 2VC0A 1TAUA 2LXUA 5IM0B 1VFJA 3T5KA 1U45A 3KK3A 3DM2A 4IRCA 2I0XA 3PJWA 1YSJA 4IRKA 2XY6A 3LH2S 2XWXA 3JTOA 3TVZA 2R7QA 3LQVA 1X7VA 3I0SB 3BM7A 5GVQA 4UQTA 2FHKA 4Q2LA 2ZE2B 2LECA 2IA6A 4G3IA 1V9OA 2GNKA 1M90T 2LQ9A 2OTJS 2OPSA 2YX1A 3DXBA 4WF9Q 4BBYA 2B43A 2HHWA 1OIAA 5J1NA 2IYGA 4Y2KA 4BWMA 3WBZA 5SZTA 5DM6Q 3KLEA 1UEUA 2VOOA 1QAJA 3KK1B 2UXBF 3MM6A 2VBXA 3C2PA 3BDPA 2RVJA 3GV5B 3K5MA 1DTTB 1Z1ZA 5D4NA 1SKSA 3DLJA 2OPPB 4NLRA 2J6SA 2QSWA 3OTEA 1HHTP 1DZ5A 1UA0A 2YNGB 2ZDOA 1UFLA 1BD6A 1NHVA 4HLBA 2DR5A 5DDOC 2BBEA 3BS9A 4MKAA 1IKXB 4WIIA 3P96A 1N0VC 4MYTA 3KJVA 2XS5A 1ZTTA 2HWIA 2KM8B 2HWTA 2CQCA 3M8RA 3LP1B 2QMXA 3CVKA 4C8LA 1WWHA 4NLUA 2PA3A 3PW4A 2HMIA 2I9SA 1TVRA 1Y00A 2LMIA 1G3OA 5CD4H 1NKBA 3GR1A 3FFIA 2I8EA 2G0CA 1QAXA 2WHOA 2AJFE 5F0WA 2XWYA 3FSXA 5GADI 2GMHA 1VBYA 1YG0A 2E7XA 1P1LA 1DURA 2BJEA 3EGNA 4B3SF 4WJBA 2VPWB 2I5JA 3RBEA 4M5DB 4OFZA 3HHEA 2B4UA 2PC6A 3MEGB 2EBGA 1B0VA 3PKMA 4RWXA 5J1EA 1KFSA 3MAHA 2CPFA 5THWA 3WX4A 4DLGA 4X2BA 3FZBA 3TUZC 5F3TA 2MQLA 3H4BA 3BGFA 3KTQA 1B0TA 1HBMA 1QUPA 4BDPA 2ZH4A 2LEBA 2KG1A 2PA8D 1JLAB 3K59A 2UVVA 3D5MA 4P7TA 3CJ5A 2D7SA 4CH7A 1D1UA 3RR7A 4NA3A 3CDBA 3H4DA 3NKYA 3JSYA 4CO5A 1HNZF 1IKYB 1FRXA 2K7KA 4PUOB 1X4HA 4ZP8A 1N52B 1OSCA 2ASYA 3EYZA 1RT2B 4I2QA 3M8SA 2X1AA 4AL7A 2P6SA 2A18A 1H7WA 4ECUA 1HNIA 4NLQA 5H1SV 1YVFA 1XERA 1IBKF 2WTFA 5KFGA 3M2UA 2HNYA 2CPZA 4TQSA 3E51A 1FRKA 1RT1A 5FDLB 3DLEA 1T05B 2DR7A 5E2QA 5DG8A 1M5VC 3MMAA 4DV4F 3KHHA 2OJ3A 3NP5A 4FF1A 5A8KB 1S1VB 3NBPA 4IOAQ 4IDKB 3I32A 3K58A 4WFNQ 1R31A 3RAQA 2VZ9A 1U6ZA 4Y2CA 4BWJA 3UQSA 4JYAF 1NB7A 3OR2A 2EFVA 4WFZA 1ZETA 4ECTA 3B8HA 2CRLA 5IM0A 1AUDA 2DD8S 2B5JA 2HW3A 4OZ5A 2FLPA 1RT6B 3HHDA 2B51A 3CIZA 4LVNP 2CJBA 4OI2A 1HQUA 5A8WB 3F73A 1Q79A 2R2TA 3CJKB 2W8KA 1WG4A 3G8QA 2QA4S 5IQQA 3MTJA 3CC2S 2KKHA 1KQFB 4OHYA 