1FXUA

Purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
278
Chain Sequence
GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine nucleoside phosphorylase: structure of its ternary complex with an N(7)-acycloguanosine inhibitor and a phosphate anion.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 86
structure length 278
sequence length 281
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fxuA00
4TTJA 4DARA 1PR4A 4DANA 4LNAA 1CG6A 1PK7A 5K1ZA 2PGAA 1K9SA 3K8OE 3NBQA 3E0QA 3FAZA 4MCHA 1QE5A 4QFBA 3DPSA 3PHBE 4NSNA 1V4NA 1NW4A 2XRFA 1T8SA 4DAEA 4MARA 4WKPA 1RFGE 3KUKA 1Z39A 4PNPA 5EPUA 4NS1A 4H1TA 1A9RA 4UC0A 1JDSA 1ODLA 4JP5A 4OF4A 2H8GA 4LDNA 1V3QE 3DF9A 3SCZA 1PWYE 1V48A 4D9HA 3ODGA 3EMVA 4RJ2A 1Y1QA 4YJKA 1OU4A 1Z5OA 4G8JA 4QARA 4F3KA 3KU4A 1VHWA 3T94A 3P0EA 5EUBA 2QTTA 1ZOSA 3IEXA 3ENZA 2I4TA 3FNQA 3LA8A 1Z38A 1ZL2A 1RYZA 4R2XA 4TXNA 1FXUA 1NC1A 2AC7A 3LGSA 5I3CA 1ODIA 3FWPA 4F1WA 5F77A 4WKBA 1RXUA 1RXSA 3FUCA 1T8RA 4U2KA 4NY1A 4MCIA 1K3FA 2HN9A 1Y1RA 1ECPA 3INYA 4TXJA 1B8NA 1V45E 1YBFA 3DP9A 4OJTA 1Y1TA 1VFNA 4BMZA 4OGLA 4R31A 1C3XA 3FB1A 2HWUA 4EARA 1Z33A 5CXSA 4OEHA 1VMKA 5IU6A 1T8WA 3K8QA 3UAYA 1XE3A 5B7PA 1JPVA 1Q1GA 3PNSA 4DAOA 1A69A 1RXYA 5C80A 4OY3A 3NM4A 3C74A 1T0UA 2OECA 4WKCA 5F7XA 4TXMA 4YO8A 3O6VA 2I8AA 4L5YA 5JPCA 4TS9A 3OZCA 1RCTE 2A0WA 4JWTA 5F7OA 2BSXA 1A9SA 4GLJA 1A9TA 3UT6A 4BMXA 2OXFA 1RSZA 4F2PA 2AI3A 5ETJA 1B8OA 3OPVA 1PR1A 2A0YA 5B7NA 1K27A 4BN0A 3P0FA 2A8YA 2QSUA 4LNHA 5B7GA 2OC4A 2RJ3A 1YQQA 2QDKA 3UAZA 1TGVA 4TTIA 2AI2A 3BSFA 4DA6A 3GGSA 4D8YA 4TXLA 5F78A 1JYSA 1PR5A 4M7WA 1PW7A 1V2HE 2IQ5A 4E1VA 4ECEA 5FAKA 4I2VA 3OZBA 2QPLA 1RXCA 1Y6QA 5B7QA 1T8YA 3PHCA 1LV8A 1JDZA 3OZEA 5CYGA 1U1DA 1N3IA 3PNPA 1ODJA 4FFSA 3KVYA 4G89A 1U1FA 4QASA 2B94A 1V41E 3OOHA 3MMSA 3BJEA 3GB9A 1SQ6A 2QTGA 4YMLA 2HSWA 3O4VA 1M73E 1Z35A 1PKEA 2P4SA 1YQUA 1Y6RA 3OF3A 3TL6A 1Z34A 4TS3A 4DABA 4X24A 3OZDA 3EUFA 2HRDA 1JE1A 1Z37A 2Q7OE 4TTAA 3IOMA 1PK9A 5F7JA 3UAWA 1TCUA 1OTYA 2ISCA 3BL6A 5F7ZA 1JE0A 4JOSA 4WKNA 5CCEA 1OVGA 4LKRA 5EFOA 5KB3A 4D8XA 3MB8A 1JDVA 3E9ZA 1SJ9A 4TYMA 4D8VA 4GKAA 1TGYA 4F2WA 4L0MA 3DJFA 3EUEA 1JDTA 1SD2A 4PR3A 4L5CA 4DA8A 5F73A 2OC9A 1JP7A 4D98A 2AI1A 4F3CA 4QATA 2A0XA 1A9PA 1Y1SA 3OCCA 3D1VA 4IP0A 4GLFA 1ODKA 1OV6A 4WKOA 1U1CA 3KHSA 1VHJA 4M1EA 1I80A 5F76A 4R2WA 4L6IA 2GUWA 3ONVA 1CB0A 4YNBA 3F8WA 1PR0A 3FOWA 3LBAA 1TD1A 4OGKA 3U40A 3BGSA 1A9QA 3KVRA 2ON6A 1OUMA 1PBNA 4M3NA 4G41A 4TXHA 5CCDA 1NC3A 1RR6A 4EB8A 4L5AA 1YRYE 4GMHA 4K6OA 1G2OA 1RT9A 1LVUA 1Z5NA 3QPBA 3UAVA 4BMYA 1TCVA 1JDUA 4LZWA 4DA7A 1ULBA 3E9RA 3OOEA 1LX7A 1U1EA 4QAQA 5IFKA 5DK6A 1Z36A 1ULAA 3UAXA 1OTXA 5CYFA 3DDOA 1Z5PA 5CXQA 1WTAA 1A9OA 4QEZA 3NM5A 1SD1A 4P54A 1YR3A 1PR2A 3EEIA 1PR6A 3NM6B 3KVVA 4KN5A 1U1GA 4DA0A 1PF7E
chains in the Genus database with same CATH superfamily
1R16A 4GQBA 1D1QA 3CPEA 2YOGA 4JB2A 4PV7A 1E60A 3SJZA 5CB8A 1T25A 1CIPA 3B1JA 2WHRA 3W8NA 3JYNA 4FEEA 1HFWA 3QIAA 5MGNA 4ZI7B 5KTRA 4B3XA 3WXMA 3PR3A 5DBOA 3HQ4O 4OL9A 2CLSA 2PH7A 3J81k 4JMPA 4BKOA 5JHHB 4WVFA 1V37A 3EA5A 2ZXUA 5BSEA 4ARCA 2HJGA 2Q29A 2CXHA 4GI7A 4O4LA 1JAXA 4WCFC 1PUJA 1HNNA 1X8KA 2VP9A 3S7TA 3W9SA 2ZTUA 4WN3A 4WNIA 3CXRA 4MB2A 4IH1A 1EGHA 3A6DA 1H9BA 2VHCA 1I2ZA 1QF7A 3V4FA 3JQ7A 6NULA 4RKYA 4WE3A 1ADBA 2P1RA 1WNTA 2ZUWA 4BB6A 4BFWA 1AD2A 1UINA 4PX9A 1N5JA 1RPJA 4H7PA 2XW6A 1GG2A 2C42A 1G8HA 3MYRA 4GGMX 4ARZB 5CCXA 3A11A 4PGHA 4B6PA 3BM5A 3UK1A 2YUIA 4FKZA 4MARA 5DTRA 1WOYA 1SKUA 3LC2O 2IEZA 2UZ3A 2HGZA 1SVSA 3BMQA 2BHLA 5KNDH 2JHPA 2MU1A 3HUDA 3IQWA 4NZ9A 4ZV9A 5JSYA 4OM8A 3U7RA 3B12A 1ZBDA 3WWOA 1HEUA 1V95A 4MTCA 4MWDA 3ZBQA 5DP2A 4DQ0A 1H4SA 1KZYC 3B1WA 2KM1A 4NESA 2QQGA 4KPFC 5AOVA 1DUSA 2QPAA 5DM4A 2XRYA 4C2UA 3G5MA 4IIJF 4Q82A 3DTNA 2WFLA 2FH5B 4EHIA 1SVKA 1JBEA 5FHQA 3BHMA 5E38A 5EA2A 1JHUA 2Y76A 1YBVA 4QBTA 1DKQA 5B2ZA 1F51E 4QLAA 4RYLA 5A3JA 1H85A 1MAUA 1R10A 1UP4A 3RQIA 3SMQA 3VNSA 2I9KA 2C8LA 4LPKA 4RK0A 4EUEA 2O8FA 3T94A 2O2SA 3HJFA 1RM0A 3K20A 2NUAB 4QAJA 5DI3A 1T43A 1M2VB 3EQ8A 3CE6A 4IAOA 4NCNA 3THXB 1E2KA 1KSHA 3A10A 1JHDA 2JIMA 2BM9A 5TQJA 3WZMA 2V7VA 1CEEA 3DF7A 1W48A 2W2LA 1ANKA 4R2XA 3MJDA 3PNYA 2AC7A 2CFTA 1QFZA 2ZI7A 3RSSA 2CL5A 4HFNA 3WAKA 5I3CA 3UN1A 3L7JA 5DX8A 1NM5A 4AW9A 3HZZA 4GBGA 5AW8A 3AERB 2YYZA 3GCXA 3HA7A 2NU7A 4CODB 1COZA 2VDVE 2YBDA 4MWBA 5BOSB 3RUHA 1W9MA 2HPZA 3CRQA 4BNXA 3W5SA 1RKUA 1VZ3A 5F21A 1KK3A 2FK7A 4B44A 3UT5B 1E2HA 2F00A 1E9FA 2PD4A 3AJEA 3CUVA 3QPCA 4FS8A 4Q15A 3D6UA 5BO5A 1HLDA 1NY6A 1RQLA 1OPXA 3NJ4A 2O8BB 2NSDA 3LKBA 1QM5A 1Y8CA 2WIGA 1XDUA 2QG4A 3F71A 2HHCA 3HYSA 3E9EA 1VKJA 3NKFA 3A1EA 4KX5A 4V0NA 4A23A 5A06A 1VIAA 3LG2A 1YDHA 5CEEA 4TXJA 3KXDA 3O8QB 3DV2A 3DZGA 3BD9A 1XLVA 4A8PA 2A9VA 1UMBB 2ZLBA 4TKUA 1LI5A 1E6CA 5AHRA 5HIJA 3WZLA 3ZE2B 5G4LA 1DBVO 1NXTA 4I99A 2FMXA 4LK3A 4Q3BA 2WIKA 4ZI3A 3RG2A 5A02A 3W5BA 1C3XA 4N5NA 2GN9A 1L7VC 4HN9A 4J0CA 4KPUB 2H9IA 1U5CA 2IXFA 4XLZA 5DX0A 5IH3A 1UQUA 1DFIA 2WSMA 1AY0A 4GI3A 4XZ3A 4HRXA 2FPSA 1SU4A 3NTVA 4R1LA 5IBCA 1ZGHA 3MWDA 