1FXKB

Crystal structure of archaeal prefoldin (gimc).
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
109
structure length
109
Chain Sequence
NVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQEAMKGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the molecular chaperone prefoldin: unique interaction of multiple coiled coil tentacles with unfolded proteins.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Chaperone
molecule keywords PREFOLDIN
total genus 38
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2000-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fxkB00
2ZDIA 2ZQMA 1FXKA 1FXKB 2ZDIC 3AEIA 1FXKC
chains in the Genus database with same CATH superfamily
3ZEDA 3LDEA 3VQWA 4FJCC 2YDEA 5L3EA 1G1XB 3ZMUA 3J7AU 3AK1A 2QM4A 4PDMA 4PA7A 4I55B 3SYQA 5IYBO 1MNGA 1D5AA 1F51A 1HWYA 2HR3A 5B5EZ 3K5LA 3CCUV 2BTQA 4DW0A 2LGWA 1Q82W 1M90W 3CXCU 2DE0X 4DV4O 5GTHZ 2E74B 2NLJC 4I0XA 1GH6A 2XTAA 2QGNA 2P7TC 4LFAO 5LL6Y 1SQGA 2GDSA 3JSNA 3OTFA 4R8CA 5KAFZ 4LFAB 3NR7A 1R3IC 5FNVB 3CRAA 4LP8A 4ZHQB 5ITZA 4BWAA 5IWAB 3CD6V 1XI1A 2BE3A 5LP6A 2KG7A 2BCCH 3APOA 2Q67A 1AR5A 1WLEA 3L73H 1SQXH 5C8YA 5C93A 1M57C 1ZL8A 3BY6A 5IYCO 5CBFA 4O2BA 5LMNO 3KCXA 4ZI7A 2ZR3A 2P22C 4K8ZA 4K0KO 2HJFC 2QTOA 3QO5A 4DR5O 1F4MA 2UXXA 1PL4A 1KD1W 1OZ0A 2YXHA 5BMVA 4PDLA 2ZE6A 3JAKA 1UPGA 5KHKA 1G8MA 2Q73A 1QR8A 3H1JH 3SYPA 1YHQV 1JOYA 3ZMVA 2JRIA 5DEDA 2RQ6A 3OGCC 2UXBB 5BXZA 1N34B 2Y69C 4U3FH 3ZIAG 1QLEC 1K7DA 3I55V 1YI2V 4KHPO 4LF4B 2XAFA 1FKAO 3A0BZ 4O2AA 1VQKV 2IJHA 1X59A 4JYYA 2N04A 3N2KA 3FB5C 1I08A 1QLNA 3ABUA 4YJ3A 3K58A 3K9SA 2QA4V 2JGDB 2DW4A 5LXTB 3CCVV 1KB9F 3FYEB 3OEHG 3ABTA 1Q90D 2PZSA 1B3QA 2E3CA 1Q5OA 2AW9A 1JVMA 2RN9A 5LHIA 3CCQV 3EHBB 1BSMA 4LNUB 1XHXA 3RYCB 2PYLA 1XNQB 3RVYA 4JI3O 3AG3B 1IBKB 4LFCO 3QF7A 3ZS8C 2Q0OC 4HBNA 1GRJA 4F6EA 2CDYA 1BZKA 2XUMA 5JCOC 1QBZA 3P3PA 1J5EB 1NS1A 2OCCC 3NXSA 1N32O 3JARA 4LF4O 2HKOA 4FFKA 1RPOA 3ZRVA 3A0HZ 1JMKC 3BEHA 5A2QN 3STLC 4OPAA 5J2UA 4GCZA 4PA9A 2X6AA 3CC4V 1AJPA 4NXMB 5GTIZ 3HKBB 2V7QG 2A06H 3R66A 4JI0B 2FMLA 2ZINA 4JYBA 2EZPA 3PJSK 1XL6A 2B5UA 1NBMG 3L74H 4X64O 1VQ7V 3OW2U 3JAKB 3GVMA 4QPJA 1R3LC 3BPZA 2JJ1G 4NVPA 1MG1A 1TUBB 1N8RW 4JI5O 4B08A 3M8AA 1WPXA 4JI2B 1E79G 3GWOA 2ZR2A 1R3JC 5F2VO 4X1KB 4PI2A 1VF6A 3HKBA 4O2AB 3LDDA 3RN4A 1SA0A 2QKCA 4AHCA 1R73A 4FLXA 1JR9A 4RO2A 2FKXA 1OCRC 1TVKA 1PPJH 3ASNC 3B8MA 1TGOA 1NVPB 3BAAA 2H8PC 1FXKB 3L75H 2W0XA 4BR6A 4DUZB 4YIOA 3K0GA 1S5HC 2CTRA 1A32A 4DV3O 4DR1B 1W59A 1O9GA 1BQ0A 1N33B 4LF6B 5CA0B 4KFMA 1VQPV 3SGIA 3VQYA 1SA0B 2Q69A 3OEEG 4DV1O 2R72A 2RNBA 1SETA 3SPCA 4ZIBA 3C3SA 2YS8A 1N33O 2Q7HA 1L0LH 4LF9B 2L6LA 4LWSA 5CN0A 1LR1A 1VQ4V 2Q7GA 1RFYA 4JI2O 1THZA 4B3MO 4O4IB 2LP7A 1PKXA 3J81N 1BE3H 5FL7G 5J9PC 4EFBA 3D36C 4X1YB 4WBNB 1JJOA 1VARA 2YXLA 3RFRA 1MSWD 3WFVA 3SYOA 4QPKA 1N32B 4XBFA 5IJ9B 4OXSA 4DR7B 1H2MA 3OMNB 1SQPH 1Q7YW 5B1AC 2F23A 3T1YO 2UUAB 4B3RO 3N2GB 3DXRB 2DN9A 3ETEA 3APQA 4TWKA 2QWQB 4GX2A 2OCCB 2ZE5A 4HNAB 3CCSV 1FJGB 1WB8A 4JTAB 1XUQA 4G28B 3CJHB 3G80A 3G4SV 2EIMB 4FK5C 4GYCB 1S76D 3RYFB 3X2QC 1K97A 4KHPB 5HFLA 4EFEA 3FB7C 1NTZH 4FLVA 3QO7A 4EB6A 1GAXA 1N4CA 3S3XA 5K1XA 1XDCA 1YJWV 3SPJA 2UU9O 4BIUA 1PNMA 3T1HO 4O4HB 1XMOB 1OCZC 2GHYA 2ZIMA 4MTGA 2BSKA 4FLUA 1SS3A 4JAAA 4HNAA 4JI7B 1H2KA 4AILC 1GKFA 3L71H 3OM3B 4YJ2B 1VQ8V 2WWWA 2Y48A 3UQ8A 1N0NA 3BCCH 3HR0A 3JARB 2CUGA 4GKJO 2EJRA 4NR1A 4TV8B 3W7UA 4U3JB 3BVOA 4DV2B 4IHJB 1MABG 3JAWA 4JPRA 5IYZB 2VQFO 4JI3B 3AG2B 4B3RB 2WLJA 2K1EA 2Y69B 1FS0G 3M7MX 3RW0A 5KHJA 2VS0A 4B3TB 4I9QA 3K08A 2ZD9A 1WA8B 3C3TA 3GWKC 1SF9A 2QWRB 1H8EG 1Y6XA 4FLWA 2ATKC 5IY5B 1NR7A 5JQGA 1RPRA 1HNWO 1EZJA 1FAFA 2YI9A 1R3KC 3E86A 4DV7O 1G6UA 2JS5A 1GK9A 1HNZB 4X65O 1EM1A 2W0FC 4LF9O 1YTFD 2A79B 3CRMA 2EINC 3P32A 1H2SB 4LF7B 2VQEB 3HKEA 2YI8A 4O4JB 2F93B 1Y74A 1XBLA 5DECA 2P5OA 1H2NA 3AG4C 2ITCC 3ZHQA 1VIBA 1P7GA 3ZBHA 2Z5UA 3QO8A 3ETDA 1KYOF 5CMUA 3W7WA 4NXMO 4QE7A 2ZE8A 3B8NA 3WB0A 3RYFA 1S0VA 4FVMA 3CC7V 3DC6A 1K4CC 2WLLB 2F43G 4GUNA 2HJDA 1U97A 4MVZA 3T1YB 2M7WA 4JTCB 1FFXA 4R6ZA 2CAZC 4G27B 1F4NA 2HHHB 1US6A 2XASA 2OT5A 1XILA 1R6TA 1YF2A 1OCCB 2DYSB 1WPBA 1EZVH 4K3AA 1IZ3A 2HP8A 4GX1A 3KZIZ 1ZTEA 4TT3G 4BIOA 1QU7A 2GSMB 1F23A 1BGYH 5DN6G 4MW3A 3EVKA 1SRYA 4FIPC 4CBCA 3OUSA 2Q4PA 5EC1C 5JVDA 2QR4A 2QKAA 2ZXWB 4RAIA 3R65A 1M4UA 4IL6Z 4B7EA 4UCUA 2XT9A 4X62O 2EBOA 1UJWB 4DR1O 5EBLC 2QJ1A 5B3SB 3SYAA 1ZAUA 1SZXA 2IU3A 5LA6B 4YY3O 4KUMA 1BL8A 4JV5O 5LYJA 1P49A 3H1IH 2PY5A 2UXCB 3ABMB 3LSUA 4JI4O 3WU2Z 3K0DA 2EILC 4X1IB 4GT1A 1DLBA 1P84F 4JI7O 3D3QA 1DF5A 2UXDO 5L3BA 3LNNA 1VP7A 4LC1A 3F7YC 3N27A 5LOVB 2JGUA 2GBOA 1BHAA 4MVQA 1AR4A 2GTAA 3ASOC 3ICXA 4YHHO 5KHHA 1TUBA 2WLIB 5JCOA 1K34A 4NYKA 2Q0AA 4P30A 1XNRB 4B3SO 3JASA 4DR6B 1VF7A 4LF5O 4CH5A 1XNQO 4ZOLB 4MTXA 4PV1B 2H3OA 1Q81W 4CC6A 4HYOA 4C7UA 1GTOA 1PNLA 2X7RB 1VQ5V 4I9WA 2R70A 4PI0A 4B7KA 1Y67A 3CCJV 4WFGA 3G6BA 5L3FA 4JV5B 4R50A 4N21A 4CH3A 2ADPA 3CS5A 3SPHA 3JD0A 3FAVA 2CTWA 1VF5B 1FXKA 4TV9A 5CBHA 1Q6HA 2OTLV 4JAUA 1SESA 4DV4B 2JGDA 3W7TA 3QTCA 4PDRA 1NH2B 4J41A 1P7BA 5LXTA 3Q4HA 3ZCCA 2WLHA 1YJ9V 3JALB 3RYIB 3K79A 2JDIG 4J7JA 4YJ3B 2R9IA 5EZYB 4DR3B 4CS4A 3AK3A 1R1BA 4E4EA 1KP2A 