1FXKB

Crystal structure of archaeal prefoldin (gimc).
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
109
structure length
109
Chain Sequence
NVQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQEAMKGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the molecular chaperone prefoldin: unique interaction of multiple coiled coil tentacles with unfolded proteins.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Chaperone
molecule keywords PREFOLDIN
total genus 38
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2000-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1fxkB00
1FXKA 2ZDIA 2ZQMA 3AEIA 1FXKC 1FXKB 2ZDIC
chains in the Genus database with same CATH superfamily
5L3FA 3O9OA 1Q3EA 1VF6C 4IGGA 2X0LA 5B5EZ 5CA3A 5C93A 4LC1A 3IC9A 4X89A 3E22B 3EFFK 4MVZA 2WLJA 5IYCO 1KD1W 3CRCA 2WLLA 4JI7B 1RPOA 1F7YA 1W2BU 3NR7A 2RJZA 4FZ1A 4YHHO 4O2AB 2LFSA 3CP1A 4RWUA 1S77D 3AG2B 1YTFD 2RNBA 2Q7EA 3CSXA 3UQ8A 1P4RA 2QM7A 4Z1MG 4BIOA 2ZE7A 5KHJA 2N04A 3AG1C 5CB4B 3TETA 4LFBB 5EIBD 1QR8A 2K1EA 3ABKB 3N2GA 3ABTA 1XQ8A 1WAZA 3AG4B 4XDKA 4JV5O 2NR5A 4WFEA 4FPPA 3HKCB 1WPXA 3CS5A 1TAEA 2KB1A 2F4VO 4X62O 3L9DA 4O4JA 1FS0G 1SQXH 4WFGA 1JFFA 4DRXB 3OEHG 1FPOA 2QWRB 1M57C 1WNSA 3ETQA 5LP6C 4JZGA 3JATA 5B66Z 2QWQB 2YIBA 4QJFB 4ZOLB 2Z5UA 3AG3C 1X4TA 2GV9A 4X62B 3JD3A 4BAYA 3BAAA 3GWOA 4I55B 3C90A 3SPCA 4DR6O 4RQEA 3SPGA 5CBHA 2WA4A 2X6AA 3AG7A 3OEEG 2QKSA 2XUMA 2KKWA 1L8DA 3N27A 4GUNA 4DW1A 3OTFA 1F51A 3OTOB 3KG2A 2QA4V 1XUQA 1NQTA 1V55B 3ETEA 1HR0O 1AJPA 3TK1A 1B04A 4TV9A 5LL6Y 3STLC 4X1YB 2R72A 4DV3O 1KKDA 4RO2A 1N0JA 4JYBA 1HNXB 2DWEC 2BTQA 3L75H 4PJ0Z 1FXKB 1PNMA 1SS3A 3ABLC 1NT2B 3B8MA 4O4HA 3RWRD 2EIMB 2EZOA 3ASOB 3FB8C 4EKWA 5LGTA 1OCCB 1QVGU 2HJDA 2UXXA 3FYIB 4DV7B 2P6JA 4J7JA 1OCRB 1Z2GA 4LFAO 4DR4B 3LSQA 3RYHB 1ORQC 4BWAA 5FNVA 4DK1A 1DF4A 2EIKB 1PPJH 2CTWA 3WG7B 2JEUA 1QNMA 3ABUA 2CH7A 3HKEB 2LGWA 2QR4A 1Y66A 2YXHA 1SERA 2VWKA 3RYCA 1QU7A 1MSWD 3ZMSA 3LDDA 2JGDB 1TVKA 2XHBA 1LR1A 3OM3B 4K8ZA 3F7YC 3K3WA 1XREA 4PA6A 2F66C 4GYCB 1TGOA 4DR5O 1EN6A 1THZA 2GHYA 4DR3O 2XOKG 2PY5A 3K79A 4DYLA 1B6QA 2DYSB 1W59A 3CE2A 1Q86W 1NVPD 1R1BA 3ZS8C 4HYOA 3CC2V 2HEPA 5LOVB 2ARHA 4DR5B 1PP9H 4F6RA 4JAUA 1US6A 4X1IA 1SQFA 4UVBA 4B3RB 1R6KA 4LF6B 2RMKB 1HNWB 2WA3A 4FMTA 3CWBH 5BR8B 4JV5B 3RYIA 4HNAB 5KHHA 2WLIA 3T2MA 4DV1O 3LSSA 2M6YA 4QPJA 3A0RA 2JRIA 1S5LZ 1H2KA 1P49A 1KUQA 1XNRO 1K4CC 2JS5A 1R3JC 5CN0A 3ZCCA 3WB0A 2ZXWC 3UM7A 3K5OA 4EFEA 5B1OA 1UPGA 4OXSA 5B3SC 4DV1B 4PV1B 1YF2A 1XMQB 1L0NH 3U10A 5EC2C 3Q4HB 4R6ZA 1VQ9V 4BIZA 3CCLV 4JI6B 5ITZB 5B1AB 2A0LA 2CK3G 4UV9A 3N2KB 2QM8A 1H2SB 1MSDA 3LDCA 2EULA 2UU9B 5IDJA 1I0HA 1BSMA 4DV5B 3QNEA 3QO7A 3OGIB 4UV8A 1R3LC 5LA6B 2HKOA 4JGSA 5LMUO 1EBOA 1K5SA 1VMGA 4DV4O 3FB7C 3OUSA 1KBHA 5C8YA 3HB3B 3QO5A 4H37A 3UO3A 4PDMA 4YJ3A 2MK3A 2ATKC 1UJWB 1VQ5V 1O9GA 5CBGA 1FKAO 4Z2WA 4JTAB 3ZBHA 1G6UA 3CXCU 2EIJC 3F5WC 3DSQA 3ASNC 3ZRXA 1VQ6V 3SDLA 4DV2B 4DR7B 1KECA 1FFTB 3GWKC 4L87A 3D36C 2VQFO 2YSUB 5CA1B 2XT9A 2IH3C 1QCEA 2QWPB 1URFA 4O4HB 2PYJA 2IJKA 3BFRA 1G8MA 2IU3A 2QWOB 1SQBH 3TXSA 2ZR2A 4J80A 2OIEA 1VF7A 3BRCA 1SC5B 3E8BA 3QTCA 2LQTA 3FAVA 2DE0X 3U11A 2JJ1G 4JZ2A 1DGSA 1BE3H 3KCYA 2VRZA 3I56V 1YXBA 3JAWB 3K0GA 3IC7A 2ZE8A 5CBFA 3AG2C 4RUFA 2PGGA 4UB8Z 1XDCA 1IVSA 5KX5A 5IWAB 4KFMA 1D5NA 1NVPB 1K34A 3JD2A 4TWKA 4DW0A 1SQVH 1CEZA 5J2UB 3WU2Z 2CTPA 1VF6A 2ZQMA 5DECA 3H1KH 2D2CB 2QWNB 2G38A 1NTMH 4FLTA 2Q0OC 5LXTB 4NXMB 3OUFA 4HNAA 3BABA 4H13B 2RCVA 1GMGA 2DN9A 3SYCA 3T1CA 4CS2A 3FFQA 4N23A 5JJEB 4YHHB 3HKCA 1S5HC 4O4IA 3L73H 3ZMTA 4EEQA 4GKJO 1E1QG 2B9ZA 4CZZA 4I4TA 5LBQA 1YEWA 5H9CA 2VS0A 1HP8A 1V55C 4X88A 1IXMA 3CPWU 1JQ0A 1BL8A 2UXNA 1H2LA 3SYOA 2ZNIA 2ITCC 4NXNB 1E79G 4TUYA 3D8CA 2Y69B 4B7KA 5JH7B 4K3AA 5IT9N 1JX9A 3B4SA 2N05A 3ZRWB 3H9VA 2V1DA 3P3PA 1FXKC 1GKFA 4Q20A 2KG7A 4AI8A 2ZIMA 5B1BB 2OIGA 3NXSA 1AR4A 2AW9A 2EIMC 4X8AA 1K73W 3CC7V 1RSOB 3ASOC 2EBOA 4JI1B 1P84F 4PD4F 1OCCC 1VQLV 5C8YB 4MVOA 5K1PA 5LHIA 4A5UB 4DV6O 1G1XB 3ZMVA 1AI6A 2AXTZ 2FTKA 2CGNA 2YICA 3E8FA 4PHZA 3E89A 2IW5A 2AHYA 1YITV 1N4CA 4UCTA 5J2TB 2EIKC 3E2EA 1YTFB 2OT5A 3E8HA 4X1YA 5BY1A 1HWYA 2Q6AA 1WA8A 2C2AA 1KMIZ 3BA9A 4LF8O 3F5TA 4R8CA 4ZI7B 4DV0O 3APQA 3S3XA 4IHJA 4Q6GA 3UKMA 2QSAA 2JJ2G 3RYHA 3G80A 5B1NA 3CMAV 4CBCA 3AG1B 1YDXA 3K0DA 1G4YB 1VQKV 1K3EA 4NXNO 1QVFU 4EFBA 1MA1A 3CHXA 2P4VA 1XMOB 3AG4C 3APOA 1HR0B 2RN9A 1L1FA 3G4SV 1QLEC 1K33A 2IJIA 4DR4O 1IDSA 1I7FA 2AZ2A 5LYJA 1BS3A 2VQEO 4OPAA 3CX5F 1R3KC 4UCVA 5KX5B 5FPOA 3UT5A 2GSMB 4JF3A 2LW1A 2GTAA 2OCCB 4FFKA 2IH1C 1TUBA 3BHPA 5EZYB 5F2VO 1WJZA 4J7ZA 3T1YB 1YIJV 1V9PA 4B3SO 2M7WA 5IYBO 2ZE6A 1Q90D 1OZ0A 1GN2A 2ZXWB 1QHTA 1WPBA 1L0LH 2BOCC 2IM9A 3DTUB 3L70H 1WN7A 5IJ9A 3GVMA 4CC6A 1JCHA 4R50A 3SGIA 4KXRA 4X20B 4P30A 4WFBV 3OMAB 1F4MA 1DTOA 4UUJC 1GN6A 3OR7C 4DO2A 1GTOA 4TQFA 2QKAA 2BSKA 4JI4B 3E83A 1GM9A 4O2BB 5CA0B 1YI2V 3ETGA 2YIBD 3RYCB 1A32A 2YIAA 2GUZA 4EB6B 1YHQV 4WFHA 1M1KW 3QF7A 3JAMN 2CDYA 3TCUA 1S72V 2EX3A 3MAQA 3CCJV 3ABLB 1IZ3A 2OCHA 3RT3C 4UCRA 1GRJA 3CCUV 4WCEV 1SF9A 2QTSA 1XILA 1I08A 1MZFA 1AILA 4JYYA 4X65O 1FJGO 3H1JH 4FFBB 4IIJA 2BCCH 4JTCB 2E3CA 1OCRC 1AP6A 2WLIB 2MW2B 4J7KA 4XDJA 4MTGA 3ZEDA 