4B4UA 5JH7A 1OBFO 3NAMA 3S1AA 5THKA 2DLCX 1D9XA 1JXQA 4OUDA 3QOFA 2WOJA 4NG4A 2OBBA 2A1IA 4QQKA 4R7GA 4HRAA 4W63A 3WYEA 3GC6A 1UF9A 5HCIA 1KDVA 4ENWA 2PTGA 3GBSA 3E9CA 4KOAA 4UBOA 4ZFNA 1PO7A 1WB9A 1X7YB 4RDIA 5DNEA 2O07A 4Q9IA 3WI7A 4L4YA 4AWBA 5C2JB 3UNXA 1MA3A 4HWRA 4N0DA 4KR9A 5DNUA 1QVVA 4R5HA 3N2KB 3RAJA 3TOSA 5JEEA 1ECBA 1YR9A 5BN5A 4U0JA 1DKPA 1T2NA 1XRPA 2Q5LA 3ML1A 3VR6D 5IT4A 1MR3F 4GPTA 3PUHA 2XBUA 2H0AA 3N5CA 1TOAA 3C74A 1JZTA 5I4CA 1L3CA 3SPXA 2YFKA 1W5SA 2BGRA 5A9RA 5FI1B 3VA7A 1KY5A 3O90A 3R5JA 4IIFA 1MX3A 2IYEA 3H5WA 3MCAA 4AZ0B 5IANA 1YSCA 4XFDA 2H07A 3G1TA 4QLOA 3TI9A 1KQ3A 5J4KA 4JZYA 3GLHA 1GL9B 3P52A 4PRZA 2FMKA 1U9IC 3BXOA 3DBLA 3K1AB 4TV9A 3GFPA 3OKPA 3TLGB 1P81A 4KI0A 2CCJA 2WV7A 3COPA 3VC1A 3W79A 5ADWA 3DEAA 5JNLA 1I3NA 1DXYA 2VI5A 1C1YA 1QP4A 3ETDA 1UBEA 1FRZA 1G9TA 2F3UA 3JQAB 4Z9FA 1WCV1 1T0PA 4YT8A 3D3KA 4ZYVA 1XEXB 3B6MA 1NPDA 3DVQX 1QLWA 2X1VA 3F0TA 1AK9A 1BNCA 3IXLA 4XXHA 4XWAA 3V9PA 4BQSA 2B98A 4FC6A 3A4VA 4OP3A 2ISSD 2B5OA 1KFBB 2ZSEA 5BOVA 3TQQA 5BW8A 2XQKA 3FMIA 5JU6A 1C5KA 3U4QB 1G1MA 5CFMA 1RJEA 1FX0B 4KGXA 5TARA 4L9SA 2FOIA 5LYJA 4N3GA 4BNUA 1UDRA 4L4SA 3B9BA 1P6XA 1VE9A 1OILA 3HB5X 1U3UA 4C7JA 2XVAA 5D3MB 4IRXA 3U9TA 3BVPA 2PUAA 1CIVA 2O6LA 5FOXA 1WMEA 3L8EA 5F4BA 5AW3A 4KTVE 3OZFA 3I64A 3R6LA 4K81B 4N0EA 5IAEA 1BE6A 1U3VA 2VJMA 5BMVF 2JFQA 3ECSA 2F17A 2JHAA 3C15C 1NAIA 2BBWA 4A0RA 3PC8C 1R0LA 1E2LA 1XTBA 3ROGA 2H1OA 2GEDA 3LSTA 4QDXA 4X00A 4OAPA 3P9YA 2HXYA 1HE3A 1ST3A 2ZR0A 4TV8F 5JPIA 3GXOA 5T3YA 1S1CA 4NZMA 1VJCA 2V7QA 3N7TA 5CLHA 1J00A 4F3NA 3GG9A 2MINB 3IAAA 2DQ4A 2FWPA 1MTZA 1VB5A 3TIFA 5EPOA 4B3DA 3H11A 3A4NA 2ZBUA 3ORFA 2PUVA 2AFIA 1U7TA 2PX3A 4X94A 5AVZA 5TS2A 2RFLA 4XQEA 4LDJA 4MDYA 1QE0A 4O8ZA 2Y92A 3VNBA 2ZM6B 1JKIA 3I34X 5C46F 4G5YA 2WJVA 3CUSA 3CGWA 1MX1A 1Z2CA 2FEMA 3KVYA 1WB5A 2X0DA 3TW4A 2JFZA 4QYIA 1D2MA 4KB5A 3O8BA 4RLHA 5LN1A 5AXDA 2PS9A 3PGXA 3DBHB 4TSRA 5EJ9A 3Q1LA 3O8NA 3NOXA 4MKRA 5LYYA 3SIRA 3H0EA 2RE8A 4GMKA 3BQNB 1TDJA 3EK2A 2B9VA 3Q2IA 2W58A 4I1YA 1ADYA 5EMMA 5DGIA 5FBHA 3BD6A 2WTAA 2QJTA 1JHPA 2WHEA 3I6YA 4D4JA 1U3TA 3Q0IA 3QNMA 4GFDA 5DTIA 5LNK6 2YXEA 5E6SA 2GNPA 5ARDA 4G09A 1JG7A 2YWEA 4QPDA 4DV5B 2J09A 4H35A 3GRPA 1RM4A 3OE7A 3SX0A 4OB7A 1LLCA 1YVDA 3AB3A 3F1LA 5KYKA 2G83A 3LY7A 3M1LA 5HM6A 1RYFA 2JH8A 4GC5A 5K09A 1XTPA 3LYHA 3PUJA 4JKYA 1QAOA 5EI5A 2PE5A 3GGDA 3QKRB 4L28A 4X97A 1VMIA 3TZEA 2ZG6A 4DV7B 1F7UA 2CLOB 4H08A 1W5TA 5L4SA 3UMYA 1NAHA 2ECFA 1SQ5A 2XQJA 3QVSA 3SOZA 1GTJ1 2QUZA 2GESA 5C5IA 4WA8A 2ZWOA 3HA3A 5DH9A 4FYXA 3D5TA 2Q1TA 2ZITA 1Z7BA 2G1AA 5DVZA 521PA 5AVTA 1K9VF 7ABPA 2XCRB 3AETB 4AZ3A 5KQPA 5FBRB 3IQZA 2HIGA 2AHRA 3IPYA 1L5FA 4Q9KA 4BO1A 3T8YA 2LP4Y 4LJ9A 2Y0DA 5HPYB 2WILA 1X1SA 2ENUA 2QM7A 1QJCA 2I29A 2V9CA 1Q20A 2Y1OA 1OGYA 2ZETA 1BFKA 4MKGA 1INLA 5JSHA 5F1OA 1OA0A 1KMHB 1V6SA 2ATEA 3IB3A 3N07A 4WKGA 2DP4E 2R44A 3SHFA 3W2HA 2ZRAA 5ERGB 2ZRHA 2QM8A 3MXOA 3K92A 2G1JA 3MB8A 2AFHE 3C6QA 4OHZA 1UK7A 3DMTC 2PZGA 5E0KB 2JIRA 5TS3A 4MQUA 4L0DA 1PZGA 3RSQA 3HCFA 3N53A 1Z9BA 1Z88A 4YP7A 1MZPA 1NIJA 1QQ7A 3E27A 2C3PA 3K5HA 1E0AA 2F9MA 3HL4A 1AA6A 2QX4A 4GOMD 1M8JA 2GCOB 3OX3A 4ML3A 3WDLA 1CJKC 1U4SA 3FCSB 4RELA 1UDWA 1ABFA 5BYKA 2P7HA 3FZGA 4X1KA 2IHUA 3A1FA 4N8DA 2I34A 5AUPB 1PCXA 3K71B 3WA6A 4Z1OA 1F1BA 1QFMA 3AM4A 3C1UA 1QIMA 4P32A 3R0VA 1N2XA 3L1KA 4L22A 4AURA 1E7WA 4AMZA 3B3FA 4GRDA 4DXDA 1QWSA 2QT9A 3I28A 1JFTA 2GFIA 4D56A 3NGMA 3FSRA 1GYRA 4UMDA 4MA0A 1L4EA 3RWBA 3OCCA 1XBTA 2J9ZB 1RHKA 4FGJA 3RAGA 3WIBA 5BV2P 2ZIUB 4IOLA 4U7JA 4AZTA 2AOWA 4TVSA 5L3ZA 1C1XB 4EAAA 3O26A 3OA2A 3EC7A 3WSWA 3KHSA 1M8PA 1VHJA 4H0NA 4QHTA 2E85A 1EFUA 4NYIQ 2ZTMA 3GLHE 3QJ5A 5HK8A 4YONB 1CYEA 1H2ZA 4Z99A 4HLDA 1LPPA 4D4KA 2JI8A 4EA9A 4A2PA 1WR8A 3MJ4A 1EM6A 1J06A 2A4KA 1PK8A 3L02A 2C9ZA 3GLVA 4QXOA 4JBIA 2IKQA 5F64A 2F1HA 4PFSA 3L7CA 3WIDA 3FOWA 2X4DA 2F4NA 3QLEA 4B3BA 4H31A 4LXIA 5CVEA 2O2JA 4RSRA 4TYWA 5JW6A 3JQPA 3H97A 4F2DA 4ZO9A 4TT8A 3COYA 5E1BA 3W4IA 2YWRA 1Z0SA 2P2GA 3A2KA 4OGKA 3DC2A 3F4LA 1L7PA 1EHIA 2IPOA 3RIHA 5HCNA 3PR2B 4DCOA 5KJ6A 2ZUCA 3WGJA 2OMEA 4M3NA 1W93A 1YJCA 3GLHB 3I9MA 5LZ5A 1CUJA 4M7RA 2C2MA 2HAEA 4G9BA 3TSAA 3W6UA 2FWMX 4K6OA 5J2UF 4WXRA 1EBUA 1IK4A 4URYR 5K05A 3ELYA 3BICA 1Z22A 4Q4CA 2F55A 3NYQA 3QQ5A 4F1JA 1OHHD 1LTHR 1RC8A 3ZHUA 4HH0A 2OQRA 4KLZA 2LPMA 3V4SA 2V0GA 4M8NE 4J6EA 1RI5A 3I61A 4LTMA 1L5MA 1WPGA 2WPDD 2W8BB 3TW0A 4INOA 5BN5B 5EIOA 1HE2A 1TJYA 3K2IA 2VZ0A 4KIFA 3PG5A 1FQKA 2PK3A 4N0QA 4MYRA 3JYQA 4MNTA 1M6VA 3RS3A 4ETMA 3O8QA 5J5AA 1CWUA 4NH0A 4WH0A 1T29A 1X87A 3O75A 5DXAA 1M34B 3NORA 3OEYA 4Y30A 1WCWA 3DZ8A 5ALRA 1YR8A 3PF9A 1UMDB 1XO1A 5H4HA 4IDHA 1JDJA 2VF2A 3DEZA 4LHXA 5ERYA 3WDSA 2RI6A 3L7MA 5F23A 1D6JA 1M1YE 3V6MA 3U7HB 2O59A 1XEWX 4PU0A 1I1NA 1JN0A 2XXBA 4DC0A 1SXJE 1HQKA 4URWR 3T9AA 1W5AA 2FVYA 3A6JA 3PJEA 2AL7A 3DWIA 3MQ4A 4MA5A 5GZ6A 3Q6MA 3EFOA 3I2GA 3MS7A 4QDTA 4W82A 4JCCA 3SF8A 3TLZA 1Z0ZA 2IZOA 3UAXA 1NJ2A 2AOXA 5K2OA 3EHDA 4F6CA 1FL9A 1X74A 3A9TA 5ALYA 4HBZA 1EP3B 3VRHA 4S05A 2HEGA 4RK6A 2GASA 