1V54B 5GONB 2YIBA 2F4VB 1Y74B 3ETGA 1N36B 1TAEA 4DV5B 3JATA 1VQNV 1Q43A 2DYSC 3CCLV 4FZ1A 3B2EE 1K5QA 2ZM6B 4JZ2A 3ZHVA 1SQVH 2OIGA 2PTMA 3JAWB 2IBZH 4MTOA 4P9OA 1IDSA 2EIJB 1NQTA 4FM2A 3HPLC 2E76B 4X1YA 1RM1C 1DGSA 2NNUA 4RWUA 5KLVH 3JAMN 4YY3B 2Z3YA 3CYOA 3DXRA 3OR6C 5J2TB 1S5JA 4UUJC 4UVAA 2ZXWC 4UCVA 4AQYB 2BOCC 3N2GA 1SQFA 1N34O 1DK1A 1CEZA 1B06A 3RYHA 5IT9N 5B3SC 1BHBA 3ZHUA 4P9PA 5LHGA 5KAIZ 5KHIA 2OCHA 1FXVA 4OX9B 5CB4A 4O4HA 1HR0O 4UCTA 3ABLC 2X6BA 3JSLA 5JVDB 4DUYO 4UV9A 3MHHC 2KSDA 2E5LB 1M57B 2HFEC 4QIWF 1H8HG 4H37A 2Q7EA 3H1KH 4IHJA 4PELA 2NN4A 2JIZG 2P4VA 2X6CA 3CMAV 1M5IA 1PP9H 4UVBA 4UCSA 3K3WA 3FD9A 3FX7A 4DUYB 4U3JA 3CE2A 3ZJZA 2ZKOA 2A9HA 1AI6A 2FL4A 2ZNIA 4TQDA 1K9MW 1BS3A 4IYHA 3U0ZA 1PM9A 2XOKG 2ADQB 5L3CA 4GZRB 3TXQA 4NXNB 4B3TO 1Q6UA 1G4YB 1RSOA 1GO3F 5BMVB 5AG2A 2EZOA 1YVWA 4TUYB 2V4DA 2EIKB 1KBHA 1L0NH 2P90A 2DOSA 1WA8A 2DJVA 4H13B 1VF6C 2DQ0A 4NXNO 2JS3A 4U7NA 1Z2GA 4WCEV 2ZT9B 1OCCC 3FB8C 4ICGA 5CA0A 5IJ0B 4PA4A 4E2LA 1IURA 1EFRG 4WFEA 5CA1B 3LSSA 3K5OA 5KHGA 2UUBB 3A8TA 4LWSB 4PDVA 5D5PA 2WLKA 4D6TH 2IH3C 1VQLV 3F7VC 4J10A 2ZIOA 3OT7A 3HKDB 4I4TA 1O9HA 2XAGA 5IJ9A 2P6JA 5JH7A 4NKGB 1XREA 4H44B 3FB6C 5JJNB 1V55C 5B1NA 2Q68A 4I55A 4JGSA 5B1BC 3CHXA 1AP5A 4IIJB 3K04A 4PHZA 2M6YA 5JWPA 1S72V 1K4DC 3UCSC 4GKJB 1P4RA 4A5UB 3OR7C 1OV9A 4FZ0A 3AG2C 1Y4MA 3GB7C 4B3SB 3TGUH 3RBZA 2W6IG 2GTSA 4MVUA 3ZRSA 2HEPA 1WN7A 4JYAB 3SR2C 1JPXA 2UXBO 4JI6O 2WA3A 2E75B 3LUTB 3CRCA 3E8GA 5LP6B 5KMGA 1V9PA 5H6RA 2ZM6O 3HKCA 3D36A 2UUCO 3MHSC 1HW7A 4ZHQA 2B1IA 4MVOA 1WNSA 2OIEA 4DR2B 1BMFG 4X1KA 2LGQA 4GX0A 2PI5A 4ZI7B 4WFHA 5EK0A 3IC9A 2ODMA 2WPDG 1D2DA 5LGNA 1ZL8B 4I50B 4F6RB 4NTYA 4K35A 2PUSA 1QCEA 4ASUG 2RMKB 2QSAA 1TUEB 2R9RB 5H2FZ 5LMUB 4JYCA 5LGUA 1WAZA 4DR7O 4NTXA 2QM8A 4ZBMA 2LW1A 3RYIA 3E22A 2XNDG 3HKCB 1XOUA 2YUAA 4J11A 3FFQA 1E1RG 4JI4B 5B66Z 1JJ2U 3JD1A 3SJCC 3G71V 3STZC 2N74A 1R6NA 1AILA 5LOVA 1IX9A 1KMIZ 2Y0PA 4KXRA 3S3WA 3CEIA 4CH6A 4RQEA 3K5MA 2Y4UA 3CXHF 2YC0A 2ZQMA 4I50A 4UCOA 4F6RA 5FPRA 5JQGB 4UFZA 2PF4E 3ASOB 2AZ0A 2XAHA 3OTOB 1XMQO 2Q8VA 1PV0A 4DW1A 3JASB 2IJIA 1YDXA 4J9YB 2XAJA 3LDCA 1KKCA 4NTWA 1WJZA 2O57A 1FPOA 3E89A 4JI0O 1TA8A 4GX5A 3N2KB 4LR3A 4WFBV 4L8JA 1Y76B 3DC5A 3G6EV 3OMIB 1XNRO 2CGOA 1K33A 1URFA 3AG4B 3O9OA 2QKSA 1V55B 3U10A 3T4ZA 2A3QA 5LMNB 3BRCA 4TSFG 3UO2A 1YXBA 4MS2A 1H2LA 4BW5A 3SPIA 2X0LA 4DK1A 3D3IA 1E1QG 3CJHA 4IYIA 3CSXA 5GW7A 1YZBA 4W4LA 3T4DA 3BFRA 1FXKC 4FFBA 4WFAV 2LW7A 2VQEO 3OFNG 1QR9A 4NB5A 2RJZA 3OD4A 1IXBA 1AI7A 3JCUZ 3CB2A 2IJKA 2IU0A 5H6QA 4R7CA 4MW8A 1NVPD 5EBWC 4DV5O 2UUCB 3B77A 4MVRA 3I5DA 1MZFA 2F66C 4H0LB 1AVMA 4I7ZB 2QWPB 2MK3A 2C2AA 1OHHG 2ILMA 4UXNA 5JJJB 3UT5B 3JD2A 2EJ7A 4EB6B 5J2TA 1OCZB 1CP9A 5FNVA 2P06A 4IIJA 2CTQA 5ITZB 5KA6A 5HFMA 3KKYA 3ZMZA 1F7YA 5LA6A 2KG7B 4CS3A 1ZSPA 1QVFU 3ZN0A 3CC2V 4YIPA 4RQFA 5IJ0A 4J9ZB 4GKKB 4UB8Z 1IXMA 1GN3A 1VQ6V 2FB5A 3RYHB 2ZDIC 4WF9V 4X66O 2P67A 2JJ2G 2G38A 3JD4A 3AG3C 2DYRC 4X66B 3T1HB 5FLXN 5EBMC 1AP6A 2JEUA 5IY5C 5BR8B 3VOUA 4JI6B 2L35A 1J95A 2F4VO 5KA5A 4IT5A 4O4LA 1MZEA 3RWRD 1PD3A 2F1MA 5JJEB 2WLIA 4PD4F 1AI4A 1HP8A 3E8HA 3JCZA 3HKEB 4DR6O 1RSOB 3THOA 1UFIA 5A9GA 4QNHB 1ENVA 3ZRWB 3WB1A 2YEVB 1NR1A 4UCRA 4LF6O 1XQ8A 2GUZB 2UUAO 3P3NA 5EYPA 5B1OA 1SZTA 3B09A 2LFRA 2LQTA 4X9QA 2KKWA 3K03A 4LCUC 1B04A 1OCOC 2ITDC 4Z1MG 1S77D 3SJAC 1M9NA 4X62B 4Q6GA 1IBMO 3EXAA 1VMGA 4YXWG 1PNKA 4GLXA 3SPGA 4FM1A 3FAVB 5GONA 3ZRXA 4DV2O 5IE9A 4TQFA 2CH7A 4MSWC 3BHPA 1N0JA 2QTSA 4X8AA 5H9CA 2HHHO 4LBEC 3AEIA 3SJBC 3HKDA 1KKDA 4OPHA 5EZYA 4DR4O 1Y76A 3B4SA 4LFBB 1W2BU 2K9PA 4K8XA 2E5LO 3WB2A 2ZE7A 5J2UB 2N05A 4D7SA 1XMQB 3H1LH 4J80A 2XHBA 4X20B 4DR5B 4EEQA 4MVSA 1NI8A 1QVGU 1IBLB 5JH7B 2EINB 4J42A 3ABLB 1ZX3A 3IJ4A 5EIBC 1ZUQA 2DWEC 2IJJA 3H01A 3DSQA 4UV8A 2ARHA 4CC5A 1HNXO 2QE7G 1Q6IA 4HZ3A 2CK3G 4I5SA 2Y0IA 4DRXA 5IYZA 1XMOO 4LF7O 1BQZA 2UU9B 4DV3B 3QG5A 3QVNA 1JCHA 4X1IA 2ETNA 1GN4A 2GV9A 4UVCA 3FYIB 1H38A 3AG1C 2AHZA 1LUVA 1Z5VA 3K06A 1AR1B 3ZMTA 3LSQA 4XDLA 1M56B 5BZBA 5CA3A 4LF8B 1QLEB 4CS2A 1Q86W 3E8BA 1YSCA 4OX9O 5L3DA 1MOFA 3E83A 2YEVA 4FLYA 3UM7A 2UXDB 1M1KW 2DYRB 4X65B 2WA4A 2IW5A 4DV7B 5CB4B 1OCRB 1K5SA 1FD9A 2WLMA 1VQ9V 2H94A 2VQFB 3PN1A 1TVKB 4JYAO 3A2FA 1KUQA 1KU9A 1W0KG 1JFFB 4JI1O 5KX5A 1FFTB 1Q3EA 1AI5A 4W4KA 3E22B 3WG7C 5FPOA 2RDCA 2JK5C 4J7KA 1LUWA 2EX3A 4MTFA 1VQMV 1J5EO 3OUFA 3IAYA 1YIJV 2PYJA 2Q9LA 2WSSG 5EC2C 4DV6O 3E35A 4FMTA 4XDJA 4X89A 3G67A 3L9DA 2B9ZA 5BY1A 1H2GA 3K9AA 3AK2A 3CP1A 4Q20A 4DV0O 1MA1A 4AQYO 2V1DA 3TK1A 1JFFA 5K1PA 2YIBD 1L1FA 3ABMC 3CRQA 1I94B 3K5NA 1SC5B 3SDLA 2IM9A 4TV9B 3UKMA 1NTKH 1FJGO 2YXYA 4DUZO 2EIKC 3CWBH 4LFCB 4HAMA 3BA9A 1KC8W 3O65A 1RP3B 2YIAA 4Z1VA 4JI5B 4I4TB 2QWOB 4DR2O 1XEQA 4X88A 1NKDA 1NU1H 4QGPA 1GMGA 1SQQH 4D7TA 4EKWA 3I56V 4I0XB 2BTQB 1HDJA 1K92A 1I7FA 1WB7A 5TISZ 3DGEA 1M93A 4FPPA 4JF3A 2WAMA 2EIJC 2EIMC 4FLZA 4Z2WA 2IH1C 4JZGA 1FXHA 1ZLZA 3SYCA 2ZDIA 3T2MA 2QWNB 1YCIA 3WG7B 3RVZA 3ABKC 2EULA 2XAQA 1DTOA 2DQ3A 4AI8A 2CH7B 3ZMSA 4OGQB 4G2KA 3IC7A 1I0HA 3LNMB 1I5XA 3CCMV 1NT2B 3VQXA 3VQVA 4FFBB 3ZHSA 4O2BB 4JI1B 4TV8A 4DV1B 1SERA 1KP3A 5B1BB 2HLDG 3CRRA 4BIZA 3H1HH 3OMAB 2LO1A 4YHHB 1AB3A 5LMUO 2B1GA 5D5QA 2P4KA 2ZCEA 