4LF8B 3JATB 5DEDA 2IBZH 4JI6O 5KUMA 4O2AA 3FB5C 3ASNB 3RN4A 4QGPA 3FD9A 4DR2B 4U7NA 1YSCA 1GN3A 3L72H 4MTOA 2PI4A 4FIPC 1AB3A 2WLHA 1QQCA 3K08A 4HAMA 3ZRWA 2KG7B 2DQ0A 2WLKA 5BXZA 4CH3A 3Q4HA 4LFCB 4PELA 5LXTA 1XNRB 3W7XA 1XNQO 2Y48A 5GTHZ 3A0BZ 3OE7G 1Q6HA 3RW0A 1BGYH 5LMNB 2HJFC 5LMUB 4UCSA 1OJHA 2IJHA 4YJ2B 1AJQA 1ZTEA 3MD0A 3C3TA 2Q68A 3SPHA 4UVAA 4GZRB 1Y74A 4E2LA 4ZOLA 1TA8A 2KQXA 2IJJA 3OW2U 2UUBB 4GCZA 2ZE5A 1IURA 5JJJB 3K5LA 3L74H 3SPIA 4X66B 1OCOC 2HR3A 2E75B 4QNHB 1J95A 3C3SA 4JI8O 3OMNB 5JVDB 4DUZB 2PYLA 1PL0A 2PI5A 4TUYB 3HKBA 4DV2O 4NB5A 4WF9V 4MVQA 1BHBA 2JGUA 1VQ4V 2ITDC 3RYFA 3EHBB 3SYPA 1N34B 2AHZA 1XL6A 3CCMV 1CPYA 2B1IA 4J9YB 2Y0PA 3ZRSA 1H8EG 2B1GA 2UXBB 1K4DC 2XNDG 4J41A 5FL7G 3DC6A 4JASA 4NXMO 5B1AC 4I7ZB 1YJWV 3KZIZ 3ICXA 2W0XA 5FNVB 4AQYO 2FB5A 3B09A 1V54C 1Q8IA 4JYAO 1R73A 4YY3B 4UXNA 3UT5B 2JK5C 3A0HZ 1O9HA 4JI3B 1S3JA 2Q9LA 4DV5O 1E1RG 3ZHRA 1ZLZA 4QPKA 4X64O 1HNZB 2ZM6O 2DYRB 5KMGB 5LGNA 4I0XB 3CCEV 3CMEV 5J2UA 1BHAA 5IYZA 2Z0AA 3K9SA 2F23A 4GX1A 2PUSA 3G6EV 3CCSV 4D7TA 3ZN0A 5A2QN 1MMMA 2HFEC 3BPZA 3IJ4A 1Z5VA 3BCCH 3CJHA 4NR1A 3SR2C 2ETNA 1D5AA 3ABMB 1F4NA 4GT1A 3ZMZA 2Q5ZA 4OGQB 2Q67A 5B1BC 4I9WA 1IBLO 4X9QA 4MW3A 4LF6O 3CRQA 2XTAA 4X1IB 1MOFA 2OWOA 3LDEA 2A9HA 3BVOA 1OCZB 1IBKB 3M8AA 3RVZA 5FLXN 3TXQA 3QG5A 4ABMA 2P22C 2EINB 4LF4O 3WB1A 3AK3A 5L3CA 2L35A 2DWDC 5HFLA 4JI0B 3AK2A 1RFYA 4K8XA 3PJSK 5GONB 2EILC 2Q8VA 2Q7GA 1AI5A 3A2FA 1D2DA 5EBMC 1YJ9V 4PA9A 5E1AC 1I5XA 3K06A 4Z1VA 4FFBA 4IIJB 2F43G 4I4TB 2Q7HA 3X2QC 2ILMA 3JD1A 2LW7A 4LF9B 4JI5B 5KAFZ 1HNZO 4LH6A 2WLLB 3O65A 3S3WA 4WFFA 1MG1A 4DV3B 3K57A 2LGQA 3ZHQA 1XI1A 2DOSA 4I50B 5LHGA 4GX2A 1FXVA 1N36O 1WA8B 2W0FC 1IBMO 3IGAC 1SA0B 1IXBA 3DC5A 1K7DA 4LF9O 2PTMA 4GLXA 1K5QA 2N74A 2Y4UA 1JPXA 4RUEA 2JEXA 2OYQA 4IL6Z 1PKXA 4YJ3B 3WB2A 4DK0A 2A79B 5IY5C 4I5SA 3LNNA 3QVNA 3R66A 1DF5A 1CP9A 5J2TA 2H94A 2ZKOA 3RYFB 4DR1B 1SQQH 5CA1A 2DW4A 3E8GA 2V4DA 3JSLA 1IBKO 4FZ0A 2Q4PA 1ZSPA 2OCCC 4YIPA 2Q73A 5IYDO 1BCCH 3HKBB 2XAQA 1MZEA 1XMQO 3JD0A 1SRYA 2Y4TA 5KHIA 5H2FZ 5DM6V 3W7UA 2XAGA 5JCOC 1M9NA 2ADQB 4JYCA 1J5EB 3CXHF 5JVDA 4LR3A 4H0LB 2EZPA 1ENVA 1SESA 3T1HB 2ZDIC 1VQ7V 1XMOO 3OMIB 1K8AW 1BZKA 3MHSC 4PA4A 2Q0AA 3TJTA 1IBMB 4LF7B 2BTOA 2P5OA 3VQXA 4JI7O 3CYOA 4J10A 3FX7A 1WLEA 1VQNV 4JAAA 3T1HO 5LA6A 4HBNA 2UUAB 3GB7C 3HKEA 3FAVB 5CMUA 3JD4A 3DXRA 3T1YO 4J11A 4MTXA 4RAIA 2Q69A 4J42A 2QEXV 5LYJB 3B8NA 2YC0A 3AEIA 4JI2O 4NTXA 1VARA 1WP8A 3JCZA 3ZX6A 2HVKC 2YDEA 4C7UA 4DV4B 3W7TA 4GKKB 2RQ6A 4LCUC 5D5QA 4DUYB 1OV9A 4F6EA 4DR6B 2P67A 1KP3A 1VQ8V 2QM4A 4PDRA 4CH4A 3TGUH 4MVSA 5AG2A 1AVMA 5EZYA 4G27B 2V7QG 4LNUB 1EZVH 4U3JB 1KQSU 3SYAA 2QJ1A 1TUEB 3JAKB 1ZX3A 1NR7A 4L8JA 2E5LO 4LP8A 2UU9O 1X59A 1PV0A 4I50A 1H8HG 1VIBA 4FLZA 3OR6C 1R6NA 3H1LH 1S76D 1SETA 1SQGA 5KAIZ 5GW7A 3ZN1A 1W0JG 3ML0A 1QLEB 2UXDO 2A06H 2WWWA 4O4LB 4FM1A 1RM1B 4YXWG 5GONA 1IBLB 2DQ3A 3CB2A 3CJHB 4CS3A 4IYIA 3N2KA 4NTYA 3JAKA 4MS2A 1YJNV 2ZCEA 4FJCC 4DUZO 1M56B 2CUGA 1IX9A 4BW5A 1P7BA 3OD4A 1GO3F 4FLWA 2HG5C 1JJ2U 4ASUG 1Q6IA 1XHZA 1XEQA 3VQYA 3QO8A 1K97A 4X1KA 3D36A 1ZWIC 1N32O 1AROP 1K9MW 2QTOA 4FM0A 4PI2A 2E5LB 3RYIB 1M4UA 5E79Z 2ZINA 2A7WA 4UCUA 1KKCA 2A3QA 3CRAA 3H1IH 3JASB 4LFCO 1PL4A 4QE9A 3G71V 2DYRC 3DGEA 1GM7A 5EBLC 1Q7YW 5L3EA 5LMNO 5JH7A 3SPJA 4LF5O 3STZC 1HNWO 2F1MA 4KHPB 2RDCA 3THOA 2UXCO 2LO1A 2YI9A 3UO2A 4CH5A 1Y74B 5BZBA 2PZSA 1HW7A 1PNKA 3SJCC 4D7SA 1VQPV 5KUKA 5BMVA 3ABMC 1NR1A 1GM8A 3R65A 3FKSG 5EK0A 4MW8A 2VQFB 1EFRG 4GX0A 2EJ7A 1FXHA 2QE7G 4ZIBA 4B08A 3JSNA 4W4KA 1FD9A 3T4ZA 5L3DA 3OGCC 4GKKO 1AI7A 1OCZC 3JAWA 4YIOA 1QR9A 5EYPB 1Y4MA 3CCVV 5J9PC 1YZBA 4LWSB 3K03A 1WB7A 4W4LA 2CGOA 4K0KB 3I55V 2XASA 4U7OA 4ZHQA 4JI0O 1CXZB 5KA5A 3P3NA 4LF7O 5A9GA 4H44B 1AJNA 4GKJB 1KC8W 4QIWF 3JALA 4UVCA 3X2QB 4DXWA 2CE4A 2D3OW 3LUTB 1S0VA 4K0KO 4TV8B 2ZDIA 4MVMA 5JQGB 4KUMA 1WP7A 4O4IB 4CC5A 2FYUH 2XAHA 4TSFG 5IYZB 4JTDB 4JI4O 1DLBA 2BTQB 3CEIA 3UCSC 1OCOB 1SZXA 2CH7B 4JAVA 2NLJC 4QE7A 1H2GA 2JDIG 5LP6A 1NZ6A 4TV9B 3ABKC 1TUBB 2WSSG 2UXDB 4DR2O 4EB6A 2F4VB 1ZL8B 4LF4B 2FKXA 4UFZA 5IY5B 4NTWA 1AI4A 4G28B 3ZJZA 3P30A 5LOVA 3A8TA 1T5EA 3SJQC 4LWSA 3KKYA 1LUWA 1I5YA 2GUZB 3MDSA 1M57B 4DV6B 4WBNA 3H01A 4LH7A 2ZD9A 1H2NA 4HZ3A 2O57A 3AG3B 1GAXA 3BY6A 2UUCO 1Y6XA 3SYQA 4GX5A 4CH6A 4O4LA 2P7TC 1V54B 3I5DA 1JVMA 5KA6A 1N36B 2R9IA 1MABG 3K5NA 4MSWC 5LHHA 3SJAC 1HDJA 1JFFB 2VWJA 1PD3A 2YEVB 2YI8A 4WFAV 3RFRA 3D3QA 2Z3YA 2DJVA 5H5NA 1B3QA 2P06A 1N0NA 3ZHSA 3JARA 3VQWA 5IWAO 3JCUZ 5K1XA 1GK9A 1RP3B 1FJGB 2YS8A 2WLMA 4X66O 2F95B 1JOYA 2BE3A 4NVPA 4LF5B 1I94B 3M7MX 1Q82W 1GN4A 3W7SA 5BMVB 3CD6V 1RSOA 1ZAUA 4O4JB 4IYHA 3BA8A 1JJOA 4F6RB 1JR9A 2VQEB 1VF5B 2EINC 4DUYO 4TT3G 4ZI7A 4B3RO 1SA0A 3CCRV 4OX9B 1NJIW 2UUCB 3OTOO 3ZHVA 1FYJA 4JI1O 1XNQB 2EILB 3WG7C 2YEVA 1BQZA 1DK1A 2R9AA 4DR1O 2FL4A 1KU9A 2NNUA 4OPHA 4PA7A 3K04A 5EIBC 4TV8A 5KLVH 2E74B 2GBOA 1NKDA 1NU1H 4KP4A 2GDSA 1VEWA 2AZ0A 4JI5O 3JARB 1SKVA 5IJ0A 4AQYB 2ZT9B 4RQFA 2OTLV 3F7VC 2W6JG 1XHXA 1N32B 2WLNA 5KMGA 3E86A 4ICGA 4LFBO 5TISZ 1FAFA 3M99B 1YVWA 4JI3O 4FLXA 1VQMV 3FB6C 3H1HH 1NS1A 3CRRA 2K9PA 3JASA 2DMXA 1NTZH 1Y67A 2CTRA 5EBWC 4ZHQB 4B7EA 1XBLA 2WPDG 4LBEC 1Q43A 3K59A 4X20A 