1Y5LA 2AXNA 2NUTB 3O7MA 2H1LA 4W7HA 3N28A 2A0UA 4C4SA 1R37A 1TK3A 2YY5A 1KYIA 3PJFA 3U81A 3F1KA 3A4IA 4TLLB 1AUOA 3DKVA 4OHUA 3WQHA 3NNSA 1CY0A 1MV5A 3QVGB 1SXQA 1FU8A 3FVTA 2R6GA 4BGVA 1WD7A 1T3TA 2KX7A 1QH0A 4JLOA 1FNBA 3L9XA 2BEJA 3AUKA 4K86A 3STWA 1OWMA 3PI6A 3TGWA 5IHPA 5KKAA 2B99A 4CTKA 1WX1A 4HNSA 1N8NA 3TNYA 2XGMA 3E4CA 3TW6A 4JP3A 1NYLA 2HQ1A 5T67A 1TA4A 4TRMA 1XFAA 4BAZA 4Q7JB 1MIOA 2PDAA 5KOHB 3WXBA 4EX7A 3U3XA 5CX4A 1GSAA 2HWKA 2IYTA 2WT9A 3DNFA 4C7MA 4COOA 6REQB 1NFRA 2YV1A 1K5HA 2NZUG 2Z57A 5FPSA 5KSZA 5LJLA 4IIYA 4HNHA 3KLMX 3ZYCA 1P9LA 4KX3A 1GZHB 4M83A 5ALLA 5EHZA 2QTNA 1IEWA 1NUTA 4WXYB 4ZOLF 3NBQA 4RLSA 4XDGA 4EHHA 4HX2A 1G21A 3K9HA 4OO3A 5JS2A 2XMDA 3HVHA 4UBKA 3NIFB 2J3JA 5EWMA 1YVUA 3W2EA 4WECA 1D6MA 2J31A 2JGIA 2R7NA 2G82A 2X9QA 2XXJA 5EWLB 1JNYA 1LLUA 4IJWA 2IH4A 1EP2B 4HTAA 3N0VA 4ND7A 4EJ2A 2WKPA 1E6EA 1MIHA 4M21A 5IZCC 4CM3A 4WK6A 5FNVA 2FUNB 3T1YB 1WXWA 5E6RB 4UAUA 1PEDA 5HF5A 3TL3A 2DCMA 4JI8B 3WYAA 5KYUB 1ORWA 4L16A 2IFTA 3OU7A 2X2PA 1OJLA 1L4NA 1YBMA 1Q74A 1J09A 1S9DA 1UH5A 2XD9A 4ID9A 4PNPA 3K3PA 4H1VA 1TO2E 4FILA 4HLCA 2YXNA 2HADA 5F2EA 3BF8A 1V8PA 2XGSA 3BKXA 5A0FA 5TLSA 4BQPA 3BTUA 2D5AA 1U7WA 4TQAA 3WLLA 4KIGA 4K8OA 3GJQA 1Z56C 2B4TO 3RFUA 3SS7X 1L4LA 3GEIA 3R3VA 2WZCA 4AKGA 3O4GA 1PFQA 1V48A 1NW8A 1C29B 1P60A 5LB2A 1P73A 5AOAA 3COZA 1GNQA 3E1SA 2PSDA 4UBJA 4ZO6A 1TZMA 3RCBA 1CF4A 1BEUB 3B85A 2J0VA 5KIAA 4W1PA 2X41A 1KP9A 4UUAA 4X44A 2XJ9A 3LUBA 1F8FA 4YJ3B 4UDOA 5HM8A 2J5BA 1GCUA 3GGOA 4G8JA 4ONEA 5AI0A 5JDIC 2BCEA 3PHJA 5GJWC 4DC1A 3H2ZA 2AUTA 5HMLA 3BBLA 5AIAA 4OOFA 3SEQA 1NP3A 5IT5A 1T1EA 1X7XB 4LXQA 3ENZA 3OJWA 1JKFA 3ROXA 1SAYA 4URXR 5EVJA 3SZGA 2PLRA 3KYDA 5ICCA 2E37A 4J0IA 4QYSA 2PRZA 3FBWA 5A7HA 2O1XA 4KYUA 2FFRA 4LBZA 2CK3A 4YMIA 3G7NA 3RTCA 4BLRA 1MC4A 1OT5A 1JR2A 3M4XA 3F7OA 4QSHA 5FULA 1T13A 4AUNA 1HG0A 1TW2A 2XOEA 3HABA 4L4XA 3R5SA 5B3LA 3BHJA 2QX7A 4OMDA 4GU5A 1GNPA 1KDYA 1A4XA 2G0NA 2YV3A 1CUWA 5I51A 3O4JA 3USES 1T8RA 3JYHA 5K0CA 5JYBA 1MNAA 1YS9A 3P97A 1LPNA 1PJ8A 1T2VA 2CFRA 3B3AA 2WT8A 4LYEA 4D9EA 4RJTA 1MQAA 4G97A 2JJ1D 3KG2A 2RHCA 2YINC 4LI0A 3VKFA 3VO9A 3WB9A 1GZ3A 1E1YA 1IHPA 2AZDA 2I33A 3N05A 5JBNA 5EE3A 4GHWA 4UPDA 4KVGA 3IUJA 4G0VA 3BFVA 5AQ1A 1AKVA 1FFBA 3INYA 1SXIA 5KX5A 4YCAA 2ZJ1A 3I6ZA 4F92B 2C2ZA 2IEGA 4JYPA 4W5RA 3SIXA 3V2UA 1Y48E 4I9FA 4MROA 2BF4A 1BWPA 5E2IA 1SWVA 1GWNA 3OF2A 4FKBA 1FYXA 3EXAA 5IDVA 4W9RA 2X15A 2HU2A 3MK31 4WOCA 3GIDA 3VKVA 5E95A 2AZ4A 1J6UA 5AOCA 3WY9A 4YHHB 3VPCA 4DBVO 5KQRA 4HLNA 1N0IA 3W2TA 4LF5B 3U4MA 3B9PA 3KSUA 4AO8A 5CEFA 3NDBB 4RL4A 2QRQA 3BTOA 5LBTA 3V2GA 1YCHA 3SFTA 3SYTA 4EJ0A 3DFFA 1XN4A 2P0AA 3KSDO 2FSPA 1BHSA 3EOBI 1XZLA 2VXYA 4XYMA 2X1LA 2C98A 2PMFA 5CJJA 4REQB 5DISB 1FLNA 2YVUA 3PCRB 2H3HA 4JI1B 1D0SA 2P67A 5DHPA 4BDTA 5JS7A 2ZVPX 3FOBA 3P0RA 1BW9A 3RHTA 1K2VN 1UK6A 3HBNA 3MN1A 3I92A 2K2QB 3UWKA 4HO1X 3T3IA 4MA4A 1RZRD 1PFWA 3QWHA 2AQ8A 4RVUA 1A9XB 1YJXA 3ZJYA 4G6ZA 2F2TA 2ZT8A 4F6RB 4KR2A 3EXFB 4E14A 3OWOA 1ONPA 3STUA 4ARIA 3W1WA 1QYRA 2JCGA 1PJ3A 1ATZA 4O2AF 2QU7A 3DHEA 4YO8A 4DCTA 4DEVA 4EY8A 4PCLA 5A3SA 1A50B 4PNZA 4IDGA 4EECA 4O5AA 4BO5A 5D2CA 2NUPA 2ZJBA 3WKAA 1U28C 2RHBA 2KBEA 4FOLA 4PC1A 4E30A 2JHFA 2CKMA 4RTRA 4FGUA 1FMLA 1K7FB 2OXFA 4KLCA 5TF0A 1E9SA 2RCNA 4F04A 1DTSA 5K20A 1D4FA 3VYWA 5ETJA 3MXTA 4ZVMA 1MG0A 2VK2A 3PENA 4M87A 1ZGGA 3V8VA 3AFNA 2J4CA 1UM9B 3GX1A 1WP4A 3H6KA 5I3ZA 1GA1A 1GDDA 1RQ7A 2KWIA 2H18A 4JLMA 2EJUA 2ZIAA 3CUEF 4KGVA 1CP3A 2ZRBA 1QIJA 1QTIA 4EEZA 5AHWA 3K35A 5HJEA 1YQQA 4OBWA 5DE3A 1VC2A 2NO4A 4BP3A 1RRPA 2YDXA 2C3UA 2P9GA 3K73O 3ACCA 3OZTA 4OI2A 3QPUA 5FL7A 5HILA 3V33A 4BVBA 3FA2A 1WMDA 4HZIA 1DRJA 2ZYUX 4S3MA 4D8YA 3LVQE 1N92A 5A4JA 3WLAA 2C88A 2O8NA 5JZMA 2ZS9A 2J3KA 4LOLA 1XCMA 2E55A 2QY6A 3ISJA 1XCLA 3HO8A 5CGQB 1Z18A 4DN6A 4O1MA 5A9SB 1PW5A 3ZJ4A 4DCUA 3NX4A 1TXGA 1U2SA 3QX3A 3I6QA 1JXMA 3CIOA 1DQZA 2GMWA 2QORA 2ZDGA 4KBGA 4PN7A 1VZ2A 2N0SA 3HPQA 3OZBA 3Q2KA 2AW5A 2O4CA 2QPLA 2V1XA 2XT6A 1OWNA 2PN1A 2Q2NA 4PS0A 1LPOA 4CL3A 4N0PA 2XUDA 4ZT3A 2Z5FA 3FUWA 2HUNA 3KQTA 3WMEA 3B52X 3HS3A 4ZGBA 5CA0B 4JODA 3DBVO 4AI6A 4MLPA 2R96A 4UKDA 4AUKA 2DR0A 1P1BA 1HFEL 1ZKDA 5EE5B 4MR9B 3O8CA 4BX0A 2BVNA 2HFJA 3CF2A 4J8PA 4UU7A 1QQAA 2YJ4A 3DR5A 1RE1A 1Y63A 3VC2A 3H9GA 3QEKA 1J25A 1PSZA 3G17A 4DWJA 1ML3A 1MHPA 3PVSA 3WL4A 3DE6X 4I5DA 1CYDA 4A5OA 2JS7A 4C7OB 1HOXA 3U4QA 5H0IA 2Q45A 4QGBA 5E2BA 4Z6KA 2VP3A 1KTVA 2EJWA 3VO8A 1J56A 1Z3CA 1XUOA 3HLKA 1TMGE 1W1WA 4RM3A 2ZAGA 5DZSA 4DPMA 1JL3A 4CTOA 4GUAA 1SPXA 3AHHA 2GETA 1B6TA 1C0LA 2LKDA 3C48A 1YO6A 2KQUA 3IJRA 4XVQA 1FYVA 3HVKA 5IVKA 1CW2B 4ZOLA 3OZRA 2FPRA 1PT8A 3OPYI 4OI0A 1QQ5A 1K75A 5HZKA 3VQTA 2V98A 2PRIA 2VRBA 2PVSA 1NPYA 1CU1A 4O63O 4CLOB 4LF9B 3EGEA 1JWLA 4IIDA 4TS3A 4DABA 4TLAA 3HXPA 4B43A 1QP0A 1USKA 1XK6A 1KI2A 3C3WA 3HDJA 1JU9A 3N8GA 1IBLB 2IHVA 2WIDA 2NUAA 3KT0A 2ZZMA 1BU5A 5EGSA 3CMCO 2HK9A 1TTPB 2ZBEA 5AVOA 1HDGO 1FOEB 3N2EA 1VHLA 1MB4A 3KHTA 3GRUA 4GLLA 1GA6A 3RK4A 5F7JA 1RADA 1GXSA 1FP4B 2Z5VA 1P80A 3SDZA 3DWEX 4MX8A 2XZPA 4XD2A 