5LBQA 2WLNA 4F4LA 5KMGB 5E1AC 1M56C 3P30A 1NH2D 3E8FA 1KQSU 3DTUB 3UT5A 1D5NA 4DV0B 2CGNA 3CCEV 4L87A 4DR3O 2HVKC 3JYCA 2YSUB 2UUBO 4FLTA 4PA6A 2W6JG 4N23A 3VBBA 5L3GA 5IYDO 2A7WA 4ZOLA 4RUEA 1RM1B 1COWG 2UXNA 2KQXA 5IDJA 1MSDA 1HNXB 2AGAA 3OTOO 3TXSA 4BW9A 4DYLA 5CBGA 4U7OA 2MW2B 4B3MB 4TUYA 1EN6A 1BCCH 3CCRV 4QE9A 3SJQC 4FM0A 1WP8A 2FYUH 2LFSA 3ZHTA 3KG2A 3QNEA 1S5LZ 3OGIB 5LGTA 3MD0A 1R6KA 5EIBD 2DMXA 3J80N 3ASNB 4O4LB 4O4IA 1AJNA 1HR0B 3ZHRA 3OAAG 4WBNA 1N36O 4H33A 1VQOV 1NZ6A 2PGGA 4ZKIA 5CA1A 1AROP 3X2QB 3CMEV 1FFXB 4DXWA 1QHTA 1B6QA 3ZRWA 1ORQC 1CXZB 3TETA 3K59A 1SKVA 1QQCA 1HNWB 2AHYA 2OTJV 1NTMH 4IGGA 2JEXA 1IBMB 4JAVA 1L8DA 5IWAO 4JTDB 1X4TA 1WP7A 1NJIW 2OWOA 5DM6V 1SQBH 4RUFA 1GN2A 3AG7A 4KP4A 3MDSA 1JA8A 3W7XA 1VEWA 4UB6Z 4P2ZA 5KUMA 1IBKO 3FKSG 1YEWA 3OE7G 4CZZA 1W0JG 3ETQA 1Q8IA 1K8AW 2BSKB 2QM7A 3UO3A 3K57A 3F5TA 4WFFA 5B1AB 4YJ2A 4ABMA 3F5WC 4CH4A 3KCYA 2Q5ZA 4X64B 4PJ0Z 1YITV 1I94O 4GKKO 2YIDA 1AJQA 5C8YB 3BA8A 3ZN1A 1MMMA 3CX5F 4LH6A 1FYJA 5KX5B 2HG5C 4X20A 1GM8A 1PL0A 1JQ0A 1GM7A 1IBLO 5LP6C 2D3OW 4DV6B 1KECA 2VRZA 1IVSA 3IFXA 2KB1A 2EILB 3ZX6A 4BAYA 1GM9A 4DRXB 5LYJB 4MVMA 3T1CA 4JI8B 4JASA 2RCVA 1JX9A 5E79Z 3D8CA 2YICA 4DR4B 1LNQA 1V54C 4LF5B 2QDOA 1EN4A 3H9VA 4TOIA 3U11A 3HB3B 2UXCO 4QJFB 2QEXV 1Y66A 4XDKA 5H5NA 1K73W 2VWJA 2HVJC 1S3JA 1OJHA 2BOBC 2BTOA 3CPWU 1QNMA 1ZWIC 1BT8A 1YTFB 4J7ZA 4PA3A 2JVDA 2PI4A 3AG1B 3RGBA 2Y4TA 2VWKA 1DF4A 1K3EA 2Q6AA 1YJNV 4LF8O 1U96A 1OCOB 4MT8A 1Z5WA 4K0KB 2LJ2A 2AXTZ 2A0LA 2Z0AA 4O4JA 3EFFK 5LHHA 3W7SA 5BR8O 1XL4A 3M99B 3RYCA 1GN6A 1I5YA 4DO2A 4DK0A 3RT3C 3A0RA 3B40A 1HNZO 3TJTA 1ROPA 3C90A 4LNUA 3MAQA 3E2EA 2WLLA 2NR5A 1CPYA 3Q4HB 2GUZA 3JALA 3TCUA 3BABA 4LFBO 3ML0A 1EN5A 2D2CB 2R9AA 1EBOA 3IGAC 1T5EA 2CTPA 2AZ2A 4KL1A 2CE4A 3L72H 3ABKB 1XHZA 2FTKA 3JATB 3JD3A 5EYPB 4LH7A 4JI8O 5KUKA 2ZNJA 2F95B 3L70H 2DWDC 2OYQA
chains in the Genus database with same CATH topology
1M1KW 2DYRB 1V55C 2IW5A 3LDEA 5B1NA 1H8EG 1OCRB 4FJCC 2Q68A 5L3EA 2ATKC 5IY5B 1NR7A 4JGSA 1K5SA 3ZMUA 5B1BC 1RPRA 2WLMA 1VQ9V 4PDMA 4PA7A 2H94A 3SYQA 1EZJA 5IYBO 3K04A 1R3KC 1W0KG 1F51A 1HWYA 3E86A 1S72V 2HR3A 1GK9A 1FFTB 1K4DC 1AI5A 3CCUV 2W0FC 3WG7C 1YTFD 1P4RA 2JK5C 1Q82W 2A79B 3OR7C 1M90W 3CXCU 2EINC 3AG2C 3P32A 1Y4MA 3GB7C 4MTFA 3RBZA 1VQMV 2W6IG 3OUFA 2NLJC 4MVUA 1YIJV 3AG4C 2WSSG 3ZRSA 5EC2C 2ITCC 2P7TC 3E35A 1JPXA 4FMTA 4XDJA 4X89A 2Z5UA 4R8CA 1H2GA 3QO8A 3K9AA 3CP1A 3ETDA 3LUTB 5CMUA 4Q20A 3E8GA 3W7WA 4QE7A 1R3IC 5H6RA 2V1DA 3TK1A 3B8NA 4LP8A 3D36A 3MHSC 1L1FA 3ABMC 1S0VA 2B1IA 3CD6V 4MVOA 3CC7V 3UKMA 1BMFG 1K4CC 2WLLB 2Q67A 1WLEA 2F43G 4GX0A 2PI5A 2EIKC 4HAMA 1M57C 5C93A 3BY6A 4MVZA 2M7WA 4WFHA 4JTCB 5EK0A 5CBFA 5IYCO 1KC8W 2WPDG 4R6ZA 5LGNA 4G27B 2ZR3A 1F4NA 1QCEA 4ASUG 2XASA 2OT5A 1TUEB 2R9RB 2HJFC 2QTOA 4JYCA 1OCCB 4X88A 3QO5A 5LGUA 1NKDA 2DYSB 1F4MA 1GMGA 2UXXA 2QM8A 4ZBMA 4EKWA 3I56V 1KD1W 2XNDG 1OZ0A 1K92A 4GX1A 3DGEA 1E1RG 4FPPA 4JF3A 2WAMA 4PDLA 2EIJC 2EIMC 4TT3G 1JJ2U 3JD1A 3G71V 2IH1C 2GSMB 3STZC 1G8MA 1QR8A 1F23A 3SYPA 1YHQV 1FXHA 5DN6G 4MW3A 1R6NA 3ZMVA 1JOYA 3SYCA 2ZDIA 3T2MA 3OGCC 1SRYA 3WG7B 3RVZA 3ABKC 4FIPC 4RQEA 4CBCA 2XAQA 3OUSA 1DTOA 2Y69C 2ZQMA 3ZIAG 1QLEC 2DQ3A 1K7DA 3I55V 5EC1C 1YI2V 3ZMSA 2ZXWB 4G2KA 3IC7A 4RAIA 2XAFA 3R65A 3LNMB 1I5XA 3ASOB 3CCMV 1VQKV 2IJHA 2XAHA 2EBOA 1UJWB 3FB5C 2IJIA 5EBLC 4J9YB 1QLNA 1SERA 3ABUA 1KP3A 2XAJA 3LDCA 5B3SB 5B1BB 3SYAA 2IU3A 2HLDG 4BIZA 2QA4V 2DW4A 3OMAB 4KUMA 3E89A 1BL8A 3CCVV 3FYEB 2B1GA 4GX5A 3ABMB 3OEHG 3ABTA 5LBQA 4WFBV 3K0DA 2EILC 2WLNA 4F4LA 1JVMA 3G6EV 5LHIA 5E1AC 1M56C 3OMIB 4GT1A 3CCQV 1DLBA 3P30A 1DF5A 1NH2D 3E8FA 1KQSU 3EHBB 3DTUB 1K33A 3AG4B 5L3BA 4LC1A 3F7YC 3RVYA 1BHAA 4MVQA 3CCEV 2QKSA 1V55B 4L87A 3ASOC 2HVKC 3T4ZA 3JYCA 4TSFG 3AG3B 2YSUB 4MS2A 2WLIB 4BW5A 3SPIA 4PA6A 2W6JG 2X0LA 3D3IA 4N23A 3VBBA 1E1QG 1K34A 4P30A 1QBZA 5GW7A 5L3GA 2OCCC 3T4DA 4WFAV 5IYDO 1FXKC 3NXSA 4RUEA 1RM1B 3OFNG 1COWG 1QR9A 4MTXA 1Q81W 2HKOA 2UXNA 1RPOA 3ZRVA 4HYOA 1AI7A 5IDJA 3BEHA 1GTOA 3STLC 1PNLA 2IJKA 2IU0A 5H6QA 4GCZA 4PA9A 4MW8A 4R7CA 2X6AA 1NVPD 5EBWC 2X7RB 1VQ5V 3B77A 4I9WA 4MVRA 5CBGA 4U7OA 3CC4V 1AJPA 3CCJV 4WFGA 3CCRV 4QE9A 3SJQC 2MK3A 2V7QG 2C2AA 5L3FA 1OHHG 4UXNA 4R50A 4N21A 3JD2A 2LFSA 4JYBA 1OCZB 3KG2A 3QNEA 1CP9A 2EZPA 3PJSK 1XL6A 5LGTA 3MD0A 3SPHA 1R6KA 3JD0A 2B5UA 1NBMG 3ASNB 1VQ7V 1FXKA 3OW2U 1AJNA 5CBHA 5KA6A 5HFMA 3ZMZA 4QPJA 2OTLV 4JAUA 1R3LC 1SESA 3W7TA 4PDRA 2JJ1G 1NH2B 1P7BA 3OAAG 1MG1A 3ZCCA 2WLHA 4H33A 1YJ9V 1VQOV 1N8RW 4ZKIA 1QVFU 3K79A 2JDIG 1AROP 3X2QB 3ZN0A 3CMEV 1WPXA 2R9IA 3CC2V 1E79G 3GWOA 4RQFA 4DXWA 2ZR2A 1R3JC 1B6QA 1KP2A 1V54B 3ZRWA 1ORQC 3TETA 4J9ZB 3LDDA 2AHYA 2OTJV 1IXMA 3ETGA 2JEXA 1VQ6V 4WF9V 2ZDIC 1VQNV 4JAVA 2P67A 2DYSC 1R73A 4JTDB 3CCLV 1NJIW 2JJ2G 1K5QA 4RO2A 3JD4A 3AG3C 5DM6V 2DYRC 4MTOA 4P9OA 1OCRC 5EBMC 2EIJB 1NQTA 2JEUA 4RUFA 3HPLC 5IY5C 3ASNC 4KP4A 3B8MA 1NVPB 3VOUA 2H8PC 1J95A 1FXKB 3W7XA 1RM1C 5KA5A 4P2ZA 5KUMA 2NNUA 3FKSG 3K0GA 1S5HC 3OE7G 4CZZA 1W0JG 1K8AW 2Z3YA 3CYOA 1PD3A 2QM7A 3OR6C 4KFMA 1VQPV 4UUJC 2WLIA 3OEEG 2Q69A 4UVAA 1AI4A 2ZXWC 1SETA 4WFFA 5B1AB 3SPCA 2BOCC 3F5WC 3E8HA 3JCZA 1YITV 4QNHB 1ENVA 3ZRWB 1AJQA 2YEVB 1CEZA 1NR1A 5B3SC 