5BR8O 1I94O 4ZKIA 2Y0IA 1LNQA 3B2EE 3EXAA 4F4LA 1FFXA 4I55A 2QGNA 4PA3A 5L3BA 2HLDG 5LP6B 5IJ0B 1B06A 3J81N 3MHHC 2HP8A 5L3GA 3L71H 1H38A 3IAYA 1VQOV 2LJ2A 4G2KA 1XOUA 5JCOA 4CS4A 4J9ZB 1PM9A 1EZJA 1N33B 4JI2B 3VBBA 4MTFA 2YXLA 2OTJV 3E22A 3JALB 4AILC 2EJRA 4I9QA 4JYAB 3B40A 5B3SB 5FPRA 1F23A 4DV0B 2X7RB 2ZNJA 4BW9A 2E76B 1NTKH 1Z5WA 3K58A 2R9RB 4LNUA 1R6TA 2GTSA 1PNLA 5EYPA 1NI8A 5H6RA 1Q81W 1GH6A 3B77A 4B3MO 5CB4A 2B5UA 2AGAA 2BSKB 1HNXO 3N2GB 2JS3A 3J80N 2P90A 1LUVA 3E35A 3KCXA 4P2ZA 2LP7A 1H2MA 5JQGA 4PI0A 3ZMUA 2YUAA 2JGDA 2QKCA 3ZRVA 4WBNB 1W0KG 1TVKB 5IE9A 2FMLA 5HFMA 3CRMA 2PF4E 3ETDA 5JWPA 1P7GA 1RPRA 4DV7O 1Y76A 2H8PC 2ZM6B 3ZHUA 2HHHB 2ZR3A 3ZHTA 4U3FH 1MNGA 3OFNG 1YCIA 2LFRA 3IFXA 2HVJC 1WB8A 4PDLA 2UXBO 1AR5A 4B3SB 1M90W 3VOUA 1KB9F 4P9PA 2IU0A 4IT5A 5GTIZ 4UB6Z 4MVRA 2W6IG 2CAZC 3VQVA 5D5PA 4N21A 2ADPA 1KYOF 1R3IC 1K92A 1N8RW 1BT8A 4MT8A 2JIZG 3U0ZA 4IHJB 1NH2B 2X6BA 4JPRA 1FXKA 1XL4A 1U97A 3J7AU 3RGBA 2UXCB 2KSDA 3T4DA 3CCQV 2JVDA 4DR3B 3OT7A 4XDLA 4E4EA 1QBZA 2DYSC 1Y76B 4JI8B 2R70A 4X64B 3G6BA 1RM1C 3RVYA 4YJ2A 4X65B 1NH2D 1N33O 4R7CA 4KL1A 1EN4A 1Q5OA 2HHHO 3SJBC 1U96A 1M56C 1BMFG 4X1KB 4DRXA 4KHPO 1ZUQA 1ROPA 4OX9O 5ITZA 4D6TH 4LFAB 1ZL8A 2NN4A 1EM1A 1COWG 4B3MB 4U3JA 3HKDB 1J5EO 2YXYA 3BEHA 5JJNB 3HPLC 4FK5C 1UFIA 4PDVA 5H6QA 3LNMB 2CTQA 1N34O 4O2BA 4B3TB 1BQ0A 2ODMA 1S5JA 4ZBMA 3DXRB 3JYCA 4DR7O 2L6LA 2WAMA 1OHHG 1VP7A 4BIUA 3FYEB 4FM2A 5KHGA 5LGUA 4NYKA 1AP5A 4K35A 1EN5A 1M5IA 4H33A 4UCOA 2UUAO 3LSUA 3W7WA 4BR6A 1NBMG 3HKDA 4I0XA 3D3IA 2UUBO 4YY3O 3PN1A 1M93A 4NKGB 3RBZA 4FLVA 2XAJA 4XBFA 2Y69C 1KP2A 4FLYA 3EVKA 5EC1C 2ZIOA 3OAAG 2YIDA 1JMKC 2BOBC 3ZIAG 4TQDA 5KHKA 3G67A 1JA8A 3K5MA 2EIJB 1Q6UA 4AHCA 2P4KA 1QLNA 1AR1B 3HR0A 4TOIA 4FVMA 5IJ9B 2QDOA 2XAFA 4FLUA 2H3OA 1SZTA 1FFXB 2F93B 3P32A 3CC4V 4P9OA 3K9AA 4B3TO 1SQPH 4MVUA 3AK1A 3WFVA 5CA0A 2X6CA 5DN6G
chains in the Genus database with same CATH topology
5E1AC 1I5XA 1S5HC 1JVMA 3ZMTA 5KA6A 3K06A 5L3FA 2R9IA 1MABG 2F43G 1E1QG 2X0LA 3X2QC 5CA3A 4CZZA 3JD1A 5C93A 4MSWC 4LC1A 5LBQA 5LHHA 4X89A 2WLLB 5H9CA 3EFFK 1MG1A 1PD3A 2WLJA 2YEVB 1V55C 4MVZA 4WFFA 4X88A 1IXMA 2WLLA 1KD1W 4WFAV 1RPOA 3CPWU 1JQ0A 1BL8A 2UXNA 1W2BU 2Z3YA 5LHGA 3SYOA 2LFSA 1FXVA 4GX2A 2ITCC 3CP1A 2W0FC 1S77D 3AG2B 3IGAC 1YTFD 1P4RA 1E79G 2QM7A 4Z1MG 1K7DA 3AG1C 2Y69B 1JX9A 3TETA 3ZRWB 1QR8A 2K1EA 3ABKB 1K5QA 1GK9A 1JPXA 2JEXA 4RUEA 2V1DA 1FXKC 1GKFA 3ABTA 4Q20A 4XDKA 3AG4B 4WFEA 2WLMA 4FPPA 1PKXA 1JOYA 2A79B 1WPXA 5IY5C 5B1BB 4I5SA 3NXSA 2KB1A 2EIMC 1DF5A 4X8AA 1Q82W 3CC7V 1K73W 3ASOC 2EBOA 3W7SA 1CP9A 3CD6V 2H94A 1FS0G 1OCCC 1VQLV 4WFGA 4MVOA 3OEHG 5LHIA 2DW4A 1M57C 3ZMVA 3E8GA 1AI6A 2OCCC 5IYDO 2EINC 2FTKA 3E8FA 4QJFB 3E89A 4TT3G 2Z5UA 2IW5A 2AHYA 2XAQA 3CCRV 3AG3C 1YITV 3JD0A 1NJIW 1SRYA 3JD3A 4BAYA 3GWOA 2EIKC 2EILB 3WG7C 2YEVA 5DM6V 3W7UA 3SPCA 1YTFB 3E2EA 2OT5A 2XAGA 3E8HA 4RQEA 3SPGA 5CBHA 1M9NA 2X6AA 3OEEG 4JYCA 1HWYA 2NNUA 2Q6AA 2QKSA 2C2AA 4PA7A 3K04A 2EZPA 1ENVA 1SESA 4R8CA 1F51A 2QA4V 3KG2A 1NKDA 2ZDIC 4KP4A 1NQTA 1V55B 3ETEA 1VQ7V 3OMIB 1K8AW 3MHSC 4PA4A 1AJPA 3TK1A 3UKMA 4RQFA 2OTLV 3STLC 3F7VC 1KKDA 3CYOA 2JJ2G 1WLEA 2W6JG 4RO2A 1VQNV 2WLNA 5B1NA 3E86A 3CMAV 4CBCA 3AG1B 4JYBA 3M99B 3K0DA 1G4YB 2DWEC 1VQKV 1K3EA 3GB7C 1VQMV 1QVFU 1FXKB 3FB6C 1PNMA 3AG4C 3ABLC 3B8MA 1L1FA 3G4SV 1QLEC 1K33A 2IJIA 5EBWC 5CMUA 3JD4A 2EIMB 2EZOA 3ASOB 3FB8C 4MTXA 4RAIA 4EKWA 2WPDG 4LBEC 2Q69A 5LGTA 1OCCB 1QVGU 2QEXV 3B8NA 4ZKIA 1LNQA 3AEIA 4F4LA 2UXXA 3FYIB 4PA3A 2P6JA 1R3KC 5L3BA 2HLDG 2GSMB 3JCZA 4JF3A 2OCCB 2HVKC 1OCRB 3MHHC 2IH1C 5L3GA 3W7TA 1H38A 4LCUC 1VQOV 3LSQA 4G2KA 1ORQC 1YIJV 4J9ZB 1DF4A 2EIKB 1EZJA 2P67A 1KP3A 4MTFA 2JEUA 3VBBA 3WG7B 2M7WA 5IYBO 3ABUA 2OTJV 1OZ0A 2ZXWB 1VQ8V 4PDRA 2EJRA 4MVSA 1Y66A 2BOCC 1SERA 3DTUB 5B3SB 1F23A 2X7RB 4G27B 1MSWD 2V7QG 3ZMSA 1JCHA 3LDDA 4R50A 2R9RB 1KQSU 3SYAA 1PNLA 3OM3B 4P30A 1TUEB 4WFBV 3OMAB 1F4MA 5H6RA 1Q81W 1DTOA 4UUJC 3F7YC 1NR7A 3K3WA 3OR7C 3B77A 4DO2A 1GTOA 2B5UA 4PA6A 3E83A 1GM9A 4LP8A 1YI2V 2P90A 3E35A 3ETGA 4P2ZA 1THZA 2GHYA 2LP7A 1H8HG 2XOKG 1YHQV 3OR6C 1R6NA 3ZMUA 4WFHA 1M1KW 3ZRVA 1S76D 1SETA 3K79A 1B6QA 3TCUA 1W0KG 2DYSB 1S72V 3CCJV 3ABLB 5GW7A 3ZN1A 1Q86W 1NVPD 1W0JG 3ML0A 3CC2V 1QLEB 4HYOA 5HFMA 2WWWA 1RM1B 4JAUA 4YXWG 4UVBA 1R6KA 3CCUV 2DQ3A 4WCEV 3ETDA 1RPRA 4FMTA 2H8PC 4JTCB 2WLIA 4MS2A 3T2MA 1YJNV 1OCRC 2ZR3A 3LSSA 4FJCC 2WLIB 4QPJA 4XDJA 1M56B 3A0RA 4MTGA 3OFNG 4BW5A 1P7BA 2LFRA 3IFXA 1K4CC 2HVJC 1GO3F 4PDLA 5KUMA 3FB5C 1R3JC 2HG5C 5CN0A 1JJ2U 4ASUG 3ASNB 3ZCCA 1M90W 2ZXWC 4U7NA 3UM7A 1YSCA 3VOUA 5B1OA 4MTOA 4OXSA 2PI4A 4FIPC 3QO8A 4P9PA 5B3SC 2WLHA 1K97A 3K08A 3D36A 4HAMA 2IU0A 1ZWIC 3ZRWA 5EC2C 2DQ0A 1AROP 2WLKA 1K9MW 4R6ZA 4MVRA 2QTOA 2W6IG 1VQ9V 4PELA 4BIZA 3CCLV 3W7XA 5B1AB 4N21A 2A0LA 1R3IC 2CK3G 2Y48A 4UV9A 1K92A 3OE7G 1N8RW 2QM8A 4MT8A 3RW0A 3LDCA 2JIZG 2HJFC 1NH2B 2X6BA 4JPRA 1FXKA 1XL4A 2IJHA 5IDJA 1AJQA 3MD0A 3QNEA 3QO7A 2Q68A 3SPHA 3T4DA 4UVAA 3CCQV 4XDLA 4UV8A 4QE9A 3G71V 4E2LA 1QBZA 1R3LC 2DYSC 2IJJA 3OW2U 2HKOA 4JGSA 4GCZA 2DYRC 3DGEA 1GM7A 1EBOA 1K5SA 5EBLC 1Q7YW 5L3EA 3FB7C 1RM1C 3SPJA 3SPIA 3OUSA 3STZC 3RVYA 1OCOC 2HR3A 4QNHB 3HB3B 1J95A 3QO5A 1NH2D 4H37A 4PDMA 