3WHLA 1IH8A 2XSZD 5K7SA 1ZEMA 2HRBA 2EOAA 2JRLA 1UEXC 2Z5GA 1KORA 1NTRA 2VPQA 1LLQA 3FF4A 2Q46A 3DDZX 2V0NA 3AFHA 3KYCB 3RR2A 5KO2A 4YCMA 2H51A 3SEAA 1LLFA 1RYNA 1YCFA 1W49A 1R0RE 2PBFA 5KQMA 2C5GA 4JU8A 2C7RA 3KUUA 3H1PA 3IQDB 4X61A 1FMFA 3H6HA 3RABA 4D02A 5FIUA 1BCSA 3H04A 2R8YA 2RDMA 3PC8A 4R01A 3TW8B 3W78A 1B3RA 2F1OA 3D9QX 5H4GA 1H1LB 1AQUA 2O0LA 3EOZA 5CVUA 2BJWA 5HA5A 5B3JA 1J2EA 2GR9A 2PO5A 3E9ZA 5JZBA 4TYMA 2O0KA 3B6ZA 3KVOA 1UCFA 1N2GA 4K9SA 1PX2A 2LD4A 1X8LA 4J76A 3U4GA 4MRMB 5JNWA 3NOQA 1FFEA 5HK9A 5LQDA 3WWEA 5DYWA 1ZKMA 4TQGA 1E9RA 3QQPA 3SMVA 2PPVA 5EIXA 1P2TA 3UHJA 4Y3UA 1Y4DE 5KTOA 2UYHA 1U0RA 3O9VA 3PXCX 1FRVA 4AN0A 1V6AA 4YR9A 1MB2A 3Q3JB 3WNCA 5BN4A 2ETVA 2Y1EA 5JAMA 4RK5A 3CS3A 5GVRA 1KZ4A 2GSWA 3DYBA 4OKSA 3EDMA 2VJPA 3S4YA 4LVUA 3EEYA 2IITA 1ESCA 5A5EA 2V7TA 3I01M 2BONA 4BVGA 5AKYA 2O7QA 4YAGA 4RTLA 1HTBA 3V00A 3BE6A 5HR5A 3E53A 3L84A 4DUGA 1QLJA 1Q22A 1JU3A 1NW6A 1UWKA 3OECA 3V1TC 3ZZNA 4BJ5A 4CV2A 1WVIA 4LMRA 3V32A 3ZLJA 4E5UA 1LI4A 4LYHA 3DWFA 2YS6A 5B2EA 4IIJB 2VLIA 4KG7A 2JZNA 3WTBA 2VDQB 5L3QA 4LY0A 4KVFA 3AVTA 3IILA 3K4HA 1ZNYA 1UQRA 2PJUA 1KDRA 5JCOA 3EVFA 4H7KA 1UMKA 2DHCA 1QYXA 4R2WA 3COSA 2GLXA 2OGWA 3L07A 2REOA 3BGOS 5K6AC 4XUEA 1IMOA 5ILQA 1QX3A 2HSEA 1EFVB 1LSUA 1L5LA 4EGAA 2LV8A 5JADA 1QHNA 2I80A 4EBFA 1F0NA 4CIWA 3B1VA 2X0FA 2OYRA 4MQ5A 4BUZA 5PGMA 5H16A 1N0WA 3EG5A 3E5HA 2HA6A 4ZOBA 3R8CA 4AG3A 4JDUA 1IOVA 2R62A 5CT9A 3ZVMA 4Y1GA 1U4NA 2O8CA 1FUIA 2CV0A 2WFMA 3TVYA 5I48A 3DTVD 4RXMA 4XRGA 4EO9A 4LJKA 1XZAA 3J80A 1OZGA 1RBZA 4OQ4A 1OXMA 5DN6D 3ET5A 2VEOA 1EVLA 1T91A 4Z49A 1KVUA 4D8WA 2VQFB 2PD3A 5C18A 1OUMA 1VHQA 1JQ3A 1M6YA 2COEA 3VGJA 2OCKA 2WV9A 2EX1A 2AEMA 4N3CA 4CV1A 2PVPA 3NIBA 1DQSA 1D2EA 1IQPA 4JGBA 3OSUA 3R20A 3NWPA 1M2NA 5DV9A 4H77A 4A0FA 4IDCA 3NUZA 4MZDA 1A97A 1YFZA 1XL0A 3GJTA 3NVDA 3UJAA 5G1PA 5HRUA 2QLMA 4OSPA 3BULA 3LO5A 5GONA 4HD8A 3W5HA 1DG9A 1Z5NA 3MJEA 3TR0A 3AUJB 2JFVA 1NW3A 2DZDA 3T5DA 5GP1A 1SMKA 2NYVA 5EKSA 3EAGA 4HTFA 2VVTA 4IHKA 4TL6A 3GRZA 4C4XA 2QX6A 1QCYA 2Q4EA 3ZV6A 1C7RA 5F3WB 3QW4B 821PA 5HQ3B 3AETA 4KXNA 4COKA 1GV1A 1E6LA 2YN0A 3N87A 3OOEA 2A5FA 2AX4A 2GXSA 1P44A 1EGVB 2HDOA 3P9SA 5FFMA 5I9BA 3VPDA 3PPWA 4B73A 1KFEB 3FKJA 2GZHA 1ZP6A 1GGHA 2OV8A 4F21A 2V6JA 4DRZA 2F1JA 4RTKA 1WW2A 3SGLA 4BO6A 4EI8A 4NK5A 3RS5A 4A3SA 2WM9B 2YV2A 4MTLA 1G17A 4PPQA 4DPKA 5ED4A 1L3BA 3B8HA 3RSZA 3AR9A 3Q98A 3EZNA 1Y98A 2AMFA 3L7NA 2ZJ4A 2LNDA 2QGNA 1ULAA 2ZDQA 3P9XA 3K2QA 4EQ6A 2QUBA 2WAMA 3CZPA 1W44A 3RODA 3F46A 4LBWA 4MI1A 5HNKA 3VFDA 3L4BC 2WVAA 1OTXA 3NEPX 3B7WA 1AM4D 4GRAA 4ZZ3A 5B64A 4BB5A 1GPH1 1AKWA 5HGJA 4E2WA 4QEZA 1G5HA 1XVTA 4K9MA 3UG6A 3B1XA 5EXPA 1ZGZA 1BXRB 5SY6A 2RI0A 3WNBA 3ZKWA 3CV3A 4GC9A 1F2VA 1G8GA 1QK5A 3BSSA 3W06A 3G8YA 1X1QA 2BFWA 3PFFA 1P61B 5BPHA 5HWSA 5DFAA 3IHWA 1QZXA 4RWZA 2CXUA 2IHKA 1IWOA 4W5HA 4ZCMA 2IHYA 3KWMA 3T1OA 3T4XA 4MHTA 4RZ3A 4FNOA 1Q14A 1JVNA 3VI3B 4X6UA 4R1NA 1FLVA 4RAOA 2JEYA 3EFHA 4M76B 4RGBA 4BE4A 2GM3A 3ETJA 5HUHA 2FETA 1UOPA 4UHKA 1YZTA 4KH0A 4J7CA 4GOJA 5TMBA 2AOTA 2J7PA 5I01A 1AIPA 1K98A 4FWIB 4PG6A 3AONB 3ABOB 3HN2A 4IYJA 5ALDA 4ZRNA 2SKEA 4WASA 4AJPA 1EG2A 1BVYF 1K8ZB 3C8MA 4BJ6A 3E0QA 4I36A 5AK6A 5LOVB 4YCJA 3ACBA 2IZZA 1USWA 4WJZA 3V1LA 5FEUA 1JR3A 2IOFK 3CRRA 1F8UA 3ASVA 3CZ4A 3TQRA 1CUAA 1SQFA 1V5GA 1K0FA 3G6KA 1UJ6A 2WRZA 1ESEA 3CW2A 2AK3A 3D4PA 3PNOA 2ERXA 4IICA 4PBRA 3V8QA 3V97A 2HBYA 2J5KA 1OB2A 2WG1A 3PVCA 2FP4B 4RIIA 4DY4A 3QFRA 1YQDA 3NHMA 4IHQA 4JR1A 1IPFA 5CBKA 5CJPA 1MHTA 3MB5A 3ELDA 2R7MA 2Z2KA 3ABQB 4YJ3F 1KYVA 2WZQA 4XYLA 1FW6A 4RFLA 3MHPA 2R8RA 1E1RA 4L73A 5E6UA 5A4DA 1R5BA 2H17A 2I8CA 2XIQA 3LY8A 2UZ0A 3ELBA 3S2FA 1QRDA 1ZMXA 4QDZA 1IHUA 4BWFB 1DLIA 3CJQA 3FROA 1LF5A 4UPEA 1L7BA 4POOA 4QXMA 4H7EA 2ODEA 4R8VA 4LOJA 1N6NA 1UWVA 1ZGCA 1UXIA 3TLGA 2YRFA 1FFYA 1MIOB 1OZHA 4PFJA 2WQ7A 3BS4A 1W4CA 4A27A 2Q3FA 3FNEA 3HMQA 4NMHA 4MINA 5SY4A 5IYZB 2HTFA 3GUCA 5IAGA 3F73A 3B7GA 2FEAA 2C83A 3QE2A 4UQOA 2BJHA 1OU4A 3IEUA 5ALXA 1E4EB 3BC1A 3I42A 4MW2A 4BQEA 3D4IA 3C6XA 3S7ZA 4N39A 1NQXA 1NWHA 1X7ZB 4UULA 2VXOA 3G5LA 3T7RA 4BJ3A 1Y6GA 3U7EB 1FDOA 1H6AA 1W35A 3E15A 2NAPA 4BTVA 5K99A 4MRSA 1YVRA 2P9CA 3ZDCA 3RVQA 3IEXA 3ZW7A 1VYUA 3NOVA 4A03A 1NUUA 4BLPA 4L9AA 4BVAA 5HVNA 3AKCA 3EIXA 2Q0QA 2K6GA 3IERA 2B4QA 2PZ8A 2BMWA 3X1WA 2YASA 1NW9B 2VCHA 1UPAA 1XGKA 3TJMA 4DB4A 3AGPA 4KE6A 3RNOA 1EP1B 1RYBA 2H11A 4TL8A 4Z1MD 4FWTA 3UMRA 2JLVA 4RY8A 4AJEA 4MIEA 4P3KA 3LLUA 5DWDA 2RIRA 5HG0A 1EI9A 5BSHA 2BEWA 1QHXA 1MFZA 4Q1VA 3CLTC 4Q03A 2ISQA 3RASA 1CTQA 3TZQA 4PQGA 1G8MA 1VHTA 4C0LA 4FHEA 2FW7A 1BX0A 4JQYA 5DOZA 3FUCA 1HI9A 2IEAA 4PTZA 4QDKA 4B3TB 2PSEA 3MOGA 3HEMA 1XJ0A 2R85A 1RAFA 4P4SB 3SVLA 1R9GA 3IDAA 4BLOA 1KJIA 2PGDA 3PRYA 1WULS 2RMKA 4QWMA 1G18A 3RJMA 3NCTA 721PA 4G9EA 2R1VA 3AL2A 4R8KA 4E6EA 4EG7A 2BFFA 1U0LA 2Z0MA 4LHZA 5FJIA 3TI7A 4BO3A 3IBCA 2G6BA 1Y0BA 1KOJA 1Y3FE 3KOZA 3V5NA 1NJ6A 2BFAA 3EQ6A 5THQA 3QLUA 5B57C 4LZZA 1IONA 1UDBA 2JARA 2I4OA 2XDQA 4Q3LA 5ED0A 4F9TA 5DGCA 3A1NA 4FGZA 3LQFA 4QTTB 3TRDA 3WGTA 4YDQA 