3ZN1A 1BHBA 5CN0A 2HG5C 1VQ4V 1GM8A 1PL0A 4P9PA 1JQ0A 1GM7A 5LHGA 1THZA 5B1OA 1SZTA 2LFRA 2D3OW 2LP7A 1PKXA 1KECA 1FXVA 5FL7G 3K03A 3IFXA 4LCUC 2KB1A 2EILB 4BAYA 5J9PC 1GM9A 1OCOC 2ITDC 4MVMA 3T1CA 4Z1MG 4JASA 1S77D 1JX9A 1M9NA 1MSWD 3WFVA 3ABLC 3SYOA 2X6BA 4YXWG 4QPKA 1PNKA 1LNQA 1V54C 4UV9A 3MHHC 4XBFA 3SPGA 4OXSA 1M57B 2HFEC 3HB3B 1H8HG 4H37A 4QIWF 3OMNB 3ZRXA 1Q7YW 4PELA 5B1AC 4MSWC 4QJFB 2X6CA 2JIZG 3CMAV 2QEXV 1Y66A 4XDKA 4X8AA 5H9CA 4LBEC 3ETEA 4UVBA 1K73W 3K3WA 3AEIA 2HVJC 1S3JA 1KKDA 2BOBC 4TWKA 3ZJZA 3CPWU 4GX2A 2A9HA 1AI6A 2OCCB 3CCSV 1W2BU 1K9MW 1ZWIC 2XOKG 1YTFB 4PA3A 4JTAB 5L3CA 4G28B 2PI4A 3AG1B 3G4SV 2EIMB 4FK5C 1S76D 3X2QC 1K97A 1DF4A 4MVSA 1G4YB 1K3EA 5HFLA 2Q6AA 1QVGU 1YJNV 1GO3F 1OCOB 3FB7C 4MT8A 2EINB 2EZOA 2A0LA 3QO7A 2EIKB 3ABLB 3EFFK 5LHHA 3W7SA 2P90A 1YJWV 3SPJA 1XL4A 3M99B 2DWEC 2DQ0A 2IJJA 4BIUA 1PNMA 3H01A 4UV8A 4U7NA 4WCEV 2QE7G 1OCZC 2GHYA 4HZ3A 4MTGA 1I5YA 1OCCC 3FB8C 2CK3G 4I5SA 4DO2A 3A0RA 1ROPA 4PA4A 4E2LA 3E2EA 1GKFA 3OM3B 2WLLA 1VQ8V 1EFRG 2WWWA 1CPYA 2Y48A 4WFEA 3LSSA 3TCUA 1JCHA 2EJRA 3ML0A 4UVCA 3W7UA 1EBOA 3FYIB 1MABG 3AG1C 4PDVA 1H38A 3IGAC 4JPRA 2AHZA 3AG2B 2WLKA 3K06A 1AR1B 3ZMTA 3LSQA 2WLJA 2IH3C 3ABKB 4XDLA 2K1EA 2FTKA 1VQLV 1M56B 3F7VC 2Y69B 5BZBA 5CA3A 3JD3A 1QLEB 1FS0G 3RW0A 1Q86W 3E8BA 1YSCA 5KUKA 2XAGA 5L3DA 1MOFA 3K08A 2ZD9A 3E83A 2YEVA 2P6JA 2DWDC 3UM7A 3FB6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI A;  2ZQM A;  1FXK A;  1FXK B;  2ZDI C;  3AEI A;  1FXK C; 
#chains in the Genus database with same CATH topology
 3ZED A;  3LDE A;  3VQW A;  4FJC C;  2YDE A;  5L3E A;  1G1X B;  3ZMU A;  3J7A U;  3AK1 A;  2QM4 A;  4PDM A;  4PA7 A;  4I55 B;  3SYQ A;  5IYB O;  1MNG A;  1D5A A;  1F51 A;  1HWY A;  2HR3 A;  5B5E Z;  3K5L A;  3CCU V;  2BTQ A;  4DW0 A;  2LGW A;  1Q82 W;  1M90 W;  3CXC U;  2DE0 X;  4DV4 O;  5GTH Z;  2E74 B;  2NLJ C;  4I0X A;  1GH6 A;  2XTA A;  2QGN A;  2P7T C;  4LFA O;  5LL6 Y;  1SQG A;  2GDS A;  3JSN A;  3OTF A;  4R8C A;  5KAF Z;  4LFA B;  3NR7 A;  1R3I C;  5FNV B;  3CRA A;  4LP8 A;  4ZHQ B;  5ITZ A;  4BWA A;  5IWA B;  3CD6 V;  1XI1 A;  2BE3 A;  5LP6 A;  2KG7 A;  2BCC H;  3APO A;  2Q67 A;  1AR5 A;  1WLE A;  3L73 H;  1SQX H;  5C8Y A;  5C93 A;  1M57 C;  1ZL8 A;  3BY6 A;  5IYC O;  5CBF A;  4O2B A;  5LMN O;  3KCX A;  4ZI7 A;  2ZR3 A;  2P22 C;  4K8Z A;  4K0K O;  2HJF C;  2QTO A;  3QO5 A;  4DR5 O;  1F4M A;  2UXX A;  1PL4 A;  1KD1 W;  1OZ0 A;  2YXH A;  5BMV A;  4PDL A;  2ZE6 A;  3JAK A;  1UPG A;  5KHK A;  1G8M A;  2Q73 A;  1QR8 A;  3H1J H;  3SYP A;  1YHQ V;  1JOY A;  3ZMV A;  2JRI A;  5DED A;  2RQ6 A;  3OGC C;  2UXB B;  5BXZ A;  1N34 B;  2Y69 C;  4U3F H;  3ZIA G;  1QLE C;  1K7D A;  3I55 V;  1YI2 V;  4KHP O;  4LF4 B;  2XAF A;  1FKA O;  3A0B Z;  4O2A A;  1VQK V;  2IJH A;  1X59 A;  4JYY A;  2N04 A;  3N2K A;  3FB5 C;  1I08 A;  1QLN A;  3ABU A;  4YJ3 A;  3K58 A;  3K9S A;  2QA4 V;  2JGD B;  2DW4 A;  5LXT B;  3CCV V;  1KB9 F;  3FYE B;  3OEH G;  3ABT A;  1Q90 D;  2PZS A;  1B3Q A;  2E3C A;  1Q5O A;  2AW9 A;  1JVM A;  2RN9 A;  5LHI A;  3CCQ V;  3EHB B;  1BSM A;  4LNU B;  1XHX A;  3RYC B;  2PYL A;  1XNQ B;  3RVY A;  4JI3 O;  3AG3 B;  1IBK B;  4LFC O;  3QF7 A;  3ZS8 C;  2Q0O C;  4HBN A;  1GRJ A;  4F6E A;  2CDY A;  1BZK A;  2XUM A;  5JCO C;  1QBZ A;  3P3P A;  1J5E B;  1NS1 A;  2OCC C;  3NXS A;  1N32 O;  3JAR A;  4LF4 O;  2HKO A;  4FFK A;  1RPO A;  3ZRV A;  3A0H Z;  1JMK C;  3BEH A;  5A2Q N;  3STL C;  4OPA A;  5J2U A;  4GCZ A;  4PA9 A;  2X6A A;  3CC4 V;  1AJP A;  4NXM B;  5GTI Z;  3HKB B;  2V7Q G;  2A06 H;  3R66 A;  4JI0 B;  2FML A;  2ZIN A;  4JYB A;  2EZP A;  3PJS K;  1XL6 A;  2B5U A;  1NBM G;  3L74 H;  4X64 O;  1VQ7 V;  3OW2 U;  3JAK B;  3GVM A;  4QPJ A;  1R3L C;  3BPZ A;  2JJ1 G;  4NVP A;  1MG1 A;  1TUB B;  1N8R W;  4JI5 O;  4B08 A;  3M8A A;  1WPX A;  4JI2 B;  1E79 G;  3GWO A;  2ZR2 A;  1R3J C;  5F2V O;  4X1K B;  4PI2 A;  1VF6 A;  3HKB A;  4O2A B;  3LDD A;  3RN4 A;  1SA0 A;  2QKC A;  4AHC A;  1R73 A;  4FLX A;  1JR9 A;  4RO2 A;  2FKX A;  1OCR C;  1TVK A;  1PPJ H;  3ASN C;  3B8M A;  1TGO A;  1NVP B;  3BAA A;  2H8P C;  1FXK B;  3L75 H;  2W0X A;  4BR6 A;  4DUZ B;  4YIO A;  3K0G A;  1S5H C;  2CTR A;  1A32 A;  4DV3 O;  4DR1 B;  1W59 A;  1O9G A;  1BQ0 A;  1N33 B;  4LF6 B;  5CA0 B;  4KFM A;  1VQP V;  3SGI A;  3VQY A;  1SA0 B;  2Q69 A;  3OEE G;  4DV1 O;  2R72 A;  2RNB A;  1SET A;  3SPC A;  4ZIB A;  3C3S A;  2YS8 A;  1N33 O;  2Q7H A;  1L0L H;  4LF9 B;  2L6L A;  4LWS A;  5CN0 A;  1LR1 A;  1VQ4 V;  2Q7G A;  1RFY A;  4JI2 O;  1THZ A;  4B3M O;  4O4I B;  2LP7 A;  1PKX A;  3J81 N;  1BE3 H;  5FL7 G;  5J9P C;  4EFB A;  3D36 C;  4X1Y B;  4WBN B;  1JJO A;  1VAR A;  2YXL A;  3RFR A;  1MSW D;  3WFV A;  3SYO A;  4QPK A;  1N32 B;  4XBF A;  5IJ9 B;  4OXS A;  4DR7 B;  1H2M A;  3OMN B;  1SQP H;  1Q7Y W;  5B1A C;  2F23 A;  3T1Y O;  2UUA B;  4B3R O;  3N2G B;  3DXR B;  2DN9 A;  3ETE A;  3APQ A;  4TWK A;  2QWQ B;  4GX2 A;  2OCC B;  2ZE5 A;  4HNA B;  3CCS V;  1FJG B;  1WB8 A;  4JTA B;  1XUQ A;  4G28 B;  3CJH B;  3G80 A;  3G4S V;  2EIM B;  4FK5 C;  4GYC B;  1S76 D;  3RYF B;  3X2Q C;  1K97 A;  4KHP B;  5HFL A;  4EFE A;  3FB7 C;  1NTZ H;  4FLV A;  3QO7 