2MK3A 2ATKC 1UJWB 4R7CA 5BZBA 1VQ5V 3OMNB 1PNKA 1PL0A 2PI5A 5CBGA 1VQPV 5KUKA 3ABMC 1M56C 4JTAB 1NR1A 4WF9V 1GM8A 4MVQA 1BMFG 1BHBA 3R65A 3FKSG 1VQ4V 5EK0A 2ITDC 3EHBB 4MW8A 3SYPA 3CXCU 1EFRG 4GX0A 2EIJC 1FXHA 2AHZA 2QE7G 3F5WC 1XL6A 3CCMV 1ROPA 3ASNC 1CPYA 3ZRXA 1VQ6V 3T4ZA 5L3DA 2B1IA 4J9YB 3OGCC 1COWG 1FFTB 1AI7A 1KECA 1OCZC 3ZRSA 1H8EG 2B1GA 1K4DC 1QR9A 1Y4MA 3BEHA 3CCVV 5J9PC 4L87A 3HPLC 2XNDG 2YSUB 5FL7G 4FK5C 4PDVA 4JASA 5H6QA 3LNMB 3K03A 4ZBMA 2IH3C 1QCEA 5B1AC 3I55V 2XASA 1YJWV 3JYCA 4U7OA 2IJKA 2WAMA 1OHHG 1G8MA 2IU3A 5KA5A 4BIUA 1V54C 3FYEB 2ZR2A 1AJNA 5LGUA 1KC8W 1R73A 4QIWF 4UXNA 2JK5C 3E8BA 4UVCA 3X2QB 4DXWA 4H33A 1S3JA 2D3OW 1E1RG 3LUTB 1S0VA 4QPKA 2JJ1G 2ZDIA 4MVMA 2DYRB 4KUMA 5LGNA 3W7WA 3I56V 2XAHA 4TSFG 1NBMG 3CCEV 5DN6G 3K0GA 4JTDB 3CMEV 3D3IA 1DLBA 3IC7A 1BHAA 5CBFA 1OCOB 3AG2C 4RUFA 4JAVA 4GX1A 2NLJC 3RBZA 4QE7A 3G6EV 1H2GA 2JDIG 2XAJA 4XBFA 3CCSV 2Y69C 1KP2A 3ZN0A 4KFMA 3ABKC 2WSSG 2HFEC 5EC1C 3OAAG 1NVPB 5IYCO 1K34A 3ABMB 3JD2A 4TWKA 1F4NA 2BOBC 3ZIAG 4GT1A 3ZMZA 1CEZA 5IY5B 5B1BC 2Q67A 4I9WA 1AI4A 4G28B 2EIJB 3ZJZA 3P30A 4MW3A 2ZQMA 3SJQC 1MOFA 1QLNA 1AR1B 3LDEA 2A9HA 1I5YA 1OCZB 1M57B 2XAFA 3RVZA 3H01A 3OUFA 2ZD9A 2EINB 1SZTA 4HZ3A 3P32A 1GMGA 3CC4V 3SYCA 5L3CA 3T1CA 3AG3B 4P9OA 3K9AA 2DWDC 3BY6A 5HFLA 3PJSK 4MVUA 3SYQA 2EILC 4GX5A 1AI5A 4N23A 3WFVA 2X6CA 5EBMC 2P7TC 1V54B 1YJ9V 4PA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK A;  2ZDI A;  2ZQM A;  3AEI A;  1FXK C;  1FXK B;  2ZDI C; 
#chains in the Genus database with same CATH topology
 5L3F A;  3O9O A;  1Q3E A;  1VF6 C;  4IGG A;  2X0L A;  5B5E Z;  5CA3 A;  5C93 A;  4LC1 A;  3IC9 A;  4X89 A;  3E22 B;  3EFF K;  4MVZ A;  2WLJ A;  5IYC O;  1KD1 W;  3CRC A;  2WLL A;  4JI7 B;  1RPO A;  1F7Y A;  1W2B U;  3NR7 A;  2RJZ A;  4FZ1 A;  4YHH O;  4O2A B;  2LFS A;  3CP1 A;  4RWU A;  1S77 D;  3AG2 B;  1YTF D;  2RNB A;  2Q7E A;  3CSX A;  3UQ8 A;  1P4R A;  2QM7 A;  4Z1M G;  4BIO A;  2ZE7 A;  5KHJ A;  2N04 A;  3AG1 C;  5CB4 B;  3TET A;  4LFB B;  5EIB D;  1QR8 A;  2K1E A;  3ABK B;  3N2G A;  3ABT A;  1XQ8 A;  1WAZ A;  3AG4 B;  4XDK A;  4JV5 O;  2NR5 A;  4WFE A;  4FPP A;  3HKC B;  1WPX A;  3CS5 A;  1TAE A;  2KB1 A;  2F4V O;  4X62 O;  3L9D A;  4O4J A;  1FS0 G;  1SQX H;  4WFG A;  1JFF A;  4DRX B;  3OEH G;  1FPO A;  2QWR B;  1M57 C;  1WNS A;  3ETQ A;  5LP6 C;  4JZG A;  3JAT A;  5B66 Z;  2QWQ B;  2YIB A;  4QJF B;  4ZOL B;  2Z5U A;  3AG3 C;  1X4T A;  2GV9 A;  4X62 B;  3JD3 A;  4BAY A;  3BAA A;  3GWO A;  4I55 B;  3C90 A;  3SPC A;  4DR6 O;  4RQE A;  3SPG A;  5CBH A;  2WA4 A;  2X6A A;  3AG7 A;  3OEE G;  2QKS A;  2XUM A;  2KKW A;  1L8D A;  3N27 A;  4GUN A;  4DW1 A;  3OTF A;  1F51 A;  3OTO B;  3KG2 A;  2QA4 V;  1XUQ A;  1NQT A;  1V55 B;  3ETE A;  1HR0 O;  1AJP A;  3TK1 A;  1B04 A;  4TV9 A;  5LL6 Y;  3STL C;  4X1Y B;  2R72 A;  4DV3 O;  1KKD A;  4RO2 A;  1N0J A;  4JYB A;  1HNX B;  2DWE C;  2BTQ A;  3L75 H;  4PJ0 Z;  1FXK B;  1PNM A;  1SS3 A;  3ABL C;  1NT2 B;  3B8M A;  4O4H A;  3RWR D;  2EIM B;  2EZO A;  3ASO B;  3FB8 C;  4EKW A;  5LGT A;  1OCC B;  1QVG U;  2HJD A;  2UXX A;  3FYI B;  4DV7 B;  2P6J A;  4J7J A;  1OCR B;  1Z2G A;  4LFA O;  4DR4 B;  3LSQ A;  3RYH B;  1ORQ C;  4BWA A;  5FNV A;  4DK1 A;  1DF4 A;  2EIK B;  1PPJ H;  2CTW A;  3WG7 B;  2JEU A;  1QNM A;  3ABU A;  2CH7 A;  3HKE B;  2LGW A;  2QR4 A;  1Y66 A;  2YXH A;  1SER A;  2VWK A;  3RYC A;  1QU7 A;  1MSW D;  3ZMS A;  3LDD A;  2JGD B;  1TVK A;  2XHB A;  1LR1 A;  3OM3 B;  4K8Z A;  3F7Y C;  3K3W A;  1XRE A;  4PA6 A;  2F66 C;  4GYC B;  1TGO A;  4DR5 O;  1EN6 A;  1THZ A;  2GHY A;  4DR3 O;  2XOK G;  2PY5 A;  3K79 A;  4DYL A;  1B6Q A;  2DYS B;  1W59 A;  3CE2 A;  1Q86 W;  1NVP D;  1R1B A;  3ZS8 C;  4HYO A;  3CC2 V;  2HEP A;  5LOV B;  2ARH A;  4DR5 B;  1PP9 H;  4F6R A;  4JAU A;  1US6 A;  4X1I A;  1SQF A;  4UVB A;  4B3R B;  1R6K A;  4LF6 B;  2RMK B;  1HNW B;  2WA3 A;  4FMT A;  3CWB H;  5BR8 B;  4JV5 B;  3RYI A;  4HNA B;  5KHH A;  2WLI A;  3T2M A;  4DV1 O;  3LSS A;  2M6Y A;  4QPJ A;  3A0R A;  2JRI A;  1S5L Z;  1H2K A;  1P49 A;  1KUQ A;  1XNR O;  1K4C C;  2JS5 A;  1R3J C;  5CN0 A;  3ZCC A;  3WB0 A;  2ZXW C;  3UM7 A;  3K5O A;  4EFE A;  5B1O A;  1UPG A;  4OXS A;  5B3S C;  4DV1 B;  4PV1 B;  1YF2 A;  1XMQ B;  1L0N H;  3U10 A;  5EC2 C;  3Q4H B;  4R6Z A;  1VQ9 V;  4BIZ A;  3CCL V;  4JI6 B;  5ITZ B;  5B1A B;  2A0L A;  2CK3 G;  4UV9 A;  3N2K B;  2QM8 A;  1H2S B;  1MSD A;  3LDC A;  2EUL A;  2UU9 B;  5IDJ A;  1I0H A;  1BSM A;  4DV5 B;  3QNE A;  3QO7 A;  3OGI B;  4UV8 A;  1R3L C;  5LA6 B;  2HKO A;  4JGS A;  5LMU O;  1EBO A;  1K5S A;  1VMG A;  4DV4 O;  3FB7 C;  3OUS A;  1KBH A;  5C8Y A;  3HB3 B;  3QO5 A;  4H37 A;  3UO3 A;  4PDM A;  4YJ3 A;  2MK3 A;  2ATK C;  1UJW B;  1VQ5 V;  1O9G A;  5CBG A;  1FKA O;  4Z2W A;  4JTA B;  3ZBH A;  1G6U A;  3CXC U;  2EIJ C;  3F5W C;  3DSQ A;  3ASN C;  3ZRX A;  1VQ6 V;  3SDL A;  4DV2 B;  4DR7 B;  1KEC A;  1FFT B;  3GWK C;  4L87 A;  3D36 C;  2VQF O;  2YSU B;  5CA1 B;  2XT9 A;  2IH3 C;  1QCE A;  2QWP B;  1URF A;  4O4H B;  2PYJ A;  2IJK A;  3BFR A;  1G8M A;  2IU3 A;  2QWO B;  1SQB H;  3TXS A;  2ZR2 A;  4J80 A;  2OIE A;  1VF7 A;  3BRC A;  1SC5 B;  3E8B