1D9DA 3QWPA 1QSLA 3OV7A 4MIWA 1C0TB 1QM9A 2VG6A 4NLVA 2DITA 5D4PA 1N48A 2XMKA 3CCSS 2U2FA 3RR8A 3W3SA 5AE3A 2UXDF 3DRRA 3NMAA 4IQMA 1LW2B 2VQEF 3UCZP 3UCUP 2XSFA 4HH0A 2CPJA 1U25A 1S6QB 5CH7B 1GTHA 2B56A 2FJEB 4Y6IA 5F9NA 4YB1P 4U67Q 2DO0A 2EK6A 1U1PA 4JI0F 3QGIA 1KTQA 1SH3A 4FNIA 3M8PB 2LLZA 4MMOA 3FZ2A 4ETZA 4ECVA 1YITS 2J7UA 4AFFA 4RW6B 2HLUA 2NSBA 2DH7A 3VAMA 1MROA 1OSDA 4ALZA 1R43A 4O44B 1M5OC 5KFWA 4ID5A 5HROA 4TN2A 1JX4A 2DIUA 3I9V9 4DS4A 1S97A 1LV5A 2WB4A 4J9OA 1WTFA 3FCHA 4TNOA 3KLGB 2P9GA 1D9FA 2DCLA 3CCMS 2BXJA 1X4EA 5B0AA 3CC7S 4DMZA 1H38A 1R8BA 4M1KA 4DG1A 2QLXA 3I87A 2W7OA 4USHA 2RMLA 1BQNB 1C1BA 3ZZOA 5KFCA 4YB6A 5U47A 2EI5A 3GG1A 2E29A 2EFNA 3AJ1A 2JFDA 3JSRA 3LP2B 1UWBA 4F2RA 4PWUA 4B3OA 5KFOA 5GMKa 3K5PA 3UI3A 1U1MA 4WFBQ 5C42B 1JJ4A 3IG1B 2F7VA 4FBTA 3CCLS 2ZFHA 4LF9F 1N5QA 2VC1A 4MTPA 3S01A 2CQ3A 3FJ2A 2XB2D 4X4PA 1FF2A 4OLOA 4Q43A 3GFHA 1K9MT 3HK2A 4Y00A 1JNZB 1HQEB 2E1AA 3J7YU 3SZ2A 4DQRA 3H5SA 3PXGa 1U1LA 2KTQA 2CQ2A 3K5OA 1MU2A 2B0GA 2QA1A 2C42A 3C66A 4H4OB 4TLRA 4DS5A 2CPYA 2IHR1 2V94A 3GFZA 1UVIA 5HLFA 1RA7A 3G6YA 2O66A 1N34F 1S99A 1D8ZA 4OL8A 3DRXA 2HS3A 2KXHA 3CULA 3BO3A 3M1VA 2JZ5A 1NK5A 1RYRA 5KFAA 2Y1JA 3IGVA 3SFGA 3QJPA 4X4UA 2OMOA 3E01B 1RTHA 4RW7A 3NGKA 3RU0A 1KNZA 5K14B 5KT4A 4YP3A 1X4FA 4DSJA 4JUZA 1S49A 2YKMA 1RK8A 2NUUG 4XDDA 4DR3F 2R9LA 4JV5F 2L48A 3T1YF 1MWYA 1WHYA 1B0PA 2AGQA 1FNOA 4O0IA 4DV5F 1FXRA 2YQ3A 1IN0A 3QGHA 3NMRA 1REVB 5CYQB 1VRUB 2Q43A 2KT3A 2JWNA 5IS2A 2AP6A 2AU0A 4KFBB 1NK6A 1T3OA 5KFEA 3W7BA 3NL0A 2GW8A 1T7PA 3HVWA 5DQGA 2QT7A 4LSLA 4OX6A 3V6HA 2HHQA 2CG4A 2RQCA 2FTRA 2JEIA 3QO9B 2KG0A 1HBUB 3DRRB 4PWDB 5KFKA 1R8HA 2V4QA 4OI0A 4ED7A 5M2PA 2Q66A 4MYUA 1A6LA 2N82B 3PR4A 2HS4A 4DPOA 4AQYF 1PC5A 5AXKA 2QFJA 2YNFA 2DNQA 1VK8A 3Q24A 2CYYA 2ZVSA 5J2PB 2CJAA 3FGVA 1TQLA 4PRFA 