A;  4EB6 A;  1GAX A;  1N4C A;  3S3X A;  5K1X A;  1XDC A;  1YJW V;  3SPJ A;  2UU9 O;  4BIU A;  1PNM A;  3T1H O;  4O4H B;  1XMO B;  1OCZ C;  2GHY A;  2ZIM A;  4MTG A;  2BSK A;  4FLU A;  1SS3 A;  4JAA A;  4HNA A;  4JI7 B;  1H2K A;  4AIL C;  1GKF A;  3L71 H;  3OM3 B;  4YJ2 B;  1VQ8 V;  2WWW A;  2Y48 A;  3UQ8 A;  1N0N A;  3BCC H;  3HR0 A;  3JAR B;  2CUG A;  4GKJ O;  2EJR A;  4NR1 A;  4TV8 B;  3W7U A;  4U3J B;  3BVO A;  4DV2 B;  4IHJ B;  1MAB G;  3JAW A;  4JPR A;  5IYZ B;  2VQF O;  4JI3 B;  3AG2 B;  4B3R B;  2WLJ A;  2K1E A;  2Y69 B;  1FS0 G;  3M7M X;  3RW0 A;  5KHJ A;  2VS0 A;  4B3T B;  4I9Q A;  3K08 A;  2ZD9 A;  1WA8 B;  3C3T A;  3GWK C;  1SF9 A;  2QWR B;  1H8E G;  1Y6X A;  4FLW A;  2ATK C;  5IY5 B;  1NR7 A;  5JQG A;  1RPR A;  1HNW O;  1EZJ A;  1FAF A;  2YI9 A;  1R3K C;  3E86 A;  4DV7 O;  1G6U A;  2JS5 A;  1GK9 A;  1HNZ B;  4X65 O;  1EM1 A;  2W0F C;  4LF9 O;  1YTF D;  2A79 B;  3CRM A;  2EIN C;  3P32 A;  1H2S B;  4LF7 B;  2VQE B;  3HKE A;  2YI8 A;  4O4J B;  2F93 B;  1Y74 A;  1XBL A;  5DEC A;  2P5O A;  1H2N A;  3AG4 C;  2ITC C;  3ZHQ A;  1VIB A;  1P7G A;  3ZBH A;  2Z5U A;  3QO8 A;  3ETD A;  1KYO F;  5CMU A;  3W7W A;  4NXM O;  4QE7 A;  2ZE8 A;  3B8N A;  3WB0 A;  3RYF A;  1S0V A;  4FVM A;  3CC7 V;  3DC6 A;  1K4C C;  2WLL B;  2F43 G;  4GUN A;  2HJD A;  1U97 A;  4MVZ A;  3T1Y B;  2M7W A;  4JTC B;  1FFX A;  4R6Z A;  2CAZ C;  4G27 B;  1F4N A;  2HHH B;  1US6 A;  2XAS A;  2OT5 A;  1XIL A;  1R6T A;  1YF2 A;  1OCC B;  2DYS B;  1WPB A;  1EZV H;  4K3A A;  1IZ3 A;  2HP8 A;  4GX1 A;  3KZI Z;  1ZTE A;  4TT3 G;  4BIO A;  1QU7 A;  2GSM B;  1F23 A;  1BGY H;  5DN6 G;  4MW3 A;  3EVK A;  1SRY A;  4FIP C;  4CBC A;  3OUS A;  2Q4P A;  5EC1 C;  5JVD A;  2QR4 A;  2QKA A;  2ZXW B;  4RAI A;  3R65 A;  1M4U A;  4IL6 Z;  4B7E A;  4UCU A;  2XT9 A;  4X62 O;  2EBO A;  1UJW B;  4DR1 O;  5EBL C;  2QJ1 A;  5B3S B;  3SYA A;  1ZAU A;  1SZX A;  2IU3 A;  5LA6 B;  4YY3 O;  4KUM A;  1BL8 A;  4JV5 O;  5LYJ A;  1P49 A;  3H1I H;  2PY5 A;  2UXC B;  3ABM B;  3LSU A;  4JI4 O;  3WU2 Z;  3K0D A;  2EIL C;  4X1I B;  4GT1 A;  1DLB A;  1P84 F;  4JI7 O;  3D3Q A;  1DF5 A;  2UXD O;  5L3B A;  3LNN A;  1VP7 A;  4LC1 A;  3F7Y C;  3N27 A;  5LOV B;  2JGU A;  2GBO A;  1BHA A;  4MVQ A;  1AR4 A;  2GTA A;  3ASO C;  3ICX A;  4YHH O;  5KHH A;  1TUB A;  2WLI B;  5JCO A;  1K34 A;  4NYK A;  2Q0A A;  4P30 A;  1XNR B;  4B3S O;  3JAS A;  4DR6 B;  1VF7 A;  4LF5 O;  4CH5 A;  1XNQ O;  4ZOL B;  4MTX A;  4PV1 B;  2H3O A;  1Q81 W;  4CC6 A;  4HYO A;  4C7U A;  1GTO A;  1PNL A;  2X7R B;  1VQ5 V;  4I9W A;  2R70 A;  4PI0 A;  4B7K A;  1Y67 A;  3CCJ V;  4WFG A;  3G6B A;  5L3F A;  4JV5 B;  4R50 A;  4N21 A;  4CH3 A;  2ADP A;  3CS5 A;  3SPH A;  3JD0 A;  3FAV A;  2CTW A;  1VF5 B;  1FXK A;  4TV9 A;  5CBH A;  1Q6H A;  2OTL V;  4JAU A;  1SES A;  4DV4 B;  2JGD A;  3W7T A;  3QTC A;  4PDR A;  1NH2 B;  4J41 A;  1P7B A;  5LXT A;  3Q4H A;  3ZCC A;  2WLH A;  1YJ9 V;  3JAL B;  3RYI B;  3K79 A;  2JDI G;  4J7J A;  4YJ3 B;  2R9I A;  5EZY B;  4DR3 B;  4CS4 A;  3AK3 A;  1R1B A;  4E4E A;  1KP2 A;  1V54 B;  5GON B;  2YIB A;  2F4V B;  1Y74 B;  3ETG A;  1N36 B;  1TAE A;  4DV5 B;  3JAT A;  1VQN V;  1Q43 A;  2DYS C;  3CCL V;  4FZ1 A;  3B2E E;  1K5Q A;  2ZM6 B;  4JZ2 A;  3ZHV A;  1SQV H;  2OIG A;  2PTM A;  3JAW B;  2IBZ H;  4MTO A;  4P9O A;  1IDS A;  2EIJ B;  1NQT A;  4FM2 A;  3HPL C;  2E76 B;  4X1Y A;  1RM1 C;  1DGS A;  2NNU A;  4RWU A;  5KLV H;  3JAM N;  4YY3 B;  2Z3Y A;  3CYO A;  3DXR A;  3OR6 C;  5J2T B;  1S5J A;  4UUJ C;  4UVA A;  2ZXW C;  4UCV A;  4AQY B;  2BOC C;  3N2G A;  1SQF A;  1N34 O;  1DK1 A;  1CEZ A;  1B06 A;  3RYH A;  5IT9 N;  5B3S C;  1BHB A;  3ZHU A;  4P9P A;  5LHG A;  5KAI Z;  5KHI A;  2OCH A;  1FXV A;  4OX9 B;  5CB4 A;  4O4H A;  1HR0 O;  4UCT A;  3ABL C;  2X6B A;  3JSL A;  5JVD B;  4DUY O;  4UV9 A;  3MHH C;  2KSD A;  2E5L B;  1M57 B;  2HFE C;  4QIW F;  1H8H G;  4H37 A;  2Q7E A;  3H1K H;  4IHJ A;  4PEL A;  2NN4 A;  2JIZ G;  2P4V A;  2X6C A;  3CMA V;  1M5I A;  1PP9 H;  4UVB A;  4UCS A;  3K3W A;  3FD9 A;  3FX7 A;  4DUY B;  4U3J A;  3CE2 A;  3ZJZ A;  2ZKO A;  2A9H A;  1AI6 A;  2FL4 A;  2ZNI A;  4TQD A;  1K9M W;  1BS3 A;  4IYH A;  3U0Z A;  1PM9 A;  2XOK G;  2ADQ B;  5L3C A;  4GZR B;  3TXQ A;  4NXN B;  4B3T O;  1Q6U A;  1G4Y B;  1RSO A;  1GO3 F;  5BMV B;  5AG2 A;  2EZO A;  1YVW A;  4TUY B;  2V4D A;  2EIK B;  1KBH A;  1L0N H;  2P90 A;  2DOS A;  1WA8 A;  2DJV A;  4H13 B;  1VF6 C;  2DQ0 A;  4NXN O;  2JS3 A;  4U7N A;  1Z2G A;  4WCE V;  2ZT9 B;  1OCC C;  3FB8 C;  4ICG A;  5CA0 A;  5IJ0 B;  4PA4 A;  4E2L A;  1IUR A;  1EFR G;  4WFE A;  5CA1 B;  3LSS A;  3K5O A;  5KHG A;  2UUB B;  3A8T A;  4LWS B;  4PDV A;  5D5P A;  2WLK A;  4D6T H;  2IH3 C;  1VQL V;  3F7V C;  4J10 A;  2ZIO A;  3OT7 A;  3HKD B;  4I4T A;  1O9H A;  2XAG A;  5IJ9 A;  2P6J A;  5JH7 A;  4NKG B;  1XRE A;  4H44 B;  3FB6 C;  5JJN B;  1V55 C;  5B1N A;  2Q68 A;  4I55 A;  4JGS A;  5B1B C;  3CHX A;  1AP5 A;  4IIJ B;  3K04 A;  4PHZ A;  2M6Y A;  5JWP A;  1S72 V;  1K4D C;  3UCS C;  4GKJ B;  1P4R A;  4A5U B;  3OR7 C;  1OV9 A;  4FZ0 A;  3AG2 C;  1Y4M A;  3GB7 C;  4B3S B;  3TGU H;  3RBZ A;  2W6I G;  2GTS A;  4MVU A;  3ZRS A;  2HEP A;  