A;  3QTC A;  2LQT A;  3FAV A;  2DE0 X;  3U11 A;  2JJ1 G;  4JZ2 A;  1DGS A;  1BE3 H;  3KCY A;  2VRZ A;  3I56 V;  1YXB A;  3JAW B;  3K0G A;  3IC7 A;  2ZE8 A;  5CBF A;  3AG2 C;  4RUF A;  2PGG A;  4UB8 Z;  1XDC A;  1IVS A;  5KX5 A;  5IWA B;  4KFM A;  1D5N A;  1NVP B;  1K34 A;  3JD2 A;  4TWK A;  4DW0 A;  1SQV H;  1CEZ A;  5J2U B;  3WU2 Z;  2CTP A;  1VF6 A;  2ZQM A;  5DEC A;  3H1K H;  2D2C B;  2QWN B;  2G38 A;  1NTM H;  4FLT A;  2Q0O C;  5LXT B;  4NXM B;  3OUF A;  4HNA A;  3BAB A;  4H13 B;  2RCV A;  1GMG A;  2DN9 A;  3SYC A;  3T1C A;  4CS2 A;  3FFQ A;  4N23 A;  5JJE B;  4YHH B;  3HKC A;  1S5H C;  4O4I A;  3L73 H;  3ZMT A;  4EEQ A;  4GKJ O;  1E1Q G;  2B9Z A;  4CZZ A;  4I4T A;  5LBQ A;  1YEW A;  5H9C A;  2VS0 A;  1HP8 A;  1V55 C;  4X88 A;  1IXM A;  3CPW U;  1JQ0 A;  1BL8 A;  2UXN A;  1H2L A;  3SYO A;  2ZNI A;  2ITC C;  4NXN B;  1E79 G;  4TUY A;  3D8C A;  2Y69 B;  4B7K A;  5JH7 B;  4K3A A;  5IT9 N;  1JX9 A;  3B4S A;  2N05 A;  3ZRW B;  3H9V A;  2V1D A;  3P3P A;  1FXK C;  1GKF A;  4Q20 A;  2KG7 A;  4AI8 A;  2ZIM A;  5B1B B;  2OIG A;  3NXS A;  1AR4 A;  2AW9 A;  2EIM C;  4X8A A;  1K73 W;  3CC7 V;  1RSO B;  3ASO C;  2EBO A;  4JI1 B;  1P84 F;  4PD4 F;  1OCC C;  1VQL V;  5C8Y B;  4MVO A;  5K1P A;  5LHI A;  4A5U B;  4DV6 O;  1G1X B;  3ZMV A;  1AI6 A;  2AXT Z;  2FTK A;  2CGN A;  2YIC A;  3E8F A;  4PHZ A;  3E89 A;  2IW5 A;  2AHY A;  1YIT V;  1N4C A;  4UCT A;  5J2T B;  2EIK C;  3E2E A;  1YTF B;  2OT5 A;  3E8H A;  4X1Y A;  5BY1 A;  1HWY A;  2Q6A A;  1WA8 A;  2C2A A;  1KMI Z;  3BA9 A;  4LF8 O;  3F5T A;  4R8C A;  4ZI7 B;  4DV0 O;  3APQ A;  3S3X A;  4IHJ A;  4Q6G A;  3UKM A;  2QSA A;  2JJ2 G;  3RYH A;  3G80 A;  5B1N A;  3CMA V;  4CBC A;  3AG1 B;  1YDX A;  3K0D A;  1G4Y B;  1VQK V;  1K3E A;  4NXN O;  1QVF U;  4EFB A;  1MA1 A;  3CHX A;  2P4V A;  1XMO B;  3AG4 C;  3APO A;  1HR0 B;  2RN9 A;  1L1F A;  3G4S V;  1QLE C;  1K33 A;  2IJI A;  4DR4 O;  1IDS A;  1I7F A;  2AZ2 A;  5LYJ A;  1BS3 A;  2VQE O;  4OPA A;  3CX5 F;  1R3K C;  4UCV A;  5KX5 B;  5FPO A;  3UT5 A;  2GSM B;  4JF3 A;  2LW1 A;  2GTA A;  2OCC B;  4FFK A;  2IH1 C;  1TUB A;  3BHP A;  5EZY B;  5F2V O;  1WJZ A;  4J7Z A;  3T1Y B;  1YIJ V;  1V9P A;  4B3S O;  2M7W A;  5IYB O;  2ZE6 A;  1Q90 D;  1OZ0 A;  1GN2 A;  2ZXW B;  1QHT A;  1WPB A;  1L0L H;  2BOC C;  2IM9 A;  3DTU B;  3L70 H;  1WN7 A;  5IJ9 A;  3GVM A;  4CC6 A;  1JCH A;  4R50 A;  3SGI A;  4KXR A;  4X20 B;  4P30 A;  4WFB V;  3OMA B;  1F4M A;  1DTO A;  4UUJ C;  1GN6 A;  3OR7 C;  4DO2 A;  1GTO A;  4TQF A;  2QKA A;  2BSK A;  4JI4 B;  3E83 A;  1GM9 A;  4O2B B;  5CA0 B;  1YI2 V;  3ETG A;  2YIB D;  3RYC B;  1A32 A;  2YIA A;  2GUZ A;  4EB6 B;  1YHQ V;  4WFH A;  1M1K W;  3QF7 A;  3JAM N;  2CDY A;  3TCU A;  1S72 V;  2EX3 A;  3MAQ A;  3CCJ V;  3ABL B;  1IZ3 A;  2OCH A;  3RT3 C;  4UCR A;  1GRJ A;  3CCU V;  4WCE V;  1SF9 A;  2QTS A;  1XIL A;  1I08 A;  1MZF A;  1AIL A;  4JYY A;  4X65 O;  1FJG O;  3H1J H;  4FFB B;  4IIJ A;  2BCC H;  4JTC B;  2E3C A;  1OCR C;  1AP6 A;  2WLI B;  2MW2 B;  4J7K A;  4XDJ A;  4MTG A;  3ZED A;  4LF8 B;  3JAT B;  5DED A;  2IBZ H;  4JI6 O;  5KUM A;  4O2A A;  3FB5 C;  3ASN B;  3RN4 A;  4QGP A;  3FD9 A;  4DR2 B;  4U7N A;  1YSC A;  1GN3 A;  3L72 H;  4MTO A;  2PI4 A;  4FIP C;  1AB3 A;  2WLH A;  1QQC A;  3K08 A;  4HAM A;  3ZRW A;  2KG7 B;  2DQ0 A;  2WLK A;  5BXZ A;  4CH3 A;  3Q4H A;  4LFC B;  4PEL A;  5LXT A;  1XNR B;  3W7X A;  1XNQ O;  2Y48 A;  5GTH Z;  3A0B Z;  3OE7 G;  1Q6H A;  3RW0 A;  1BGY H;  5LMN B;  2HJF C;  5LMU B;  4UCS A;  1OJH A;  2IJH A;  4YJ2 B;  1AJQ A;  1ZTE A;  3MD0 A;  3C3T A;  2Q68 A;  3SPH A;  4UVA A;  4GZR B;  1Y74 A;  4E2L A;  4ZOL A;  1TA8 A;  2KQX A;  2IJJ A;  3OW2 U;  2UUB B;  4GCZ A;  2ZE5 A;  1IUR A;  5JJJ B;  3K5L A;  3L74 H;  3SPI A;  4X66 B;  1OCO C;  2HR3 A;  2E75 B;  4QNH B;  1J95 A;  3C3S A;  4JI8 O;  3OMN B;  5JVD B;  4DUZ B;  2PYL A;  1PL0 A;  2PI5 A;  4TUY B;  3HKB A;  4DV2 O;  4NB5 A;  4WF9 V;  4MVQ A;  1BHB A;  2JGU A;  1VQ4 V;  2ITD C;  3RYF A;  3EHB B;  3SYP A;  1N34 B;  2AHZ A;  1XL6 A;  3CCM V;  1CPY A;  2B1I A;  4J9Y B;  2Y0P A;  3ZRS A;  1H8E G;  2B1G A;  2UXB B;  1K4D C;  2XND G;  4J41 A;  5FL7 G;  3DC6 A;  4JAS A;  4NXM O;  5B1A C;  4I7Z B;  1YJW V;  3KZI Z;  3ICX A;  2W0X A;  5FNV B;  4AQY O;  2FB5 A;  3B09 A;  1V54 C;  1Q8I A;  4JYA O;  1R73 A;  4YY3 B;  4UXN A;  3UT5 B;  2JK5 C;  3A0H Z;  1O9H A;  4JI3 B;  1S3J A;  2Q9L A;  4DV5 O;  1E1R G;  3ZHR A;  1ZLZ A;  4QPK A;  4X64 O;  1HNZ B;  2ZM6 O;  2DYR B;  5KMG B;  5LGN A;  4I0X B;  3CCE V;  3CME V;  5J2U A;  1BHA A;  5IYZ A;  2Z0A A;  3K9S A;  2F23 A;  4GX1 A;  2PUS A;  3G6E V;  3CCS V;  4D7T A;  3ZN0 A;  5A2Q N;  1MMM A;  2HFE C;  3BPZ A;  3IJ4 A;  1Z5V A;  3BCC H;  3CJH A;  4NR1 A;  3SR2 C;  2ETN A;  1D5A A;  3ABM B;  1F4N A;  4GT1 A;  3ZMZ A;  2Q5Z A;  4OGQ B;  2Q67 A;  5B1B C;  4I9W A;  1IBL O;  4X9Q A;  4MW3 A;  4LF6 O;  3CRQ A;  2XTA A;  4X1I B;  1MOF A;  2OWO A;  3LDE A;  2A9H A;  3BVO A;  1OCZ B;  1IBK B;  3M8A A;  3RVZ A;  5FLX N;  3TXQ A;  3QG5 A;  4ABM A;  2P22 C;  2EIN B;  4LF4 O;  3WB1 A;  3AK3 A;  5L3C A;  2L35 A;  2DWD C;  5HFL A;  4JI0 B;  3AK2 A;  1RFY A;  4K8X A;  3PJS K;  