1I32A 2XE8A 1R6BX 3DFIA 2QMYA 1B2RA 1MT3A 1ZNWA 2WJ3A 4IEIA 4LECA 2IPXA 4DLNA 2QQ5A 2EDCA 2Y6VA 3IP1A 4FZ3A 1XZPA 4N7JA 2ZPUA 3AZOA 3VDQA 4EARA 3LBNA 2CEKA 1Y37A 1KH2A 2QL9A 3U31A 3U80A 1ZK2A 3D0OA 3H9EO 4KQJA 1KEWA 4BRUA 1H3EA 1X0XA 1NLYA 3ORYA 1EVYA 4U2EA 3H1AA 3JD4A 1CZNA 2C4KA 2QKYA 1U6KA 2H4YA 2ODPA 1KEKA 5EL0A 4Q3CA 1ZK1A 3MVEA 4WPGA 5FBVB 2ZU6A 3MCVA 2JIZA 5B4UA 2XCTB 1SZPA 4KQFA 4P84A 3BWMA 4Z0NA 4C7BA 2MCFA 2O2GA 5K0EA 2LCQA 4KP7A 1ZUIA 3GUUA 1OU0A 1RWPA 4MMZB 2O8CB 1CUYA 1JG4A 1YJAA 4X20B 4XH9B 3IQGX 4P6VF 3OZIA 5FLEX 3AVVA 2CWWA 4H7FA 1NBHA 2AFVA 2QVXX 3EVAA 1O77A 4FN5A 4QTZA 1P9NA 3F97A 1ULUA 3P9NA 1ZEJA 5AM4A 3LF1A 4ZV7A 3T7DA 4WJLA 1FYEA 2JNWA 3BH6A 5FLXA 1Z2PX 1B43A 1VPLA 2YIVX 2QMHA 3BWXA 3M4NA 4R98A 1FK8A 5ENDA 3VU8A 2B7BA 3DDHA 1G9SA 1M6WA 4TXMA 4UBLA 3UOGA 3QI7A 1QSGA 4QC2A 1AB6A 2NTVA 3WNZA 4BFCA 2JIDA 3LX4A 4BNIA 1YE3A 3T7CA 4LTNA 5JS8A 4BCBA 3P9PA 1A5TA 3AIMA 4PHGA 4KYTA 1HG1A 4TS9A 4MW6A 5AW2A 2WJAA 1TAQA 2Q3CA 3TZ6A 4BO4A 4BCDA 2C4WA 2CBGA 2HFKA 2VJBA 4EUKA 3A0UA 3S6JA 4A8JA 1A9TA 1G9XA 1T6YA 1U7OA 3DO8A 4LV8B 3T06B 3EOAI 4BHTA 2W42A 1R74A 1SURA 3IJPA 3ZCTA 4LI3X 4BGIA 4XDYA 3GYGA 3HJBA 5IAJA 5AI4A 5C4IA 1YR2A 2XZDA 3ITEA 4ZYUA 3SWWA 3NTRA 2ZIEA 5JRDS 1CX9B 2OZLB 1P4GA 4Q4JB 4YXFA 2VFAA 2CNDA 4H0FA 4YIKA 3UPTA 2QSUA 1D5WA 4BS9A 3FHTA 3M6AA 4GEKA 1M33A 4ZI5A 2C96A 2O0HA 1CBUA 2W2XA 4JHLA 3UAZA 4TTIA 2RK4A 1USVA 4CG3A 1I9CA 4J0QA 1ZVJA 1HZZC 2PZLA 4QOJA 1PI3A 4DF3A 2E5FA 2HHJA 4RX1A 3KIPA 1VKRA 2FCRA 4U6NA 4R2JA 3T5GA 1T3LA 4ZGGA 3GEMA 1SO8A 2RAUA 4PWZA 1J42A 1PT7A 4QJ5A 1JAYA 1F9AA 4JJGA 1D4ZA 3HU3A 2AQIA 2HQRA 3DLCA 4RTOA 4FFVA 1U5BB 4OB6A 1BCSB 2I6TA 4QBHA 3UJ9A 1VPVA 4DLVA 2ZAMA 3TQOA 5FAKA 4C22A 3EZ9A 1PQUA 2X13A 1MO4A 2XCSB 3HZRA 2JBAA 3QVMA 1ZCFA 4MUHA 1Y8RA 3KXPA 4M1TA 1MKYA 1SBTA 3MJRA 2CJWB 2IZ1A 2ZR9A 3B5JA 2JEOA 4D25A 1Z6YA 1YB2A 3FG9A 3DJYA 1ECJA 2GZ1A 2VTDA 4CKBB 1PR3A 4H1UA 2PKQO 3HADA 1GQFA 3OQVA 4UW9A 1EVEA 5HF6A 5EN4A 2ZIFA 5SV2A 4RTNA 3IE1A 2CUTA 2GPSA 1ID8A 4Y7DA 2VL7A 4GWGA 5DI9A 3OFJA 1YHYA 1BWRA 2PKEA 4V0ME 2Y71A 1TMOA 3BGWA 2GK3A 4KV9A 4ZYXA 1E62A 5FWYA 1GTVA 2C7BA 2G40A 1R0CA 4GQIA 3W4JA 5LIRA 4NCJA 3MCWA 3OOHA 1M75A 3IUBA 1WV1A 4LNUB 4KPUA 5TT1A 4ZU1X 2F9FA 2H1IA 3O21A 3GLSA 4M88A 5FRDA 3KR1A 1YUMA 1WY7A 5CRIA 1T6XA 4LXTA 1CRLA 1NDQA 1M73E 2ZOSA 4TTRA 4UCWA 5T7BA 1UXHA 1GGFA 1ZOOA 1MBZA 4RE6A 3BIFA 3BIXA 3QTLA 5EMKA 5HKLA 1R3DA 1MFPA 3K7EA 3L7DA 1Z74A 4MPPA 4XEUA 5JO9A 1S89A 1WUTA 4IIXA 2Q4OA 1R4ZA 3BKWA 3VH2A 3DAYA 4O5OA 4WOJA 2VDKB 5EPEA 1DC3A 5FUBA 1EFTA 2ZVQX 3ANNA 4ZK6A 1NR7A 2JVJA 4LK2A 4RESA 3F8TA 5C34B 3Q3EA 4CNQA 3U1BA 4E5YA 2FLWA 1JE1A 1GNTA 2Z83A 3HL0A 4RD1A 1Z37A 1N6OA 2Q7OE 1BJRE 2W2QA 3WMWA 5KCZA 1PK9A 5F9MA 4DFDA 3RKRA 2RGNA 3DEYX 1PZNA 1TCUA 3GDWA 4GSLA 4V24A 4BFSA 5NLLA 5LXTA 2DFKB 5TQVA 5A71A 3ZTTA 1NGSA 3BL6A 4MR9A 4P80A 3W9YA 4TZTA 3TB6A 1LZLA 3U2QA 3GMDA 5A7FA 1KU0A 3G1WA 4OATA 5BSKA 1V8DA 1VE3A 2YWXA 4HZUB 3ZV3A 4XWWA 4JUBA 1QVAA 2H2GA 2VSNA 3KDPA 1KH1A 4RGYA 4EO4A 3NAGA 4BN5A 4BIMA 5ALEA 2PZKA 4ZQFA 4D8XA 1W52X 4RSMA 4DCMA 1NBME 2DM6A 3KL4A 2AVDA 4MKXA 1ZLXA 4BZQA 1M6HA 4J1TA 5EFZA 4UDYX 2I7CA 3W1VA 3ZI4A 2R0QC 5CDGA 5FPKA 2J07A 3BDVA 4JVNA 5JNSA 1ATIA 1HE1C 1WHSA 3F5DA 2JHCA 5BV1A 1ZR2A 1XTUA 3KLNA 2ZTVA 1RQXA 1MA0A 4EUFA 1Q7CA 1PS8A 4Z8XA 4FE7A 2NYRA 3TQIA 3PDJA 2RGBA 1S1MA 4RD2A 2Y05A 3VR4D 5BNZA 2GJ9A 3CEPB 2NU8B 2MT9A 4UVHA 3FYDA 2GAOA 2D1RA 2O0JA 1TUBB 1CUIA 2WWIA 2ZRPA 3H9CA 3HFRA 1KMCA 2MSDB 3LECA 4QVKA 3A3YA 3NJ8A 5F51A 2R84A 3N0WA 2VZ9A 1QDEA 1VQ1A 3DVAB 3DV0B 3GFRA 2I3ZA 4UM8B 1V8BA 1Y1SA 3BRCA 4M0LA 3ECAA 4NYMR 1SK9A 3LWZA 3EG9A 4LPSA 2XWQA 3KTAA 1Q92A 2FWJA 2XTMA 4LF7B 3O8RA 2J0SA 3H5RA 3KAJA 1VGRA 4ZAFA 2BT4A 3ETLA 3QITA 1P31A 3MSXA 4E09A 1BDMA 1EZZA 2FFQA 2QNBA 4JJ6A 1VIDA 3CZMA 4WRRA 4BLUA 3NO4A 2DKOA 1XKXA 3M6LA 4LRYA 5EKDA 4BFUA 1G3UA 3N6VA 5BXYA 1KQFA 5LMUB 2ANBA 2ZWAA 4EZBA 3DR3A 1UODA 1A2OA 1H6CA 1Z4MA 1H94A 2IWHA 3H9QA 2O1EA 2O9JA 3O3CA 1NN1A 4YN3A 5J9FA 5BQ3A 1PR0A 2E9SA 3VVMA 2IUYA 5DDIP 1E94E 1I33A 3FVVA 3GP5A 4KRXA 1H0SA 3A9RA 3T54A 3UY4A 1PNRA 4FMDB 3SSOA 2J3QA 3KSZO 1NNLA 4UUBA 5IPFA 4LDZA 1TD1A 1QFJA 2R1UA 1D2AA 3B78A 4YHBA 1KVTA 4BMVA 3P94A 2XNDD 3CM0A 3GJ6A 3VU0A 1GFIA 4R2HA 1XKQA 2FDRA 3T3NA 1JEQA 1ODFA 4ZOQI 4GXQA 3DMYA 1PBNA 4LC9A 3TLYA 2VP0A 3GEBA 4G41A 2WU0A 2BM0A 2HCBA 1NC3A 3GAFA 5JCXA 3LUCA 4HDSA 1MOSA 2J9FA 4I7EA 2W2PA 2RH5A 2ECPA 3PX2A 3LUFA 5LVAA 4GR4A 2JG3A 6Q21A 1N8SA 3QU7A 5J2UB 2XLBA 3E03A 1Q19A 4LCJA 4LZNA 4TUYF 5BVHB 2NWQA 2D6FA 5IKEA 4QYIB 1MC1A 4XLLA 2PMBA 1V8FA 4AQDA 5I7RA 1YIOA 5G0UA 3W3AH 4PINA 2A88A 1G2QA 3BMQB 3ULKA 3ZQKA 4EVRA 3KSAC 2IY7A 1JI3A 1PGQA 4M99A 4UZSA 4ZOEA 4D0RA 5C8DA 2XEXA 3ZBUA 3DM9B 1J97A 1KJWA 1C1DB 4NU8X 5KTNA 2YHIB 4EX6A 3VR1A 4NPCA 1Q5PA 4EF5A 4DA4A 1OR8A 4FNAA 5FUQA 5IAKA 4JXKA 4EM6A 3WFJA 3UK6A 3LPDA 4G5QA 3DXXA 3RVSA 4X5OA 4L7VA 3DDSA 3C6YA 3WL3A 3A2LA 1GAXA 4P38A 3UICA 4R9UC 1YIDA 3EGCA 3IEKA 2PPLA 4KPEC 4LN1A 4LXYA 2D0IA 4MP6A 1YI8A 1PDVA 2EYUA 3EMKA 5G0WA 1QKIA 5BMVA 