1WN7 A;  4JYA B;  3SR2 C;  1JPX A;  2UXB O;  4JI6 O;  2WA3 A;  2E75 B;  3LUT B;  3CRC A;  3E8G A;  5LP6 B;  5KMG A;  1V9P A;  5H6R A;  2ZM6 O;  3HKC A;  3D36 A;  2UUC O;  3MHS C;  1HW7 A;  4ZHQ A;  2B1I A;  4MVO A;  1WNS A;  2OIE A;  4DR2 B;  1BMF G;  4X1K A;  2LGQ A;  4GX0 A;  2PI5 A;  4ZI7 B;  4WFH A;  5EK0 A;  3IC9 A;  2ODM A;  2WPD G;  1D2D A;  5LGN A;  1ZL8 B;  4I50 B;  4F6R B;  4NTY A;  4K35 A;  2PUS A;  1QCE A;  4ASU G;  2RMK B;  2QSA A;  1TUE B;  2R9R B;  5H2F Z;  5LMU B;  4JYC A;  5LGU A;  1WAZ A;  4DR7 O;  4NTX A;  2QM8 A;  4ZBM A;  2LW1 A;  3RYI A;  3E22 A;  2XND G;  3HKC B;  1XOU A;  2YUA A;  4J11 A;  3FFQ A;  1E1R G;  4JI4 B;  5B66 Z;  1JJ2 U;  3JD1 A;  3SJC C;  3G71 V;  3STZ C;  2N74 A;  1R6N A;  1AIL A;  5LOV A;  1IX9 A;  1KMI Z;  2Y0P A;  4KXR A;  3S3W A;  3CEI A;  4CH6 A;  4RQE A;  3K5M A;  2Y4U A;  3CXH F;  2YC0 A;  2ZQM A;  4I50 A;  4UCO A;  4F6R A;  5FPR A;  5JQG B;  4UFZ A;  2PF4 E;  3ASO B;  2AZ0 A;  2XAH A;  3OTO B;  1XMQ O;  2Q8V A;  1PV0 A;  4DW1 A;  3JAS B;  2IJI A;  1YDX A;  4J9Y B;  2XAJ A;  3LDC A;  1KKC A;  4NTW A;  1WJZ A;  2O57 A;  1FPO A;  3E89 A;  4JI0 O;  1TA8 A;  4GX5 A;  3N2K B;  4LR3 A;  4WFB V;  4L8J A;  1Y76 B;  3DC5 A;  3G6E V;  3OMI B;  1XNR O;  2CGO A;  1K33 A;  1URF A;  3AG4 B;  3O9O A;  2QKS A;  1V55 B;  3U10 A;  3T4Z A;  2A3Q A;  5LMN B;  3BRC A;  4TSF G;  3UO2 A;  1YXB A;  4MS2 A;  1H2L A;  4BW5 A;  3SPI A;  2X0L A;  4DK1 A;  3D3I A;  1E1Q G;  3CJH A;  4IYI A;  3CSX A;  5GW7 A;  1YZB A;  4W4L A;  3T4D A;  3BFR A;  1FXK C;  4FFB A;  4WFA V;  2LW7 A;  2VQE O;  3OFN G;  1QR9 A;  4NB5 A;  2RJZ A;  3OD4 A;  1IXB A;  1AI7 A;  3JCU Z;  3CB2 A;  2IJK A;  2IU0 A;  5H6Q A;  4R7C A;  4MW8 A;  1NVP D;  5EBW C;  4DV5 O;  2UUC B;  3B77 A;  4MVR A;  3I5D A;  1MZF A;  2F66 C;  4H0L B;  1AVM A;  4I7Z B;  2QWP B;  2MK3 A;  2C2A A;  1OHH G;  2ILM A;  4UXN A;  5JJJ B;  3UT5 B;  3JD2 A;  2EJ7 A;  4EB6 B;  5J2T A;  1OCZ B;  1CP9 A;  5FNV A;  2P06 A;  4IIJ A;  2CTQ A;  5ITZ B;  5KA6 A;  5HFM A;  3KKY A;  3ZMZ A;  1F7Y A;  5LA6 A;  2KG7 B;  4CS3 A;  1ZSP A;  1QVF U;  3ZN0 A;  3CC2 V;  4YIP A;  4RQF A;  5IJ0 A;  4J9Z B;  4GKK B;  4UB8 Z;  1IXM A;  1GN3 A;  1VQ6 V;  2FB5 A;  3RYH B;  2ZDI C;  4WF9 V;  4X66 O;  2P67 A;  2JJ2 G;  2G38 A;  3JD4 A;  3AG3 C;  2DYR C;  4X66 B;  3T1H B;  5FLX N;  5EBM C;  1AP6 A;  2JEU A;  5IY5 C;  5BR8 B;  3VOU A;  4JI6 B;  2L35 A;  1J95 A;  2F4V O;  5KA5 A;  4IT5 A;  4O4L A;  1MZE A;  3RWR D;  1PD3 A;  2F1M A;  5JJE B;  2WLI A;  4PD4 F;  1AI4 A;  1HP8 A;  3E8H A;  3JCZ A;  3HKE B;  4DR6 O;  1RSO B;  3THO A;  1UFI A;  5A9G A;  4QNH B;  1ENV A;  3ZRW B;  3WB1 A;  2YEV B;  1NR1 A;  4UCR A;  4LF6 O;  1XQ8 A;  2GUZ B;  2UUA O;  3P3N A;  5EYP A;  5B1O A;  1SZT A;  3B09 A;  2LFR A;  2LQT A;  4X9Q A;  2KKW A;  3K03 A;  4LCU C;  1B04 A;  1OCO C;  2ITD C;  4Z1M G;  1S77 D;  3SJA C;  1M9N A;  4X62 B;  4Q6G A;  1IBM O;  3EXA A;  1VMG A;  4YXW G;  1PNK A;  4GLX A;  3SPG A;  4FM1 A;  3FAV B;  5GON A;  3ZRX A;  4DV2 O;  5IE9 A;  4TQF A;  2CH7 A;  4MSW C;  3BHP A;  1N0J A;  2QTS A;  4X8A A;  5H9C A;  2HHH O;  4LBE C;  3AEI A;  3SJB C;  3HKD A;  1KKD A;  4OPH A;  5EZY A;  4DR4 O;  1Y76 A;  3B4S A;  4LFB B;  1W2B U;  2K9P A;  4K8X A;  2E5L O;  3WB2 A;  2ZE7 A;  5J2U B;  2N05 A;  4D7S A;  1XMQ B;  3H1L H;  4J80 A;  2XHB A;  4X20 B;  4DR5 B;  4EEQ A;  4MVS A;  1NI8 A;  1QVG U;  1IBL B;  5JH7 B;  2EIN B;  4J42 A;  3ABL B;  1ZX3 A;  3IJ4 A;  5EIB C;  1ZUQ A;  2DWE C;  2IJJ A;  3H01 A;  3DSQ A;  4UV8 A;  2ARH A;  4CC5 A;  1HNX O;  2QE7 G;  1Q6I A;  4HZ3 A;  2CK3 G;  4I5S A;  2Y0I A;  4DRX A;  5IYZ A;  1XMO O;  4LF7 O;  1BQZ A;  2UU9 B;  4DV3 B;  3QG5 A;  3QVN A;  1JCH A;  4X1I A;  2ETN A;  1GN4 A;  2GV9 A;  4UVC A;  3FYI B;  1H38 A;  3AG1 C;  2AHZ A;  1LUV A;  1Z5V A;  3K06 A;  1AR1 B;  3ZMT A;  3LSQ A;  4XDL A;  1M56 B;  5BZB A;  5CA3 A;  4LF8 B;  1QLE B;  4CS2 A;  1Q86 W;  3E8B A;  1YSC A;  4OX9 O;  5L3D A;  1MOF A;  3E83 A;  2YEV A;  4FLY A;  3UM7 A;  2UXD B;  1M1K W;  2DYR B;  4X65 B;  2WA4 A;  2IW5 A;  4DV7 B;  5CB4 B;  1OCR B;  1K5S A;  1FD9 A;  2WLM A;  1VQ9 V;  2H94 A;  2VQF B;  3PN1 A;  1TVK B;  4JYA O;  3A2F A;  1KUQ A;  1KU9 A;  1W0K G;  1JFF B;  4JI1 O;  5KX5 A;  1FFT B;  1Q3E A;  1AI5 A;  4W4K A;  3E22 B;  3WG7 C;  5FPO A;  2RDC A;  2JK5 C;  4J7K A;  1LUW A;  2EX3 A;  4MTF A;  1VQM V;  1J5E O;  3OUF A;  3IAY A;  1YIJ V;  2PYJ A;  2Q9L A;  2WSS G;  5EC2 C;  4DV6 O;  3E35 A;  4FMT A;  4XDJ A;  4X89 A;  3G67 A;  3L9D A;  2B9Z A;  5BY1 A;  1H2G A;  3K9A A;  3AK2 A;  3CP1 A;  4Q20 A;  4DV0 O;  1MA1 A;  4AQY O;  2V1D A;  3TK1 A;  1JFF A;  5K1P A;  2YIB D;  1L1F A;  3ABM C;  3CRQ A;  1I94 B;  3K5N A;  1SC5 B;  3SDL A;  2IM9 A;  4TV9 B;  3UKM A;  1NTK H;  1FJG O;  2YXY A;  4DUZ O;  2EIK C;  3CWB H;  4LFC B;  4HAM A;  3BA9 A;  1KC8 W;  3O65 A;  1RP3 B;  2YIA A;  4Z1V A;  4JI5 B;  4I4T B;  2QWO B;  4DR2 O;  1XEQ A;  4X88 A;  1NKD A;  1NU1 H;  4QGP A;  1GMG A;  1SQQ H;  4D7T A;  4EKW A;  3I56 V;  4I0X B;  2BTQ B;  1HDJ A;  1K92 A;  1I7F A;  1WB7 A;  5TIS Z;  3DGE A;  1M93 A;  4FPP A;  4JF3 A;  2WAM A;  2EIJ C;  2EIM C;  4FLZ A;  4Z2W A;  