5GON B;  2EIL C;  2Q8V A;  2Q7G A;  1AI5 A;  3A2F A;  1D2D A;  5EBM C;  1YJ9 V;  4PA9 A;  5E1A C;  1I5X A;  3K06 A;  4Z1V A;  4FFB A;  4IIJ B;  2F43 G;  4I4T B;  2Q7H A;  3X2Q C;  2ILM A;  3JD1 A;  2LW7 A;  4LF9 B;  4JI5 B;  5KAF Z;  1HNZ O;  4LH6 A;  2WLL B;  3O65 A;  3S3W A;  4WFF A;  1MG1 A;  4DV3 B;  3K57 A;  2LGQ A;  3ZHQ A;  1XI1 A;  2DOS A;  4I50 B;  5LHG A;  4GX2 A;  1FXV A;  1N36 O;  1WA8 B;  2W0F C;  1IBM O;  3IGA C;  1SA0 B;  1IXB A;  3DC5 A;  1K7D A;  4LF9 O;  2PTM A;  4GLX A;  1K5Q A;  2N74 A;  2Y4U A;  1JPX A;  4RUE A;  2JEX A;  2OYQ A;  4IL6 Z;  1PKX A;  4YJ3 B;  3WB2 A;  4DK0 A;  2A79 B;  5IY5 C;  4I5S A;  3LNN A;  3QVN A;  3R66 A;  1DF5 A;  1CP9 A;  5J2T A;  2H94 A;  2ZKO A;  3RYF B;  4DR1 B;  1SQQ H;  5CA1 A;  2DW4 A;  3E8G A;  2V4D A;  3JSL A;  1IBK O;  4FZ0 A;  2Q4P A;  1ZSP A;  2OCC C;  4YIP A;  2Q73 A;  5IYD O;  1BCC H;  3HKB B;  2XAQ A;  1MZE A;  1XMQ O;  3JD0 A;  1SRY A;  2Y4T A;  5KHI A;  5H2F Z;  5DM6 V;  3W7U A;  2XAG A;  5JCO C;  1M9N A;  2ADQ B;  4JYC A;  1J5E B;  3CXH F;  5JVD A;  4LR3 A;  4H0L B;  2EZP A;  1ENV A;  1SES A;  3T1H B;  2ZDI C;  1VQ7 V;  1XMO O;  3OMI B;  1K8A W;  1BZK A;  3MHS C;  4PA4 A;  2Q0A A;  3TJT A;  1IBM B;  4LF7 B;  2BTO A;  2P5O A;  3VQX A;  4JI7 O;  3CYO A;  4J10 A;  3FX7 A;  1WLE A;  1VQN V;  4JAA A;  3T1H O;  5LA6 A;  4HBN A;  2UUA B;  3GB7 C;  3HKE A;  3FAV B;  5CMU A;  3JD4 A;  3DXR A;  3T1Y O;  4J11 A;  4MTX A;  4RAI A;  2Q69 A;  4J42 A;  2QEX V;  5LYJ B;  3B8N A;  2YC0 A;  3AEI A;  4JI2 O;  4NTX A;  1VAR A;  1WP8 A;  3JCZ A;  3ZX6 A;  2HVK C;  2YDE A;  4C7U A;  4DV4 B;  3W7T A;  4GKK B;  2RQ6 A;  4LCU C;  5D5Q A;  4DUY B;  1OV9 A;  4F6E A;  4DR6 B;  2P67 A;  1KP3 A;  1VQ8 V;  2QM4 A;  4PDR A;  4CH4 A;  3TGU H;  4MVS A;  5AG2 A;  1AVM A;  5EZY A;  4G27 B;  2V7Q G;  4LNU B;  1EZV H;  4U3J B;  1KQS U;  3SYA A;  2QJ1 A;  1TUE B;  3JAK B;  1ZX3 A;  1NR7 A;  4L8J A;  2E5L O;  4LP8 A;  2UU9 O;  1X59 A;  1PV0 A;  4I50 A;  1H8H G;  1VIB A;  4FLZ A;  3OR6 C;  1R6N A;  3H1L H;  1S76 D;  1SET A;  1SQG A;  5KAI Z;  5GW7 A;  3ZN1 A;  1W0J G;  3ML0 A;  1QLE B;  2UXD O;  2A06 H;  2WWW A;  4O4L B;  4FM1 A;  1RM1 B;  4YXW G;  5GON A;  1IBL B;  2DQ3 A;  3CB2 A;  3CJH B;  4CS3 A;  4IYI A;  3N2K A;  4NTY A;  3JAK A;  4MS2 A;  1YJN V;  2ZCE A;  4FJC C;  4DUZ O;  1M56 B;  2CUG A;  1IX9 A;  4BW5 A;  1P7B A;  3OD4 A;  1GO3 F;  4FLW A;  2HG5 C;  1JJ2 U;  4ASU G;  1Q6I A;  1XHZ A;  1XEQ A;  3VQY A;  3QO8 A;  1K97 A;  4X1K A;  3D36 A;  1ZWI C;  1N32 O;  1ARO P;  1K9M W;  2QTO A;  4FM0 A;  4PI2 A;  2E5L B;  3RYI B;  1M4U A;  5E79 Z;  2ZIN A;  2A7W A;  4UCU A;  1KKC A;  2A3Q A;  3CRA A;  3H1I H;  3JAS B;  4LFC O;  1PL4 A;  4QE9 A;  3G71 V;  2DYR C;  3DGE A;  1GM7 A;  5EBL C;  1Q7Y W;  5L3E A;  5LMN O;  5JH7 A;  3SPJ A;  4LF5 O;  3STZ C;  1HNW O;  2F1M A;  4KHP B;  2RDC A;  3THO A;  2UXC O;  2LO1 A;  2YI9 A;  3UO2 A;  4CH5 A;  1Y74 B;  5BZB A;  2PZS A;  1HW7 A;  1PNK A;  3SJC C;  4D7S A;  1VQP V;  5KUK A;  5BMV A;  3ABM C;  1NR1 A;  1GM8 A;  3R65 A;  3FKS G;  5EK0 A;  4MW8 A;  2VQF B;  1EFR G;  4GX0 A;  2EJ7 A;  1FXH A;  2QE7 G;  4ZIB A;  4B08 A;  3JSN A;  4W4K A;  1FD9 A;  3T4Z A;  5L3D A;  3OGC C;  4GKK O;  1AI7 A;  1OCZ C;  3JAW A;  4YIO A;  1QR9 A;  5EYP B;  1Y4M A;  3CCV V;  5J9P C;  1YZB A;  4LWS B;  3K03 A;  1WB7 A;  4W4L A;  2CGO A;  4K0K B;  3I55 V;  2XAS A;  4U7O A;  4ZHQ A;  4JI0 O;  1CXZ B;  5KA5 A;  3P3N A;  4LF7 O;  5A9G A;  4H44 B;  1AJN A;  4GKJ B;  1KC8 W;  4QIW F;  3JAL A;  4UVC A;  3X2Q B;  4DXW A;  2CE4 A;  2D3O W;  3LUT B;  1S0V A;  4K0K O;  4TV8 B;  2ZDI A;  4MVM A;  5JQG B;  4KUM A;  1WP7 A;  4O4I B;  4CC5 A;  2FYU H;  2XAH A;  4TSF G;  5IYZ B;  4JTD B;  4JI4 O;  1DLB A;  2BTQ B;  3CEI A;  3UCS C;  1OCO B;  1SZX A;  2CH7 B;  4JAV A;  2NLJ C;  4QE7 A;  1H2G A;  2JDI G;  5LP6 A;  1NZ6 A;  4TV9 B;  3ABK C;  1TUB B;  2WSS G;  2UXD B;  4DR2 O;  4EB6 A;  2F4V B;  1ZL8 B;  4LF4 B;  2FKX A;  4UFZ A;  5IY5 B;  4NTW A;  1AI4 A;  4G28 B;  3ZJZ A;  3P30 A;  5LOV A;  3A8T A;  1T5E A;  3SJQ C;  4LWS A;  3KKY A;  1LUW A;  1I5Y A;  2GUZ B;  3MDS A;  1M57 B;  4DV6 B;  4WBN A;  3H01 A;  4LH7 A;  2ZD9 A;  1H2N A;  4HZ3 A;  2O57 A;  3AG3 B;  1GAX A;  3BY6 A;  2UUC O;  1Y6X A;  3SYQ A;  4GX5 A;  4CH6 A;  4O4L A;  2P7T C;  1V54 B;  3I5D A;  1JVM A;  5KA6 A;  1N36 B;  2R9I A;  1MAB G;  3K5N A;  4MSW C;  5LHH A;  3SJA C;  1HDJ A;  1JFF B;  2VWJ A;  1PD3 A;  2YEV B;  2YI8 A;  4WFA V;  3RFR A;  3D3Q A;  2Z3Y A;  2DJV A;  5H5N A;  1B3Q A;  2P06 A;  1N0N A;  3ZHS A;  3JAR A;  3VQW A;  5IWA O;  3JCU Z;  5K1X A;  1GK9 A;  1RP3 B;  1FJG B;  2YS8 A;  2WLM A;  4X66 O;  2F95 B;  1JOY A;  2BE3 A;  4NVP A;  4LF5 B;  1I94 B;  3M7M X;  1Q82 W;  1GN4 A;  3W7S A;  5BMV B;  3CD6 V;  1RSO A;  1ZAU A;  4O4J B;  4IYH A;  3BA8 A;  1JJO A;  4F6R B;  1JR9 A;  2VQE B;  1VF5 B;  2EIN C;  4DUY O;  4TT3 G;  4ZI7 A;  4B3R O;  1SA0 A;  3CCR V;  4OX9 B;  1NJI W;  2UUC B;  3OTO O;  3ZHV A;  1FYJ A;  4JI1 O;  1XNQ B;  2EIL B;  3WG7 C;  2YEV A;  1BQZ A;  1DK1 A;  2R9A A;  4DR1 O;  2FL4 A;  1KU9 A;  2NNU A;  4OPH A;  4PA7 A;  3K04 A;  5EIB C;  4TV8 A;  5KLV H;  2E74 B;  