3DDKA 5KG1A 2RQMA 4B02A 5AXLA 3G4SS 4YDXA 2D3UA 4ECQA 4EYIB 3IN5A 1XMQF 1S6OA 3DCAA 4GO7X 5I3PA 4MK9A 4QIVA 3KLGA 1FDNA 1NH7A 2LU1A 4LUBA 3MPYA 2WB1D 3NCPA 1MROB 1RAJA 2KJVA 4Y0FA 5EX0A 2XMWA 1CG2A 2XCAA 4EZ6A 4EUVA 1KRPA 3DOKB 3LANA 1HWJA 4KFBA 3UR3C 3UW1A 5DQIA 1K1QA 3IR5B 4EEYA 4L72B 2LQBA 4O4RA 3PX0A 2E5JA 3SMZA 1KOHA 1SJRA 3MM9A 1JXLA 1HNVB 2BRKA 2OFGX 5HMXA 2BJDA 1FXLA 2IFXA 4DQSA 3PM9A 2OPQA 3UR0A 4DL4A 2UVWA 4DOZA 5DGBA 5CYJA 3OTDA 4PUOA 2BE2B 3LAKA 3A8EA 4Z2XA 3U1NA 5KFPA 2ZH5A 3V6DB 2AD9A 3JYTB 1IKVA 4PQUB 5FIIA 1NHUA 2SXLA 4HI1A 4U6PA 3KNAA 1HYSB 4ED0A 3KLHA 1VBZA 1VHFA 2Q3PA 4PPDA 1MU2B 2WW8A 1S6PB 1KEKA 2CQBA 2RQ4A 2C2DA 4K4VA 1HQEA 4CO4A 4I6WA 4A8WA 3T9NA 1CQMA 2HRYA 2D9OA 4YEAA 2W9BB 3N5BA 1FTRA 4L6V3 1SKRA 3TYTA 1S1VA 1HI1A 4QR1A 1U6FA 3RYLA 4C9DA 4E98A 4R8UB 3A1YG 1HNXF 3B78A 1KLMB 1U49A 1QAYA 1M0SA 1LFPA 1YJWS 3TOQA 4Y28C 2BOPA 4TU9A 2X1FA 4NWBA 1ZOTA 3QAEA 4QPXA 5D3GA 4E0DA 4RW8B 3PV8A 1DLOA 2VBYA 2KXNB 4RNFA 5AJ3F 2DT9A 2KM8C 3KHLA 1GXTA 2XGQA 4YB7A 3ISZA 2VPXB 2ASJA 2HAIA 2UUTA 3MCSA 1TKTB 3MEDA 4K50A 4DUZF 3J7ZT 2C2EA 4KE5A 2RS2A 1XNQF 3DNCA 4IO9Q 2GMJA 4I68A 1VQ5S 1SJ1A 2WONB 3NCQA 1WHVA 4GKKF 1OWXA 2BYCA 1XR5A 1H98A 3HMJG 1A7GE 4C7QA 2B4OA 3UE2A 4RW6A 4ES1A 4I6AA 3HHLD 3S8SA 2CZVC 4RX6A 3QAUA 2R8HA 3HDSA 1Y3KA 5I4MA 3V4MA 1JLGB 2A2CA 3U27A 4G1QB 3T5LA 3CJ2A 2YWFA 3LP0B 4ZDNA 3CTRA 1LFWA 2AYEA 1QE1A 3MDFA 4I4BA 1X5OA 2J0WA 2WSEC 3GWCA 4HH1A 1YRTA 2B3TB 3I96A 2RD5C 4RWWA 4CH1A 1H2UX 3I0SA 1BGXT 2M88A 3HM9A 4F4YA 2DGWA 3G6XA 4QIEA 3OVBA 3KK3B 2RH3A 3O2IA 1YQHA 2C3UA 2DTJA 1JLGA 1A9NB 4I64A 5D3GB 2EC0A 1Y0HA 4IH6A 4ZCKA 5JUMA 2W7PA 4AL6A 4JI5F 4YFUA 3V6KA 3KLHB 3GV8B 5HBMA 3PW0A 1OQ6A 1UFWA 1KOOA 2IAJB 5C25B 2N4DA 3CJ3A 4PG7A 2BA9A 1U7LA 3BR9A 1HQUB 2ZNZA 3G9CA 3AA9A 1RT6A 3CCZA 1FJCA 4R5PA 3S1TA 1IKXA 5JXSA 