2IH1 C;  4JZG A;  1FXH A;  1ZLZ A;  3SYC A;  2ZDI A;  3T2M A;  2QWN B;  1YCI A;  3WG7 B;  3RVZ A;  3ABK C;  2EUL A;  2XAQ A;  1DTO A;  2DQ3 A;  4AI8 A;  2CH7 B;  3ZMS A;  4OGQ B;  4G2K A;  3IC7 A;  1I0H A;  3LNM B;  1I5X A;  3CCM V;  1NT2 B;  3VQX A;  3VQV A;  4FFB B;  3ZHS A;  4O2B B;  4JI1 B;  4TV8 A;  4DV1 B;  1SER A;  1KP3 A;  5B1B B;  2HLD G;  3CRR A;  4BIZ A;  3H1H H;  3OMA B;  2LO1 A;  4YHH B;  1AB3 A;  5LMU O;  2B1G A;  5D5Q A;  2P4K A;  2ZCE A;  5LBQ A;  2WLN A;  4F4L A;  5KMG B;  5E1A C;  1M56 C;  3P30 A;  1NH2 D;  3E8F A;  1KQS U;  3DTU B;  3UT5 A;  1D5N A;  4DV0 B;  2CGN A;  3CCE V;  4L87 A;  4DR3 O;  2HVK C;  3JYC A;  2YSU B;  2UUB O;  4FLT A;  4PA6 A;  2W6J G;  4N23 A;  3VBB A;  5L3G A;  5IYD O;  2A7W A;  4ZOL A;  4RUE A;  1RM1 B;  1COW G;  2UXN A;  2KQX A;  5IDJ A;  1MSD A;  1HNX B;  2AGA A;  3OTO O;  3TXS A;  4BW9 A;  4DYL A;  5CBG A;  4U7O A;  2MW2 B;  4B3M B;  4TUY A;  1EN6 A;  1BCC H;  3CCR V;  4QE9 A;  3SJQ C;  4FM0 A;  1WP8 A;  2FYU H;  2LFS A;  3ZHT A;  3KG2 A;  3QNE A;  1S5L Z;  3OGI B;  5LGT A;  3MD0 A;  1R6K A;  5EIB D;  2DMX A;  3J80 N;  3ASN B;  4O4L B;  4O4I A;  1AJN A;  1HR0 B;  3ZHR A;  3OAA G;  4WBN A;  1N36 O;  4H33 A;  1VQO V;  1NZ6 A;  2PGG A;  4ZKI A;  5CA1 A;  1ARO P;  3X2Q B;  3CME V;  1FFX B;  4DXW A;  1QHT A;  1B6Q A;  3ZRW A;  1ORQ C;  1CXZ B;  3TET A;  3K59 A;  1SKV A;  1QQC A;  1HNW B;  2AHY A;  2OTJ V;  1NTM H;  4IGG A;  2JEX A;  1IBM B;  4JAV A;  1L8D A;  5IWA O;  4JTD B;  1X4T A;  1WP7 A;  1NJI W;  2OWO A;  5DM6 V;  1SQB H;  4RUF A;  1GN2 A;  3AG7 A;  4KP4 A;  3MDS A;  1JA8 A;  3W7X A;  1VEW A;  4UB6 Z;  4P2Z A;  5KUM A;  1IBK O;  3FKS G;  1YEW A;  3OE7 G;  4CZZ A;  1W0J G;  3ETQ A;  1Q8I A;  1K8A W;  2BSK B;  2QM7 A;  3UO3 A;  3K57 A;  3F5T A;  4WFF A;  5B1A B;  4YJ2 A;  4ABM A;  3F5W C;  4CH4 A;  3KCY A;  2Q5Z A;  4X64 B;  4PJ0 Z;  1YIT V;  1I94 O;  4GKK O;  2YID A;  1AJQ A;  5C8Y B;  3BA8 A;  3ZN1 A;  1MMM A;  3CX5 F;  4LH6 A;  1FYJ A;  5KX5 B;  2HG5 C;  4X20 A;  1GM8 A;  1PL0 A;  1JQ0 A;  1GM7 A;  1IBL O;  5LP6 C;  2D3O W;  4DV6 B;  1KEC A;  2VRZ A;  1IVS A;  3IFX A;  2KB1 A;  2EIL B;  3ZX6 A;  4BAY A;  1GM9 A;  4DRX B;  5LYJ B;  4MVM A;  3T1C A;  4JI8 B;  4JAS A;  2RCV A;  1JX9 A;  5E79 Z;  3D8C A;  2YIC A;  4DR4 B;  1LNQ A;  1V54 C;  4LF5 B;  2QDO A;  1EN4 A;  3H9V A;  4TOI A;  3U11 A;  3HB3 B;  2UXC O;  4QJF B;  2QEX V;  1Y66 A;  4XDK A;  5H5N A;  1K73 W;  2VWJ A;  2HVJ C;  1S3J A;  1OJH A;  2BOB C;  2BTO A;  3CPW U;  1QNM A;  1ZWI C;  1BT8 A;  1YTF B;  4J7Z A;  4PA3 A;  2JVD A;  2PI4 A;  3AG1 B;  3RGB A;  2Y4T A;  2VWK A;  1DF4 A;  1K3E A;  2Q6A A;  1YJN V;  4LF8 O;  1U96 A;  1OCO B;  4MT8 A;  1Z5W A;  4K0K B;  2LJ2 A;  2AXT Z;  2A0L A;  2Z0A A;  4O4J A;  3EFF K;  5LHH A;  3W7S A;  5BR8 O;  1XL4 A;  3M99 B;  3RYC A;  1GN6 A;  1I5Y A;  4DO2 A;  4DK0 A;  3RT3 C;  3A0R A;  3B40 A;  1HNZ O;  3TJT A;  1ROP A;  3C90 A;  4LNU A;  3MAQ A;  3E2E A;  2WLL A;  2NR5 A;  1CPY A;  3Q4H B;  2GUZ A;  3JAL A;  3TCU A;  3BAB A;  4LFB O;  3ML0 A;  1EN5 A;  2D2C B;  2R9A A;  1EBO A;  3IGA C;  1T5E A;  2CTP A;  2AZ2 A;  4KL1 A;  2CE4 A;  3L72 H;  3ABK B;  1XHZ A;  2FTK A;  3JAT B;  3JD3 A;  5EYP B;  4LH7 A;  4JI8 O;  5KUK A;  2ZNJ A;  2F95 B;  3L70 H;  2DWD C;  2OYQ A; 
#chains in the Genus database with same CATH homology
 1M1K W;  2DYR B;  1V55 C;  2IW5 A;  3LDE A;  5B1N A;  1H8E G;  1OCR B;  4FJC C;  2Q68 A;  5L3E A;  2ATK C;  5IY5 B;  1NR7 A;  4JGS A;  1K5S A;  3ZMU A;  5B1B C;  1RPR A;  2WLM A;  1VQ9 V;  4PDM A;  4PA7 A;  2H94 A;  3SYQ A;  1EZJ A;  5IYB O;  3K04 A;  1R3K C;  1W0K G;  1F51 A;  1HWY A;  3E86 A;  1S72 V;  2HR3 A;  1GK9 A;  1FFT B;  1K4D C;  1AI5 A;  3CCU V;  2W0F C;  3WG7 C;  1YTF D;  1P4R A;  2JK5 C;  1Q82 W;  2A79 B;  3OR7 C;  1M90 W;  3CXC U;  2EIN C;  3AG2 C;  3P32 A;  1Y4M A;  3GB7 C;  4MTF A;  3RBZ A;  1VQM V;  2W6I G;  3OUF A;  2NLJ C;  4MVU A;  1YIJ V;  3AG4 C;  2WSS G;  3ZRS A;  5EC2 C;  2ITC C;  2P7T C;  3E35 A;  1JPX A;  4FMT A;  4XDJ A;  4X89 A;  2Z5U A;  4R8C A;  1H2G A;  3QO8 A;  3K9A A;  3CP1 A;  3ETD A;  3LUT B;  5CMU A;  4Q20 A;  3E8G A;  3W7W A;  4QE7 A;  1R3I C;  5H6R A;  2V1D A;  3TK1 A;  3B8N A;  4LP8 A;  3D36 A;  3MHS C;  1L1F A;  3ABM C;  1S0V A;  2B1I A;  3CD6 V;  4MVO A;  3CC7 V;  3UKM A;  1BMF G;  1K4C C;  2WLL B;  2Q67 A;  1WLE A;  2F43 G;  4GX0 A;  2PI5 A;  2EIK C;  4HAM A;  1M57 C;  5C93 A;  3BY6 A;  4MVZ A;  2M7W A;  4WFH A;  4JTC B;  5EK0 A;  5CBF A;  5IYC O;  1KC8 W;  2WPD G;  4R6Z A;  5LGN A;  4G27 B;  2ZR3 A;  1F4N A;  1QCE A;  4ASU G;  2XAS A;  2OT5 A;  1TUE B;  2R9R B;  2HJF C;  2QTO A;  4JYC A;  1OCC B;  4X88 A;  3QO5 A;  5LGU A;  1NKD A;  2DYS B;  1F4M A;  1GMG A;  2UXX A;  2QM8 A;  4ZBM A;  4EKW A;  3I56 V;  1KD1 W;  2XND G;  1OZ0 A;  1K92 A;  4GX1 A;  3DGE A;  1E1R G;  4FPP A;  4JF3 A;  2WAM A;  4PDL A;  2EIJ C;  2EIM C;  4TT3 G;  1JJ2 U;  3JD1 A;  3G71 V;  2IH1 C;  2GSM B;  3STZ C;  1G8M A;  1QR8 A;  1F23 A;  3SYP A;  1YHQ V;  1FXH A;  5DN6 G;  4MW3 A;  1R6N A;  3ZMV A;  1JOY A;  3SYC A;  2ZDI A;  3T2M A;  3OGC C;  1SRY A;  3WG7 B;  3RVZ A;  3ABK C;  4FIP C;  4RQE A;  4CBC A;  2XAQ A;  3OUS A;  1DTO A;  2Y69 C;  2ZQM A;  3ZIA G;  1QLE C;  2DQ3 A;  1K7D A;  3I55 V;  5EC1 C;  1YI2 V;  3ZMS A;  2ZXW B;  4G2K A;  3IC7 A;  4RAI A;  2XAF A;  3R65 A;  3LNM B;  1I5X A;  3ASO B;  3CCM V;  1VQK V;  2IJH A;  2XAH A;  2EBO A;  1UJW B;  3FB5 C;  2IJI A;  5EBL C;  4J9Y B;  1QLN A;  1SER A;  3ABU A;  1KP3 A;  2XAJ A;  3LDC A;  5B3S B;  5B1B B;  3SYA A;  2IU3 A;  2HLD G;  4BIZ A;  2QA4 V;  2DW4 A;  3OMA B;  4KUM A;  3E89 A;  1BL8 A;  3CCV V;  3FYE B;  2B1G A;  4GX5 A;  3ABM B;  3OEH G;  3ABT A;  5LBQ A;  4WFB V;  3K0D A;  2EIL C;  2WLN A;  4F4L A;  1JVM A;  3G6E V;  5LHI A;  5E1A C;  1M56 C;  3OMI B;  4GT1 A;  3CCQ V;  1DLB A;  3P30 A;  1DF5 A;  1NH2 D;  3E8F A;  1KQS U;  3EHB B;  3DTU B;  1K33 A;  3AG4 B;  5L3B A;  4LC1 A;  3F7Y C;  3RVY A;  1BHA A;  4MVQ A;  3CCE V;  2QKS A;  1V55 B;  4L87 A;  3ASO C;  2HVK C;  3T4Z A;  3JYC A;  4TSF G;  3AG3 B;  2YSU B;  4MS2 A;  2WLI B;  4BW5 A;  3SPI A;  4PA6 A;  2W6J G;  2X0L A;  3D3I A;  4N23 A;  3VBB A;  1E1Q G;  1K34 A;  4P30 A;  1QBZ A;  5GW7 A;  5L3G A;  2OCC C;  3T4D A;  4WFA V;  5IYD O;  1FXK C;  3NXS A;  4RUE A;  1RM1 B;  3OFN G;  1COW G;  1QR9 A;  4MTX A;  1Q81 W;  2HKO A;  2UXN A;  1RPO A;  3ZRV A;  4HYO A;  1AI7 A;  5IDJ A;  3BEH A;  1GTO A;  3STL C;  1PNL A;  2IJK A;  2IU0 A;  5H6Q A;  4GCZ A;  4PA9 A;  4MW8 A;  4R7C A;  2X6A A;  1NVP D;  5EBW C;  2X7R B;  1VQ5 V;  3B77 A;  4I9W A;  4MVR A;  5CBG A;  4U7O A;  3CC4 V;  1AJP A;  3CCJ V;  4WFG A;  3CCR V;  4QE9 A;  3SJQ C;  2MK3 A;  2V7Q G;  2C2A A;  5L3F A;  1OHH G;  4UXN A;  4R50 A;  4N21 A;  3JD2 A;  2LFS A;  4JYB A;  1OCZ B;  3KG2 A;  3QNE A;  1CP9 A;  2EZP A;  3PJS K;  1XL6 A;  5LGT A;  3MD0 A;  3SPH A;  1R6K A;  3JD0 A;  2B5U A;  1NBM G;  3ASN B;  1VQ7 V;  1FXK A;  3OW2 U;  1AJN A;  5CBH A;  5KA6 A;  5HFM A;  3ZMZ A;  4QPJ A;  2OTL V;  4JAU A;  1R3L C;  1SES A;  3W7T A;  4PDR A;  2JJ1 G;  1NH2 B;  1P7B A;  3OAA G;  1MG1 A;  3ZCC A;  2WLH A;  4H33 A;  1YJ9 V;  1VQO V;  1N8R W;  4ZKI A;  1QVF U;  3K79 A;  2JDI G;  1ARO P;  3X2Q B;  3ZN0 A;  3CME V;  1WPX A;  2R9I A;  3CC2 V;  1E79 G;  3GWO A;  4RQF A;  4DXW A;  2ZR2 A;  1R3J C;  1B6Q A;  1KP2 A;  1V54 B;  3ZRW A;  1ORQ C;  3TET A;  4J9Z B;  3LDD A;  2AHY A;  2OTJ V;  1IXM A;  3ETG A;  2JEX A;  1VQ6 V;  4WF9 V;  2ZDI C;  1VQN V;  4JAV A;  2P67 A;  2DYS C;  1R73 A;  4JTD B;  3CCL V;  1NJI W;  2JJ2 G;  1K5Q A;  4RO2 A;  3JD4 A;  3AG3 C;  5DM6 V;  2DYR C;  4MTO A;  4P9O A;  1OCR C;  5EBM C;  2EIJ B;  1NQT A;  2JEU A;  4RUF A;  3HPL C;  5IY5 C;  3ASN C;  4KP4 A;  3B8M A;  1NVP B;  3VOU A;  2H8P C;  1J95 A;  1FXK B;  3W7X A;  1RM1 C;  5KA5 A;  4P2Z A;  5KUM A;  2NNU A;  3FKS G;  3K0G A;  1S5H C;  3OE7 G;  4CZZ A;  1W0J G;  1K8A W;  2Z3Y A;  3CYO A;  1PD3 A;  2QM7 A;  3OR6 C;  4KFM A;  1VQP V;  4UUJ C;  2WLI A;  3OEE G;  2Q69 A;  4UVA A;  1AI4 A;  2ZXW C;  1SET A;  4WFF A;  5B1A B;  3SPC A;  2BOC C;  3F5W C;  3E8H A;  3JCZ A;  1YIT V;  4QNH B;  1ENV A;  3ZRW B;  1AJQ A;  2YEV B;  1CEZ A;  1NR1 A;  5B3S C;  3ZN1 A;  1BHB A;  5CN0 A;  2HG5 C;  1VQ4 V;  1GM8 A;  1PL0 A;  4P9P A;  1JQ0 A;  1GM7 A;  5LHG A;  1THZ A;  5B1O A;  1SZT A;  2LFR A;  2D3O W;  2LP7 A;  1PKX A;  1KEC A;  1FXV A;  5FL7 G;  3K03 A;  3IFX A;  4LCU C;  2KB1 A;  2EIL B;  4BAY A;  5J9P C;  1GM9 A;  1OCO C;  2ITD C;  4MVM A;  3T1C A;  4Z1M G;  4JAS A;  1S77 D;  1JX9 A;  1M9N A;  1MSW D;  3WFV A;  3ABL C;  3SYO A;  2X6B A;  4YXW G;  4QPK A;  1PNK A;  1LNQ A;  1V54 C;  4UV9 A;  3MHH C;  4XBF A;  3SPG A;  4OXS A;  1M57 B;  2HFE C;  3HB3 B;  1H8H G;  4H37 A;  4QIW F;  3OMN B;  3ZRX A;  1Q7Y W;  4PEL A;  5B1A C;  4MSW C;  4QJF B;  2X6C A;  2JIZ G;  3CMA V;  2QEX V;  1Y66 A;  4XDK A;  4X8A A;  5H9C A;  4LBE C;  3ETE A;  4UVB A;  1K73 W;  3K3W A;  3AEI A;  2HVJ C;  1S3J A;  1KKD A;  2BOB C;  4TWK A;  3ZJZ A;  3CPW U;  4GX2 A;  2A9H A;  1AI6 A;  2OCC B;  3CCS V;  1W2B U;  1K9M W;  1ZWI C;  2XOK G;  1YTF B;  4PA3 A;  4JTA B;  5L3C A;  4G28 B;  2PI4 A;  3AG1 B;  3G4S V;  2EIM B;  4FK5 C;  1S76 D;  3X2Q C;  1K97 A;  1DF4 A;  4MVS A;  1G4Y B;  1K3E A;  5HFL A;  2Q6A A;  1QVG U;  1YJN V;  1GO3 F;  1OCO B;  3FB7 C;  4MT8 A;  2EIN B;  2EZO A;  2A0L A;  3QO7 A;  2EIK B;  3ABL B;  3EFF K;  5LHH A;  3W7S A;  2P90 A;  1YJW V;  3SPJ A;  1XL4 A;  3M99 B;  2DWE C;  2DQ0 A;  2IJJ A;  4BIU A;  1PNM A;  3H01 A;  4UV8 A;  4U7N A;  4WCE V;  2QE7 G;  1OCZ C;  2GHY A;  4HZ3 A;  4MTG A;  1I5Y A;  1OCC C;  3FB8 C;  2CK3 G;  4I5S A;  4DO2 A;  3A0R A;  1ROP A;  4PA4 A;  4E2L A;  3E2E A;  1GKF A;  3OM3 B;  2WLL A;  1VQ8 V;  1EFR G;  2WWW A;  1CPY A;  2Y48 A;  4WFE A;  3LSS A;  3TCU A;  1JCH A;  2EJR A;  3ML0 A;  4UVC A;  3W7U A;  1EBO A;  3FYI B;  1MAB G;  3AG1 C;  4PDV A;  1H38 A;  3IGA C;  4JPR A;  2AHZ A;  3AG2 B;  2WLK A;  3K06 A;  1AR1 B;  3ZMT A;  3LSQ A;  2WLJ A;  2IH3 C;  3ABK B;  4XDL A;  2K1E A;  2FTK A;  1VQL V;  1M56 B;  3F7V C;  2Y69 B;  5BZB A;  5CA3 A;  3JD3 A;  1QLE B;  1FS0 G;  3RW0 A;  1Q86 W;  3E8B A;  1YSC A;  5KUK A;  2XAG A;  5L3D A;  1MOF A;  3K08 A;  2ZD9 A;  3E83 A;  2YEV A;  2P6J A;  2DWD C;  3UM7 A;  3FB6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...