2GBO A;  1NKD A;  1NU1 H;  4KP4 A;  2GDS A;  1VEW A;  2AZ0 A;  4JI5 O;  3JAR B;  1SKV A;  5IJ0 A;  4AQY B;  2ZT9 B;  4RQF A;  2OTL V;  3F7V C;  2W6J G;  1XHX A;  1N32 B;  2WLN A;  5KMG A;  3E86 A;  4ICG A;  4LFB O;  5TIS Z;  1FAF A;  3M99 B;  1YVW A;  4JI3 O;  4FLX A;  1VQM V;  3FB6 C;  3H1H H;  1NS1 A;  3CRR A;  2K9P A;  3JAS A;  2DMX A;  1NTZ H;  1Y67 A;  2CTR A;  5EBW C;  4ZHQ B;  4B7E A;  1XBL A;  2WPD G;  4LBE C;  1Q43 A;  3K59 A;  4X20 A;  5BR8 O;  1I94 O;  4ZKI A;  2Y0I A;  1LNQ A;  3B2E E;  3EXA A;  4F4L A;  1FFX A;  4I55 A;  2QGN A;  4PA3 A;  5L3B A;  2HLD G;  5LP6 B;  5IJ0 B;  1B06 A;  3J81 N;  3MHH C;  2HP8 A;  5L3G A;  3L71 H;  1H38 A;  3IAY A;  1VQO V;  2LJ2 A;  4G2K A;  1XOU A;  5JCO A;  4CS4 A;  4J9Z B;  1PM9 A;  1EZJ A;  1N33 B;  4JI2 B;  3VBB A;  4MTF A;  2YXL A;  2OTJ V;  3E22 A;  3JAL B;  4AIL C;  2EJR A;  4I9Q A;  4JYA B;  3B40 A;  5B3S B;  5FPR A;  1F23 A;  4DV0 B;  2X7R B;  2ZNJ A;  4BW9 A;  2E76 B;  1NTK H;  1Z5W A;  3K58 A;  2R9R B;  4LNU A;  1R6T A;  2GTS A;  1PNL A;  5EYP A;  1NI8 A;  5H6R A;  1Q81 W;  1GH6 A;  3B77 A;  4B3M O;  5CB4 A;  2B5U A;  2AGA A;  2BSK B;  1HNX O;  3N2G B;  2JS3 A;  3J80 N;  2P90 A;  1LUV A;  3E35 A;  3KCX A;  4P2Z A;  2LP7 A;  1H2M A;  5JQG A;  4PI0 A;  3ZMU A;  2YUA A;  2JGD A;  2QKC A;  3ZRV A;  4WBN B;  1W0K G;  1TVK B;  5IE9 A;  2FML A;  5HFM A;  3CRM A;  2PF4 E;  3ETD A;  5JWP A;  1P7G A;  1RPR A;  4DV7 O;  1Y76 A;  2H8P C;  2ZM6 B;  3ZHU A;  2HHH B;  2ZR3 A;  3ZHT A;  4U3F H;  1MNG A;  3OFN G;  1YCI A;  2LFR A;  3IFX A;  2HVJ C;  1WB8 A;  4PDL A;  2UXB O;  1AR5 A;  4B3S B;  1M90 W;  3VOU A;  1KB9 F;  4P9P A;  2IU0 A;  4IT5 A;  5GTI Z;  4UB6 Z;  4MVR A;  2W6I G;  2CAZ C;  3VQV A;  5D5P A;  4N21 A;  2ADP A;  1KYO F;  1R3I C;  1K92 A;  1N8R W;  1BT8 A;  4MT8 A;  2JIZ G;  3U0Z A;  4IHJ B;  1NH2 B;  2X6B A;  4JPR A;  1FXK A;  1XL4 A;  1U97 A;  3J7A U;  3RGB A;  2UXC B;  2KSD A;  3T4D A;  3CCQ V;  2JVD A;  4DR3 B;  3OT7 A;  4XDL A;  4E4E A;  1QBZ A;  2DYS C;  1Y76 B;  4JI8 B;  2R70 A;  4X64 B;  3G6B A;  1RM1 C;  3RVY A;  4YJ2 A;  4X65 B;  1NH2 D;  1N33 O;  4R7C A;  4KL1 A;  1EN4 A;  1Q5O A;  2HHH O;  3SJB C;  1U96 A;  1M56 C;  1BMF G;  4X1K B;  4DRX A;  4KHP O;  1ZUQ A;  1ROP A;  4OX9 O;  5ITZ A;  4D6T H;  4LFA B;  1ZL8 A;  2NN4 A;  1EM1 A;  1COW G;  4B3M B;  4U3J A;  3HKD B;  1J5E O;  2YXY A;  3BEH A;  5JJN B;  3HPL C;  4FK5 C;  1UFI A;  4PDV A;  5H6Q A;  3LNM B;  2CTQ A;  1N34 O;  4O2B A;  4B3T B;  1BQ0 A;  2ODM A;  1S5J A;  4ZBM A;  3DXR B;  3JYC A;  4DR7 O;  2L6L A;  2WAM A;  1OHH G;  1VP7 A;  4BIU A;  3FYE B;  4FM2 A;  5KHG A;  5LGU A;  4NYK A;  1AP5 A;  4K35 A;  1EN5 A;  1M5I A;  4H33 A;  4UCO A;  2UUA O;  3LSU A;  3W7W A;  4BR6 A;  1NBM G;  3HKD A;  4I0X A;  3D3I A;  2UUB O;  4YY3 O;  3PN1 A;  1M93 A;  4NKG B;  3RBZ A;  4FLV A;  2XAJ A;  4XBF A;  2Y69 C;  1KP2 A;  4FLY A;  3EVK A;  5EC1 C;  2ZIO A;  3OAA G;  2YID A;  1JMK C;  2BOB C;  3ZIA G;  4TQD A;  5KHK A;  3G67 A;  1JA8 A;  3K5M A;  2EIJ B;  1Q6U A;  4AHC A;  2P4K A;  1QLN A;  1AR1 B;  3HR0 A;  4TOI A;  4FVM A;  5IJ9 B;  2QDO A;  2XAF A;  4FLU A;  2H3O A;  1SZT A;  1FFX B;  2F93 B;  3P32 A;  3CC4 V;  4P9O A;  3K9A A;  4B3T O;  1SQP H;  4MVU A;  3AK1 A;  3WFV A;  5CA0 A;  2X6C A;  5DN6 G; 
#chains in the Genus database with same CATH homology
 5E1A C;  1I5X A;  1S5H C;  1JVM A;  3ZMT A;  5KA6 A;  3K06 A;  5L3F A;  2R9I A;  1MAB G;  2F43 G;  1E1Q G;  2X0L A;  3X2Q C;  5CA3 A;  4CZZ A;  3JD1 A;  5C93 A;  4MSW C;  4LC1 A;  5LBQ A;  5LHH A;  4X89 A;  2WLL B;  5H9C A;  3EFF K;  1MG1 A;  1PD3 A;  2WLJ A;  2YEV B;  1V55 C;  4MVZ A;  4WFF A;  4X88 A;  1IXM A;  2WLL A;  1KD1 W;  4WFA V;  1RPO A;  3CPW U;  1JQ0 A;  1BL8 A;  2UXN A;  1W2B U;  2Z3Y A;  5LHG A;  3SYO A;  2LFS A;  1FXV A;  4GX2 A;  2ITC C;  3CP1 A;  2W0F C;  1S77 D;  3AG2 B;  3IGA C;  1YTF D;  1P4R A;  1E79 G;  2QM7 A;  4Z1M G;  1K7D A;  3AG1 C;  2Y69 B;  1JX9 A;  3TET A;  3ZRW B;  1QR8 A;  2K1E A;  3ABK B;  1K5Q A;  1GK9 A;  1JPX A;  2JEX A;  4RUE A;  2V1D A;  1FXK C;  1GKF A;  3ABT A;  4Q20 A;  4XDK A;  3AG4 B;  4WFE A;  2WLM A;  4FPP A;  1PKX A;  1JOY A;  2A79 B;  1WPX A;  5IY5 C;  5B1B B;  4I5S A;  3NXS A;  2KB1 A;  2EIM C;  1DF5 A;  4X8A A;  1Q82 W;  3CC7 V;  1K73 W;  3ASO C;  2EBO A;  3W7S A;  1CP9 A;  3CD6 V;  2H94 A;  1FS0 G;  1OCC C;  1VQL V;  4WFG A;  4MVO A;  3OEH G;  5LHI A;  2DW4 A;  1M57 C;  3ZMV A;  3E8G A;  1AI6 A;  2OCC C;  5IYD O;  2EIN C;  2FTK A;  3E8F A;  4QJF B;  3E89 A;  4TT3 G;  2Z5U A;  2IW5 A;  2AHY A;  2XAQ A;  3CCR V;  3AG3 C;  1YIT V;  3JD0 A;  1NJI W;  1SRY A;  3JD3 A;  4BAY A;  3GWO A;  2EIK C;  2EIL B;  3WG7 C;  2YEV A;  5DM6 V;  3W7U A;  3SPC A;  1YTF B;  3E2E A;  2OT5 A;  2XAG A;  3E8H A;  4RQE A;  3SPG A;  5CBH A;  1M9N A;  2X6A A;  3OEE G;  4JYC A;  1HWY A;  2NNU A;  2Q6A A;  2QKS A;  2C2A A;  4PA7 A;  3K04 A;  2EZP A;  1ENV A;  1SES A;  4R8C A;  1F51 A;  2QA4 V;  3KG2 A;  1NKD A;  2ZDI C;  4KP4 A;  1NQT A;  1V55 B;  3ETE A;  1VQ7 V;  3OMI B;  1K8A W;  3MHS C;  4PA4 A;  1AJP A;  3TK1 A;  3UKM A;  4RQF A;  2OTL V;  3STL C;  3F7V C;  1KKD A;  3CYO A;  2JJ2 G;  1WLE A;  2W6J