3OLYA 2WPDA 1V1MB 2XVZA 1QHHA 3A25A 3NTUA 2ACEA 3F7NA 5B37A 1NI4B 1Z5ZA 2FRXA 5AHOA 4EK9A 3A3KA 4G01B 1AH2A 1SHTX 1JPUA 4UXJA 1IN8A 3V2IA 4A91A 2JFYA 3HN7A 2WU4A 4U6SA 2J3DA 1YRBA 2X22A 1ISSA 4HX5A 2EFGA 4JBXA 5IN4A 5LYJF 5FOUA 1GN9A 1NNSA 3TECE 4QU8A 2QQ0A 2YV4A 2IP1A 4M9CA 1XU7A 5AK4A 5BT8A 1XHFA 3FFTA 1L4GA 2WW8A 4Q39A 1RYDA 4HWKA 1NN5A 4UDXX 3OM8A 3X2FA 4EPRA 1IULA 1EESA 3ERCA 3FOFC 4AP6A 1NYRA 1PG5A 1NVEA 3G82C 3QOXA 2J45A 1HETA 4DUPA 1N7JA 2BDEA 3DD1A 3DC7A 1NQVA 2KYRA 1NPTO 2QTAA 3JZAA 3ZGOA 2HLHA 2ZJ2A 4WIAA 3SS9X 4RA6B 4DLZA 1XN1A 1JQEA 2XYGA 1T26A 1TAHA 2QYOA 1PZHA 2P68A 1JQAA 3F2IA 2D1QA 3UK7A 1JVBA 1SVNA 5IJ9B 1DBQA 1HORA 1ZCAA 4PX3A 4JYAB 3PWZA 4J0EA 5I7AA 2R3SA 1NATA 4LNAA 3GLFB 1XZ8A 4L9RA 1VJGA 1WZCA 3UUFA 1EFPA 2MSLA 3HLYA 1JA9A 1XKTA 3N7UA 5K1ZA 3W9BA 4F4DA 3K8OE 1GITA 3FPEA 4KFUA 1VBFA 4TSFD 1B0UA 4JL6A 5DM60 4JWKA 4F9GA 2LCIA 2JFOA 5E0OA 2RGEA 3EPPA 3L79A 4FSDA 4UE6A 2W2OA 4C6RA 5EJ6A 1XRMA 1E18A 5LKRA 1Z28A 3DPSA 3GPDG 3G8DA 1H2WA 3DUWA 4ZC8A 4MJLA 5H3HA 3DKIA 3FUUA 3SX4A 4CMKA 1LEHA 4II7A 4F5YA 1T5IA 4JLAA 3TWOA 1YK0A 1M6NA 2WJPA 2Z3VA 4FXOA 2OP1A 2GN8A 1OI4A 4AKTA 1ADGA 3KKZA 1G38A 1H2FA 4IQGA 4RMHA 1LRKA 2A5YB 2FQWA 4DHEA 1R3UA 3WYNA 4BEWA 1L4KA 4DDMA 1Y5IA 4FHGA 4ISCA 4D6PA 4BNFA 3D4LA 2B4KA 2WHPB 3L0ZA 4N03A 1C7IA 5C0OE 3HU5A 1PZFA 1GYQA 2WYVA 4DR6B 2X8LA 1D5CA 4NOLA 1MVOA 1SM4A 1LBTA 4FQ5A 3VOAA 3CEAA 3KYCA 1R00A 1MAWA 2J0UA 3MS4A 4MVJE 4NV3A 2FHPA 3IMGA 1Z68A 2IEBA 3WLHA 4D9HA 1SIBE 3AYZB 3EH2A 2IXTA 2QRGA 4QD3A 1IZ9A 1WZNA 1IDOA 1VL8A 2PU7A 4YJKA 1X0VA 1HGXA 3S5UA 5CAEB 5KDOA 3KJEA 4CI0B 1G2IA 2ACKA 1K66A 3M4JA 3ZD9A 4G0MA 4FJ1A 1RJ9B 4BVJA 3IV9A 3OX4A 1JQLB 1THTA 4B6JA 1UJ4A 4M98A 2ERCA 5T3UA 3JQBA 4ZXPA 3URMA 4DQKA 1P0MA 2LXNA 1CUEA 2W2TA 2F1IA 5TVGA 3OLXA 4GWLA 3PQDA 1P74A 3LDHA 4UEKA 1SOWA 4C5CA 1Z38A 2YRXA 3NC1C 2F1RA 3AEYA 3QVKA 2DERA 3BXZA 2Y4OA 4RUKA 1P1CA 4HQ6A 2B1RA 1HH4A 1KO1A 3AG6A 1T4CA 1SU6A 4S1TA 2I7VA 4J1QA 1HBJA 5ALGA 1SUFA 2FE1A 4LHVA 1SR8A 4E70A 3QF4B 1ZM9A 2Q6OA 4ECAA 2CYAA 1ZX1A 4NHEA 1A2QA 3C7CB 3GEEA 3FHCB 3M83A 5IXYA 4MWCA 4ME6A 4YXWA 2O3TA 3OE7D 1T9BA 4EWLA 2J7PD 3HVJA 2VS1A 1D8TA 4RPLA 1IJFA 1JQBA 2HZBA 3DEIA 4BNLA 2EG5A 2ZJYA 1RXSA 4KQGA 1GG5A 3FPSA 2VTKA 3QFHA 2ZXFA 2C84A 3F67A 4IY1A 5GJBA 4L4UA 3ZCPA 4CKEA 5MDHA 1DOHA 1HZZA 2X5OA 3CNEA 3TMAA 4RZSA 4P3XA 3EFEA 2FWNA 2VTEA 4K40A 3NRBA 3OUZA 2XUHA 1U2EA 2EATA 4BNKA 1GKYA 3PNMA 2HMSA 3PR1A 4X63A 2XTZA 3H1BA 3L40A 2RGYA 4GLBA 3UHPA 2GLUA 4RTSA 4TM7A 2ZJ8A 4RVOA 4XWKA 2OB1A 4H2DA 2AWNA 4ZDWA 2I78A 3SC2B 5K0LA 3LSYA 2DSTA 2CUKA 2HXGA 3OPNA 2AS0A 2IHTA 4MQLA 4U7WA 1P4RA 4PCUA 5DHFA 4LE1A 4YV7A 3VTAA 3RYHA 3ZXYA 4X6LA 4DUGD 1C0IA 1L6RA 2OKCA 1LC0A 3DYIA 4CFZA 3ZCUA 2QGFA 4MVJG 4B81A 4G4GA 2IS2A 1JIIA 5IFLA 1OIXA 4BQQA 1Z0AA 3UC9A 3OM0A 1DIBA 3PC7A 1XDZA 2GHRA 1O94D 3ZG6A 4PPGA 4QGSA 3BEOA 1PGPA 5C1DA 2IXAA 3NUGA 3D6FA 2CY0A 4YAWA 5IEBA 1R1DA 1E32A 5C7OO 2PH5A 1QH8A 3CB4A 3DB1A 3QJYA 5I7VA 3EPKA 1ZZGA 1KC3A 4MMXB 5CFOA 4MWOA 4CMEA 3SD7A 2ZYGA 2KPOA 3TIVA 5L95A 1K5PA 3WLEA 3PF8A 1YS4A 3T5TA 2PJRA 3A1TA 1GNRA 1T10A 5EQFA 4DAOA 2BGMA 4L6AA 1NN3A 3DA8A 1Z8DA 3BCRA 3FCYA 4YI5A 5ELMA 5BYAA 5GGYA 2BLLA 3T0FA 5C80A 1FP4A 1JKJA 1QF9A 4EGSA 2IDZA 5ITSA 2XYVA 1G20B 1ONNA 4AUEA 1R0KA 2OECA 2Z6VA 2AIRA 1JHRA 4EHJA 3TOXA 5AJTA 4YUYA 3RUIA 2RK3A 4QXRA 3MINB 2GZAA 1D2RA 1XLTA 1IZ8A 5KHAA 2HYDA 5FT9A 3K0SA 4JXXA 1VB3A 3WBKA 2JGEA 2LE0A 1K7YA 2WKRA 4FEYA 1T6BY 3ONEA 4C07A 3O4IA 3HVRA 3K1TA 4JI2B 1SBNE 1KI3A 1X13A 2IDMA 2XB8A 3LYUA 5AHKA 1Z5UA 5HUQA 2WSIA 1W76A 1LBIA 3LC1O 3LXUX 4K9OA 3FPHA 2YIJA 3GCDA 4W4TA 5AJZA 3U5ZB 3T4UA 2H5IA 4X7MA 3SG0A 1QZZA 2W9XA 4NJMB 1XROA 2Q9CA 1L5WA 2FPIA 4UUOA 5C1IA 1KI8A 4G3XA 4JBNA 1A71A 3NETA 4DCJA 1PL6A 2V3VA 4BN0A 5BWMA 2C1ZA 2Q27A 2HO5A 4WGGA 5CVJA 3ZDEA 3R3ZA 5JISA 3COWA 2CDAA 5H68A 4Q12A 2OLEA 4OD0A 5IBQA 3LXMA 1O97D 4OU5A 4DY6A 2CXXA 3B7PA 4GYJA 3E2IA 4QYTA 4FM9A 3UMBA 3N1UA 5J2TB 2D5CA 4OGWA 1CVIA 1JYFA 3CQ9A 1IZ7A 2PUTA 3P9RA 3GGSA 1TTQB 4IFIA 4MR8A 4NL4H 4OGFA 5G1NA 5B1HA 4CU2A 2VLBA 4H18A 2PZMA 4Q47A 4UNIA 5JAHA 3IIKA 3ZEAA 2XUPA 2AFHB 3KKNA 5EJIA 4A26A 5HQTA 5JSZA 4YRTA 4E03A 3FW1A 1FYWA 5JD6A 3CLVA 4BFVA 1Z45A 3IP8A 4IXNA 1T4MA 4JI7B 1HDEA 1KDPA 1U3CA 2QPTA 3GRFA 3SC4A 3IR7A 2R48A 2ZYVX 5CLQA 3D7RA 4Z51A 1M34E 1KMHA 2I99A 3DULA 4G36A 4GR9A 4BCCA 1LC3A 2JFGA 3DZKA 3I9NA 4RCZA 3P2EA 1O6FA 1Z0FA 1Z0KA 2JAUA 1UFOA 3PNQA 3PXUA 3RM3A 4OQLA 4C04A 1LV8A 3PQEA 4MQFA 3RBXA 4O0MA 3WJ2A 1EUCB 4AJ1A 3W3ZB 4X8HA 2DBRA 4CL8A 1UXJA 2PBRA 3EXG1 1YL7A 4QQNA 2ZB7A 4MVJA 4NAHA 2D8MA 3FPAA 1CV2A 3F3SA 4AY4A 1PFVA 1FFCA 3DL4A 4REQA 1KMNA 2J32A 1QGUA 1EHYA 1F9EA 2QVGA 2SCUA 1Q1BA 4M7OA 5EEGA 1Y1LA 4BZWA 5HIKA 2YN2A 3BRQA 2QUJA 3VR2D 2CLCX 3JQ7B 3DEJA 2JJQA 4OOEA 2C03A 1E6WA 2BY4A 3M7IA 3TTXA 4D41A 1ZD3A 3RS0A 1JWBB 5C7YA 4HS4A 4NU6A 1V8OA 3ILVA 2VHYA 2NZYA 1E3QA 1P0IA 4OLBA 3LUGA 2I87A 2HA5A 3QXJA 4UE2A 3SLRA 2H7YA 2IF0A 2ATIA 1LS1A 3HXOA 4FCVA 5T64A 2XDWA 4EB3A 3YASA 1YHZA 5KZMB 4BFLA 1GPAA 3WX0A 2ANCA 1JLRA 1YB5A 1CUBA 3EDYA 4P31A 1XZQA 2XA2A 3O47A 1JF8A 1UK9A 2CCKA 1UBGA 2J48A 4EPVA 4JMLA 3K0AB 1GQOA 3GNTA 3R5HA 5BXQC 5EE1A 3P96A 4BLQA 5JS1A 3RYCA 2QZZA 2EF1A 4HYQA 5DNCA 1NY5A 1RJ9A 1FSFA 1DC7A 3WK9A 1QIKA 4DGQA 1IG0A 1OXXK 1W6RA 4GVXA 4IF4A 4UEWA 2XQIA 2TMYA 2ZBDA 2JLYA 1U63A 2IZ6A 3H8JA 3I45A 2PIDA 5HTKA 5ITZA 4PLCA 4CEIA 3H1EA 2QU8A 3PKIA 5F1KA 4KN9S 3AUYA 1SXHA 4CR8A 2XB6A 2IA5A 4C29A 5LQAA 2D7DA 2H8KA 1MENA 2YYYA 5KVQA 3WFIA 3EWNA 2X4GA 3AW8A 4F4FA 2DX7A 3WIEA 3ZW8A 4JLKA 2P5YA 7YASA 4ZT2A 3EXHA 4JROA 1SZJG 3JQFC 3KR9A 4WY5A 3LX5A 1KAQA 1MJFA 3WO1A 3AVYA 1WCXA 3LCUA 4OHFA 4IIVA 5DRYA 2X8BA 3R7DA 2C5BA 4GYKA 3BCUA 2ZSAA 3ESXA 2O05A 3H16A 4R51A 2EGUA 4LQDA 4HKTA 3D8HA 3QIVA 4B6EA 5FNVB 4OFXA 1AQYA 2XAUA 1J9EA 1G3RA 1H2EA 1RC0A 2ZIWB 3HB9A 3SBEA 1B1AA 1NKVA 1NZJA 3SQOA 4WFIA 3WWPA 1L5HA 3RD5A 5GJVC 1YIAA 4FBGA 4MUNA 3DPUA 3ACDA 4C5BA 5KSWB 1YFLA 3UQZA 3RYIA 3QVTA 1ZH2A 3OZSA 4CN8A 1FXSA 1GNLA 1K97A 1KHHA 3IVRA 4UDNA 1E0SA 3H6GA 1E5LA 1DO2A 4KXWA 4WLEA 3WMXA 1II8B 4ER5A 4KWEA 4BNGA 3OPMA 3SS8A 2AI1A 1PVDA 3LZ6A 3SAJA 1LH0A 2A0XA 3TDMA 1H8ED 1ZJZA 4OUKX 2UUPA 4Y2HA 4ALNA 4C2BA 3EQ7A 1N1GA 4ILKA 3L8FA 4DYDA 2VQEB 2UUBB 4AZSA 4CETA 3G2HA 1DJPA 3D6VA 1RPAA 1EMDA 1UC5B 2J85A 3KFLA 4KAAA 4Q1AA 1Z7EA 4I3HA 1JFSA 5H82A 4D4IA 3V4LA 3LPAA 4J49A 2W48A 4L3WA 4V03A 2WK1A 2OWDA 4FOSA 2VJAA 2AJCA 4YRNA 1I6WA 2MMGA 4KU4A 5ALUA 3WDKA 1IIRA 1NTOA 4N6GA 4TMXA 3ZCXA 4D82A 4F5ZA 3CFYA 2WF9A 3DT6A 3Q7RA 3QHPA 4UNRA 1ZK3A 3WGHA 4C05A 1EFRA 2ZP1A 2RAVA 16PKA 3WK8A 2R1TA 3G59A 1QOZA 4POAA 4JC4A 5IVPA 1LDGA 2KB0A 3NTXA 2F3QA 5GONF 5HFAA 3K9CA 4W1SA 1AUVA 4WOBA 1T2DA 1X7YA 2AOTB 3OY7A 4OQXA 2IOYA 1L7RA 1RXEA 1ZG3A 1LFAA 1HZJA 4IM7A 4R1MA 2D1YA 5AVXA 4EAQA 5EKTA 1GADO 2BTQA 2VPIA 4KIUA 5DULA 3QMMA 3GPIA 1QP7A 3CRMA 1SEVA 2OHJA 3EASA 1YF3A 1ENPA 4ZYWA 1QQTA 4D8TA 1GPKA 1RI3A 4E13A 4ZHSA 3U3MA 4R05A 5T4FA 4NE9A 3SN6A 3M6VA 3G3EA 2WKQA 3N75A 2GTHA 3N74A 1KVQA 4H7JA 3OEED 1CUHA 2I3BA 4UJ3A 1JWAB 2DQSA 3HRIA 1RT9A 4QU5A 3NWJA 5BSVA 1SCAA 1DRVA 4XGKA 4QPCA 5F4ZA 2XB4A 3IV7A 3S2GA 1KP2A 2GM4A 3QPBA 4CQJA 3WMGA 4BVKA 5KNCA 4KODA 1MXHA 2QRMA 2A5GA 2OWEA 1RCUA 3BE8A 1NUSA 3HEBA 3T41A 1IATA 4H6VA 4QUAA 3VZDA 5A03A 2CSUA 1OT3A 2WMOB 4NBKA 4X6YA 1N2CA 1QH8B 2WWHA 4TKZA 1DQYA 2AN3A 4M8IA 4MLCA 4B31A 4ZHQA 1RHRA 4RZIA 5CFQA 2Y2VA 4UASA 4KK3A 4LDPA 3T3HA 3ETEA 2UVPB 3D2LA 3LRPA 2V6MA 3E22B 2P3QA 3R3JA 1TPYA 2XT9A 5IKXA 1YZQA 3U7GA 1EUZA 2DULA 1E9DA 1QQ6A 3ZWVA 3Q7PA 3P7MA 3V46A 5K03A 4PCVA 5EP4A 2WDPA 2GZMA 5AP9A 4CTMA 4DSAA 3SHOA 3JVIA 1E20A 2BEWB 1BIFA 5L3VA 1PT5A 1N2OA 1AHHA 3DLBA 1C9NA 3O9MA 5FPTA 1CRPA 4C7XA 4P35A 3PFCA 4BX8A 2WYOA 4K0RA 3WGOA 4JBLA 5HQ3A 2PGNA 2Y1DA 3DAHA 3I76A 3P9IA 1UK8A 1M2VA 3P2KA 4GX1A 4HK4A 1XA3A 2R5NA 5L53A 4NCBA 3UA4A 1YQTA 4KWTA 4DXHA 1E6UA 3OFSA 2GILA 5C3UA 1HT0A 4ZZIA 2Y1CA 5TGDA 4DCGA 1PR2A 2FEPA 2R8PA 3I09A 5D3QA 4NDAA 5KYXA 1NL3A 1PR6A 4A92A 3H2BA 3PGJA 5CH3A 4MO9A 1W4BA 1OIWA 2XF2A 3CH6A 3JU3A 1KY2A 5CXXA 1S0UA 3SHVA 2P6RA 1VSUA 3LV8A 3N59A 3PZRA 4OSOA 1L1RA 4YALA 1NSTA 1O9HA 4TT3D 5CW2A 5ALMA 1UFRA 4FCTA 5DBIA 1E66A 3C5EA 4PSUA 4UAJA 1KO5A 2JANA 1XAHA 1EFHA 1MQ9A 3MTAA 2IE0A 1W9HA 4WEOA 3TE7A 2SNIE 3NKVA 2G5CA 3K9NA 1Q6YA 3ZY5A 4UUNA 3DHYA 4LNUA 3V1KA 1H65A 1KR2A 4BVFA 4PPNA 3F5FA 4D9BA 5BVGB 5MFPA 3CRW1 4YRJA 4MS4B 1ZIXA 4X7BA 2R4QA 1E2JA 1GQSA 2YR0A 2I2WA 3HDYA 4QFBA 1LWOA 2QY9A 3FTEA 1KNQA 1ZK4A 2XUZA 5FWXA 3H86A 5C5EA 3EGVA 4LGMA 4CM6A 3H17A 5CAEA 3HHEA 3QF7A 1KMQA 1MRSA 2IELA 4JLVA 2I0FA 1M74A 3W5DA 4HYYA 5DF1A 1P19A 4CM4B 2H2AA 4MICA 1SC1A 1GAEO 1NF9A 1SKAA 3F9CA 2ONZA 3MM4A 5FI5A 3DKKA 3PBKA 1WUYA 2ODQA 2PKCA 3KUKA 4Q9HA 1ACLA 4RNDB 5GPBA 4NONA 2ATXA 3TLXA 1X3SA 4P7BA 3I9FA 1NE2A 2EBHX 5CB4A 1Y7IA 4R6XA 2Z2YA 5C53B 4ND1A 1WBBA 3R24A 1YB4A 2RH8A 3PEYA 2FX5A 1X86B 2GJ8A 3AHFA 4ENPA 4DIUA 1EK6A 2B6NA 5I9NA 5KX5B 2GK4A 2Z6QA 1W88A 3EIFA 3ISVA 1IQUA 4R5MA 4HXYA 4K9LA 1ZXXA 3OD5A 2G9QA 1PJAA 3DLPX 2GCPA 3FETA 3ZTWA 3QENA 4JLSA 2BM1A 3IR5A 5ALQA 2I1QA 3W2FA 2GHTA 3KR0A 5HDBB 2FRDC 1V43A 2QVCA 2OFPA 3ZDDA 1CY4A 2AG8A 3P4XA 3ZWOA 1OHHA 4D9GA 4C0QC 3W77A 4I66A 3X44A 3U49A 4WZAB 4K2AA 3VNRA 1ESMA 1YRWA 1UM9A 3WNDA 2FPLA 3NFRA 4P22A 2WSSA 1Z0IA 2QNIA 4YQEA 1RE0A 2R9VA 2VBGA 1HOTA 4LHYA 3UZUA 4KPGA 1PJTA 5B6PA 2IUSA 1ZUD1 1NC1A 3L6BA 2H1FA 4OJYA 4WQMA 5CIWA 2QAGC 3OIFA 5GV8A 4GUDA 4LZLA 1MGOA 4HEHA 3ZIUA 4IWYA 3WGLA 1NBOA 1QPBA 2WUFA 4JFAA 5CHYA 1BMFD 3PK0A 3K96A 4HAOA 4P3OA 4J3FA 4MHOA 4ETWA 2QV7A 3ABZA 5FBKA 3OU2A 1NW5A 1XD2A 1FRQA 3UK2A 1FLAA 4BKRA 1OX4B 5B36A 3UF0A 1NBWB 4KQ1A 2FSGA 3N86A 1TF5A 4MCIA 3QKRA 2P4UA 1TYZA 1MX9A 4RVNA 2A5JA 2H4JA 4E1AA 4ZAGA 5LDDC 3WOHA 3CLHA 3GDGA 5EZYB 3EGOA 4NBNA 1E5TA 1X9GA 1S3FA 1B8NA 1IQ0A 2DRIA 4NAVA 1ICEA 1CFJA 1YZ3A 4GOXA 3WV5A 1D9ZA 3KQVA 4PYOA 3PQFA 2WHYA 2IT1A 1I6MA 3ESAA 2BISA 5DASA 2W8ZA 3SU8A 3G2LA 3HM2A 1KQPA 1ZI6A 4YQZA 3R76A 3DE7X 2RGCA 4HDMB 2GK6A 4OHMA 4FX2A 1KXZA 2JBHA 5CFLA 2HF2A 2O5EA 4BFTA 2WNIA 2A9OA 3CW9A 3P2OA 2CBXA 3S0JA 4QT4A 3GMIA 2HB6A 5KNBA 4GPD1 3QPDA 1CZKA 4IQ4A 