1N5TA 5EGYA 3AB4B 4ECYA 3D28A 1GX6A 4C3LA 3Q8QB 1VQMS 1YJVA 4WTYA 3MEDB 4U7CA 1WEYA 4CNZA 1T95A 3CJ4A 1S9EA 1JMTA 1HNVA 2ZNYA 2GO9A 3CT9A 4ID8A 4NLYA 5IWAF 3C46A 4ZHRB 3ZZZA 4QZVB 1KVJA 4IO1A 1U48A 2DR8A 1S0OA 3JSMB 2VBWA 3DLEB 1T05A 4QYZJ 1H7XA 3H98A 1TV6A 1SJFA 4FVCA 1CVJA 3TA1A 4UY8T 3MR6A 3JYTA 3NAHA 5A0YA 1N5YA 3FNNA 3OFGA 4OHZA 3U7JA 3MURP 1RT2A 2VPZB 3CCVS 1ZYQA 1VQ6S 5B0EA 5T41A 1U6BA 2Y1IA 2PGCA 3ONQA 3PEHA 4IR1A 5G0RB 4WZQA 3PX4A 1V3ZA 3CPWR 2RIJA 2IBOA 1R7IA 2XSJA 4ZP6A 2KH9A 4IOCQ 1S9FA 3GZ7A 5BYSA 5A6PA 2XO7A 2QSFA 1G1XA 3TO8A 2N7YA 2ROEA 2BV3A 2HHUA 5KG6A 3KWMA 2GGPA 2N4CA 4X4SA 4HTIA 5DQHA 3K57A 2XMMA 2V9KA 2DIVA 2D1CA 5A8RA 2RILA 4EBCA 4LQ9A 3V6DA 2YWKA 1FJ7A 4N56A 1FCAA 2QYCA 4EZ9A 2R4FA 4J9QA 1C1CA 1C4AA 2BE2A 2HFNA 4O23A 4D3GA 4YR3A 2NZ4A 2CJ9A 4DL7A 3ETOA 3SSRA 3OHBA 2D3ZA 4DSFA 1GXLA 1P8GA 1ZBTA 5DLFA 2GA7A 3DU5A 3OPKA 4KSEB 4K4ZA 4NLWA 1HBOA 2JL9A 3BN7A 2J9DA 3MXHP 3H2LA 3P3DA 1B7FA 2DJWA 5KT6A 1VQLS 4DV0F 4J9KA 1RT3B 2DHAA 5DDQC 2IM0A 2MSTA 2GV1A 1HMVB 1N33F 4QWBA 4EU0A 3MAQA 2KVIA 1MWZA 3OTCA 3RB4A 3H2VE 4IH5A 2HLTA 2OD4A 4ELVA 1RTDA 2RU3A 2WSCC 1FRMA 3MHYA 4MFBB 2XZWA 1HL6A 2PE8A 2HNDA 2LKZA 2HVIA 5EUHA 2LQJA 3R5BA 3MM8A 1BWEA 3U02A 2RJZA 2F8EX 2WK4A 1BY9A 4LFAF 5IT9Y 2MGZA 2CVIA 4ED5A 2L9WA 3IRXA 3OUYB 1UVNA 3HLUA 4X4VA 1DFDA 2KT5A 2ZBIA 2ZUGA 4QWDA 2JHEA 5E0OA 2IYIA 1S1UA 1XMOF 1UKUA 3M6XA 5KFJA 4FP9A 5DDPC 2W9AA 2DH9A 4C8KA 2YKQA 2VB6A 2R8KA 3TR5A 1S0VA 2OSRA 3TX8A 2DNNA 3IWLA 3MI7X 1RTJA 3R5CA 4LF6F 2M2BA 3O44A 4ED3A 4DL2A 4TY8B 5HP1A 1M1KT 4B9SA 3US5A 1DQ9A 2DHXA 3D1HA 4IFVA 1M5KC 2V9WA 4RBUA 2E9ZA 4ES3A 4OLPA 3MFIA 2PDAA 1V3SA 5HLFB 3GG0A 4RNHA 2YWHA 2CZ4A 1TKZA 4A8MP 3TARA 2KRRA 2JH3A 2QLWA 4CT8A 1H2VZ 1KQKA 5AXNA 4O4GB 5LJ5Y 2C22A 2DH8A 1NKEA 4F8RA 4ZPDA 4BC7A 3GIMA 2E44A 5D4LA 3O3LA 4H4KC 5T14A