G;  4RO2 A;  1VQN V;  2WLN A;  5B1N A;  3E86 A;  3CMA V;  4CBC A;  3AG1 B;  4JYB A;  3M99 B;  3K0D A;  1G4Y B;  2DWE C;  1VQK V;  1K3E A;  3GB7 C;  1VQM V;  1QVF U;  1FXK B;  3FB6 C;  1PNM A;  3AG4 C;  3ABL C;  3B8M A;  1L1F A;  3G4S V;  1QLE C;  1K33 A;  2IJI A;  5EBW C;  5CMU A;  3JD4 A;  2EIM B;  2EZO A;  3ASO B;  3FB8 C;  4MTX A;  4RAI A;  4EKW A;  2WPD G;  4LBE C;  2Q69 A;  5LGT A;  1OCC B;  1QVG U;  2QEX V;  3B8N A;  4ZKI A;  1LNQ A;  3AEI A;  4F4L A;  2UXX A;  3FYI B;  4PA3 A;  2P6J A;  1R3K C;  5L3B A;  2HLD G;  2GSM B;  3JCZ A;  4JF3 A;  2OCC B;  2HVK C;  1OCR B;  3MHH C;  2IH1 C;  5L3G A;  3W7T A;  1H38 A;  4LCU C;  1VQO V;  3LSQ A;  4G2K A;  1ORQ C;  1YIJ V;  4J9Z B;  1DF4 A;  2EIK B;  1EZJ A;  2P67 A;  1KP3 A;  4MTF A;  2JEU A;  3VBB A;  3WG7 B;  2M7W A;  5IYB O;  3ABU A;  2OTJ V;  1OZ0 A;  2ZXW B;  1VQ8 V;  4PDR A;  2EJR A;  4MVS A;  1Y66 A;  2BOC C;  1SER A;  3DTU B;  5B3S B;  1F23 A;  2X7R B;  4G27 B;  1MSW D;  2V7Q G;  3ZMS A;  1JCH A;  3LDD A;  4R50 A;  2R9R B;  1KQS U;  3SYA A;  1PNL A;  3OM3 B;  4P30 A;  1TUE B;  4WFB V;  3OMA B;  1F4M A;  5H6R A;  1Q81 W;  1DTO A;  4UUJ C;  3F7Y C;  1NR7 A;  3K3W A;  3OR7 C;  3B77 A;  4DO2 A;  1GTO A;  2B5U A;  4PA6 A;  3E83 A;  1GM9 A;  4LP8 A;  1YI2 V;  2P90 A;  3E35 A;  3ETG A;  4P2Z A;  1THZ A;  2GHY A;  2LP7 A;  1H8H G;  2XOK G;  1YHQ V;  3OR6 C;  1R6N A;  3ZMU A;  4WFH A;  1M1K W;  3ZRV A;  1S76 D;  1SET A;  3K79 A;  1B6Q A;  3TCU A;  1W0K G;  2DYS B;  1S72 V;  3CCJ V;  3ABL B;  5GW7 A;  3ZN1 A;  1Q86 W;  1NVP D;  1W0J G;  3ML0 A;  3CC2 V;  1QLE B;  4HYO A;  5HFM A;  2WWW A;  1RM1 B;  4JAU A;  4YXW G;  4UVB A;  1R6K A;  3CCU V;  2DQ3 A;  4WCE V;  3ETD A;  1RPR A;  4FMT A;  2H8P C;  4JTC B;  2WLI A;  4MS2 A;  3T2M A;  1YJN V;  1OCR C;  2ZR3 A;  3LSS A;  4FJC C;  2WLI B;  4QPJ A;  4XDJ A;  1M56 B;  3A0R A;  4MTG A;  3OFN G;  4BW5 A;  1P7B A;  2LFR A;  3IFX A;  1K4C C;  2HVJ C;  1GO3 F;  4PDL A;  5KUM A;  3FB5 C;  1R3J C;  2HG5 C;  5CN0 A;  1JJ2 U;  4ASU G;  3ASN B;  3ZCC A;  1M90 W;  2ZXW C;  4U7N A;  3UM7 A;  1YSC A;  3VOU A;  5B1O A;  4MTO A;  4OXS A;  2PI4 A;  4FIP C;  3QO8 A;  4P9P A;  5B3S C;  2WLH A;  1K97 A;  3K08 A;  3D36 A;  4HAM A;  2IU0 A;  1ZWI C;  3ZRW A;  5EC2 C;  2DQ0 A;  1ARO P;  2WLK A;  1K9M W;  4R6Z A;  4MVR A;  2QTO A;  2W6I G;  1VQ9 V;  4PEL A;  4BIZ A;  3CCL V;  3W7X A;  5B1A B;  4N21 A;  2A0L A;  1R3I C;  2CK3 G;  2Y48 A;  4UV9 A;  1K92 A;  3OE7 G;  1N8R W;  2QM8 A;  4MT8 A;  3RW0 A;  3LDC A;  2JIZ G;  2HJF C;  1NH2 B;  2X6B A;  4JPR A;  1FXK A;  1XL4 A;  2IJH A;  5IDJ A;  1AJQ A;  3MD0 A;  3QNE A;  3QO7 A;  2Q68 A;  3SPH A;  3T4D A;  4UVA A;  3CCQ V;  4XDL A;  4UV8 A;  4QE9 A;  3G71 V;  4E2L A;  1QBZ A;  1R3L C;  2DYS C;  2IJJ A;  3OW2 U;  2HKO A;  4JGS A;  4GCZ A;  2DYR C;  3DGE A;  1GM7 A;  1EBO A;  1K5S A;  5EBL C;  1Q7Y W;  5L3E A;  3FB7 C;  1RM1 C;  3SPJ A;  3SPI A;  3OUS A;  3STZ C;  3RVY A;  1OCO C;  2HR3 A;  4QNH B;  3HB3 B;  1J95 A;  3QO5 A;  1NH2 D;  4H37 A;  4PDM A;  2MK3 A;  2ATK C;  1UJW B;  4R7C A;  5BZB A;  1VQ5 V;  3OMN B;  1PNK A;  1PL0 A;  2PI5 A;  5CBG A;  1VQP V;  5KUK A;  3ABM C;  1M56 C;  4JTA B;  1NR1 A;  4WF9 V;  1GM8 A;  4MVQ A;  1BMF G;  1BHB A;  3R65 A;  3FKS G;  1VQ4 V;  5EK0 A;  2ITD C;  3EHB B;  4MW8 A;  3SYP A;  3CXC U;  1EFR G;  4GX0 A;  2EIJ C;  1FXH A;  2AHZ A;  2QE7 G;  3F5W C;  1XL6 A;  3CCM V;  1ROP A;  3ASN C;  1CPY A;  3ZRX A;  1VQ6 V;  3T4Z A;  5L3D A;  2B1I A;  4J9Y B;  3OGC C;  1COW G;  1FFT B;  1AI7 A;  1KEC A;  1OCZ C;  3ZRS A;  1H8E G;  2B1G A;  1K4D C;  1QR9 A;  1Y4M A;  3BEH A;  3CCV V;  5J9P C;  4L87 A;  3HPL C;  2XND G;  2YSU B;  5FL7 G;  4FK5 C;  4PDV A;  4JAS A;  5H6Q A;  3LNM B;  3K03 A;  4ZBM A;  2IH3 C;  1QCE A;  5B1A C;  3I55 V;  2XAS A;  1YJW V;  3JYC A;  4U7O A;  2IJK A;  2WAM A;  1OHH G;  1G8M A;  2IU3 A;  5KA5 A;  4BIU A;  1V54 C;  3FYE B;  2ZR2 A;  1AJN A;  5LGU A;  1KC8 W;  1R73 A;  4QIW F;  4UXN A;  2JK5 C;  3E8B A;  4UVC A;  3X2Q B;  4DXW A;  4H33 A;  1S3J A;  2D3O W;  1E1R G;  3LUT B;  1S0V A;  4QPK A;  2JJ1 G;  2ZDI A;  4MVM A;  2DYR B;  4KUM A;  5LGN A;  3W7W A;  3I56 V;  2XAH A;  4TSF G;  1NBM G;  3CCE V;  5DN6 G;  3K0G A;  4JTD B;  3CME V;  3D3I A;  1DLB A;  3IC7 A;  1BHA A;  5CBF A;  1OCO B;  3AG2 C;  4RUF A;  4JAV A;  4GX1 A;  2NLJ C;  3RBZ A;  4QE7 A;  3G6E V;  1H2G A;  2JDI G;  2XAJ A;  4XBF A;  3CCS V;  2Y69 C;  1KP2 A;  3ZN0 A;  4KFM A;  3ABK C;  2WSS G;  2HFE C;  5EC1 C;  3OAA G;  1NVP B;  5IYC O;  1K34 A;  3ABM B;  3JD2 A;  4TWK A;  1F4N A;  2BOB C;  3ZIA G;  4GT1 A;  3ZMZ A;  1CEZ A;  5IY5 B;  5B1B C;  2Q67 A;  4I9W A;  1AI4 A;  4G28 B;  2EIJ B;  3ZJZ A;  3P30 A;  4MW3 A;  2ZQM A;  3SJQ C;  1MOF A;  1QLN A;  1AR1 B;  3LDE A;  2A9H A;  1I5Y A;  1OCZ B;  1M57 B;  2XAF A;  3RVZ A;  3H01 A;  3OUF A;  2ZD9 A;  2EIN B;  1SZT A;  4HZ3 A;  3P32 A;  1GMG A;  3CC4 V;  3SYC A;  5L3C A;  3T1C A;  3AG3 B;  4P9O A;  3K9A A;  2DWD C;  3BY6 A;  5HFL A;  3PJS K;  4MVU A;  3SYQ A;  2EIL C;  4GX5 A;  1AI5 A;  4N23 A;  3WFV A;  2X6C A;  5EBM C;  2P7T C;  1V54 B;  1YJ9 V;  4PA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...