3S1SA 5FDFA 2R6HA 1CUDA 3PXXA 3GJ4A 4RPHA 3ZXSA 5ITWA 4E31A 1K7XB 2Q2OA 4MVJM 3L8CA 4EJSB 4E15A 3WJ1A 4G4SP 2DT8A 5CCBA 4QM6A 3G23A 1E64A 4XIFA 3T5MA 2J9XB 1QG0A 3IXQA 3PKJA 5DM0A 3VNVA 2Q6VA 4QOHA 2VEDA 3OWXA 4JQOA 3UAOA 1PFKA 4ACAA 2WB2A 4LVNA 2EHDA 4PAMA 5CTJA 1YOVB 2PCJA 3WLOA 2R6FA 4BKUA 3G8BA 3QSGA 4GP9A 4OMUA 1NP6A 4GDFA 1S4QA 1CB7A 2K5UA 4HLQB 3CNOA 3S8EA 1G2PA 1Q15A 1EA5A 4HH3C 1X92A 2H9YA 2WAYA 4MYSA 1APBA 2QGZA 3VYRB 2X7XA 3K16A 4CF3A 2UVQA 4D9JA 4FIZA 4Q1BA 3J7AC 3HB7A 4MV7A 2I8AA 2M9MA 3UXHA 4EW6A 2PEZA 1P33A 2GPNA 3G9UA 4BEJA 2CLIB 2QJRA 4Z7NB 3ZXIA 3KL2A 4GMGA 3GNLA 3EEBA 4TLBA 2J0UB 3QRWA 2C9OA 3C1TA 1N4DA 2D06A 1V1RB 3O1JC 5G1OA 4YRLA 2P41A 3EZ6A 5H9VA 1EDBA 2OPBA 4AL4A 2Q3DA 1PD1A 4II3A 1KPIA 4RVFA 5UKDA 4G0WA 1YZNA 1PHRA 4NR0A 3EDRA 3OJXA 2PAFA 621PA 2I7DA 2JI9A 2O3UA 1QOPB 2A9JA 3IEIA 4L27A 3SYKA 4KFCA 1JFFA 1VA4A 4ZTBA 2H0RA 5K0SA 4CCYB 1E1NA 4QSMA 4PYNA 3P0FA 3L0OA 4N7BA 3C8DA 4X8OA 2ZPAA 4W1QA 3ZDZB 1QCZA 3EZ7A 4BV3A 3DWGA 2YW9A 2OG1A 1SH7A 1U80A 3AHJA 3VKUA 1HYBA 4GP6A 4I2NA 5AI5A 3S2IA 3A1SA 2I2AA 2SCUB 3DH0A 1R6UA 5HYVA 1PIWA 2BZ0A 4YDHB 4K03A 3BB1A 5KJEA 1GKKA 3WMRA 1PG2A 1Z4IA 3L6EA 1AN0A 1HDCA 2HMUA 4RK4A 3WYGA 5KNCD 2DC1A 4PXAA 4ZEXA 4QULA 1PR5A 3EVEA 1FA9A 1G21B 2A94A 3B3QA 1TZKA 4D4MA 2CGEA 1O6BA 3EG9B 5BMOA 2QYHA 3AF2A 3WK5A 3NVKI 3DAPA 1JDNA 5FORA 4BQIA 4ECEA 3AF0A 3PXDA 1Z5VA 3O38A 4I2VA 3OX1A 2PT9A 4RD6A 4DNOA 4LCBA 1DPFA 3QBDA 3NHPA 1P1JA 4GPIB 1L4BA 1CQZA 1L5OA 2AV6A 2CE2X 1ESNA 1U8UA 3PHCA 2PWZA 4MZXA 4ZHQB 4B46A 4QZVA 4ZJUA 4G2TA 2Q28A 2QUIA 2WWXA 2MOKA 3QBTA 1XCJA 4NBLA 4CQLB 2PWPA 3H5IA 2JGLA 3ZY4A 2VBCA 4XX0B 4X7PA 3IHTA 3PNPA 4OJNA 2E3JA 4ERNA 2R6DA 1GGNA 3CXUA 5EGNA 3HY3A 4NXMB 4EA8A 2ATCA 4YAKA 4DG5A 4RTPA 2IXEA 3E70C 4A1OA 1WHSB 1TEHA 3V1UA 2YWBA 3PPXA 2G7ZA 3L77A 3ZK9A 1NI5A 2PSFA 3D8NA 2ECQA 2GFQA 1GTG1 3CWQA 3EIOA 3HKCA 4LMAA 4JUFA 3KWFA 3NNNA 3RJTA 3EWAA 2X3UA 2H4WA 1E1CA 1OKKA 1SQ6A 3DOEA 2IBMA 1V2GA 4JGGA 5TPZA 3VPXA 2A9QA 4IV0A 4UHHA 4I8XA 4UUPA 3K1ZA 2HV8A 3MC1A 4C87A 1FTNA 5JO0A 1Z35A 1T1IA 4GX5A 1T8TA 1GPLA 2C5EA 3DDNA 4Y1FA 1D1SA 2GTPA 3NBMA 5E8RA 2EIHA 3SYNA 3ZNPA 2K7ZA 1GRRA 1T9ZA 3OCYA 1KDTA 3RYFA 1Z34A 1KO8A 3LBHA 3USCS 4ROTA 2R8EA 1CNFA 2PZAA 5IMBA 2OR3A 2NXJA 2PL1A 3FWYA 2VRWA 5TJHA 2RONA 4TSKA 4FB5A 2VYNA 2P6NA 4CIVA 3F6YA 1L4HA 1DCKA 1XZDA 2XUFA 3CJTA 1RLJA 3JR3A 2ISCA 3AUUA 1IHYA 4TS4A 3WWCA 3CEHA 3LD9A 4YA6A 1O95D 5JCJD 2HHHB 2HDNB 1SUDA 3A2MA 4KR3A 3L6UA 4UTNA 2GZDA 3IAEA 4GOLD 2QD1A 2H7CA 4GMDA 4MS3B 4DVGA 5JZOA 3R9XA 1F38A 2FZCA 3D6NB 4I4TA 1MEEA 4FYKA 1YE8A 3F2VA 4Q16A 1ESDA 3OWHA 4Y9RA 1XR3A 1MVNA 2WJHA 4PQRA 1RPTA 2Q5CA 3DOFA 3EVGA 4TRJA 3WNVA 5BNTA 5KWIA 3I9V6 1G21E 3OA0A 3ZWNA 1XPUA 4ENUA 1G8SA 1JDVA 4HQNA 4C0XA 3UBMA 2PH3A 1PNVA 4F60A 3JAWA 5JQGA 2QI9F 3QKSB 3BF7A 1VBKA 4M9ZA 3ES9A 3OBIA 4YP1A 1UXGA 1V7QA 3PFGA 5FXMA 1Y6ZA 4QYMA 1CR4A 2Z98A 1V5IA 3DJFA 3SNHA 1NQTA 5KOIA 4AJOA 3PXAA 4TMFA 4DMUB 1GPYA 3H1TA 1NVXQ 2BTQB 3K31A 3KV1A 3AWIA 3BDIA 4EYKA 2Q41A 3EGXB 3JAKA 3PNKA 4Q0MA 1ZJ5A 4FFLA 2W6IA 1Q1AA 4PR3A 2VNIA 3GEGA 5IUJC 3ANLA 4OHBA 2ZAIA 4M36A 3KUXA 4O1HA 4U1RA 2DBVO 1N4AA 5KUTA 5DNWA 5HIMA 1ZVQA 4XR9A 4FFDA 4PXYA 2EZ4A 3LXXA 2OC9A 3RVKA 4P4GA 1YR7A 3MJCA 4JL8A 3CX6A 1IN5A 1KF0A 3K0FA 4X1YA 5FUVA 2OT3B 4N3NA 3VPBA 2OCGA 1P4SA 3GD5A 3D59A 2F1KA 3ZN2A 5HW0A 4C0KA 1T3HA 2V55B 3HWX1 3QPWA 1NI3A 3F3KA 5GONB 1CNEA 2HJSA 5LZ4A 1C1HA 3QSYA 1CR6A 1ZAKA 3VV2A 2HCRA 4ZIRA 1IXZA 3L6RA 2OK7A 1HQCA 1QIHA 3EWIA 4XJTA 2RHDA 1DIHA 2WUWE 3NHLA 4F84A 1GSHA 4LC1A 2AEJA 2Z3WA 3UJBA 2H16A 2H2FA 5GVSA 1QH1B 2EWWA 4RVSA 4UUQA 1IRIA 1T2CA 3ZGVA 1NXOA 1DBIA 4I9GA 4AULA 3EXFA 1MJHA 1RXIA 1D4AA 2DPMA 1CB0A 4ZQEA 1SCIA 3MTGA 1AKRA 1EINA 4FEAA 5TPZD 4EG0A 4FFPA 4BRSA 2PUGA 2NPOA 5K45A 3VOTA 5AKIA 3IBYA 3ZGLA 3WJ7A 3L46A 4FVTA 5F3DA 5A05A 3SYLA 3ZHYA 2NQTA 3SJBA 2FRVA 4LGYA 1P77A 3KBBA 1OC4A 5ECDA 3EPRA 3EZ2A 4NENA 4F7WA 1CQPA 3U40A 1YH3A 3LHIA 1Q2XA 3HU2A 4TKLA 5IJXA 4PYMA 1H66A 3JVUA 2ON6A 2YJZA 4EQ6B 4N48A 1J2RA 2PGXA 4AMUA 3ESDA 3O8OA 2C8JA 3CINA 1XZCA 2ONKA 1E69A 3ESQA 1Z17A 3MT0A 3ROZA 1QRUA 1GPDG 4IDEA 4R16A 1GKLA 2V7BA 1YJ8A 2R68A 1U0TA 3FOAA 2ZROA 3M33A 1EK2A 3TLMA 4EW1A 3IOBA 3Q11A 2AYZA 1B7GO 3X2EA 4EKNB 2AK2A 2P9JA 1MO3A 1LTKA 1H5QA 1YL6A 2JKVA 2XVMA 4HDMA 3ZU2A 5CVDA 2HD4A 2ZATA 3AEUA 5AVJA 3SR0A 1D09A 2BI7A 2C2WA 3EGDA 4R2LA 3TEMA 4XRRA 3NB0A 3OTGA 5DKFA 3AO0B 3PFKA 2ZI3A 5EOVA 2VCYA 3RS9A 4X20A 3HJCA 1L1QA 1U0BB 4BMYA 2CFOA 1TCVA 4LZWA 3IIEA 4EF4A 4FGWA 4NQRA 4G1VA 2AF3C 2Q1YA 3ZDAA 2CBZA 1YRHA 4YPVA 1JR3E 1A04A 4J2OA 3TDKA 5D7BA 1LX7A 2FMUA 3L0PA 1AHPA 3TLCA 4C4AA 1J33A 1UADA 3KWLA 1XTTA 2HLDD 1KK1A 3D7MA 3O1IC 4IJ5A 4Q3OA 1U9YA 4JUAA 2V4MA 1YKFA 3KQMA 3BK2A 3CSDA 4MYTA 4BU0A 2DH5A 1XAJA 5J43A 1J0BA 2VKQA 2FV8A 4YROA 1W73A 3PDIA 1WVGA 3I2JA 1CQIB 3JWHA 3AESB 1TYEB 2CUNA 3GWGA 1US8B 4Q9AA 4KNWA 4DNQA 5HS6A 5IC4A 1QVZA 2EWVA 2XSZA 2Q7DA 4R1UA 3QUCA 3G8AA 4XOUA 1ACJA 4GXNA 4C3VA 2BKVA 3QEMA 1CY7A 5JSKA 1VL2A 1FNMA 5EG5A 3RG8A 1HRKA 2Y8EA 4IR7A 5HZMA 4L8WB