1FXUA

Purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
278
Chain Sequence
b'GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
molecule tags Transferase
publication title Calf spleen purine nucleoside phosphorylase: structure of its ternary complex with an N(7)-acycloguanosine inhibitor and a phosphate anion.
pubmed doi rcsb
total genus 86
structure length 278
sequence length 281
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fxuA00
1U1DA 1TGYA 3KVVA 4M1EA 1RCTE 4GMHA 2AI3A 4TS9A 1TD1A 4G89A 4QEZA 1JDSA 2ISCA 5F7JA 1N3IA 1WTAA 1JE1A 1LVUA 2QSUA 3ONVA 4GLJA 3INYA 2QTTA 5F7ZA 3KHSA 5DK6A 1ODIA 1PR6A 4OY3A 5F78A 4WKNA 1PF7E 1A69A 4YNBA 3F8WA 1Z34A 2RJ3A 3FNQA 3EEIA 2AC7A 3KVYA 3E9RA 2A8YA 3GB9A 4LDNA 1Z33A 4JP5A 2I4TA 1TGVA 4PNPA 1ODJA 3PHBE 1U1GA 3LGSA 3O6VA 3QPBA 1Z36A 4F3KA 1K3FA 1A9SA 1Y1RA 2QDKA 1K9SA 3UAXA 5F76A 4DA0A 4NSNA 4D98A 4TXHA 4F3CA 3OF3A 3FOWA 1PK7A 4P54A 2ON6A 5CXQA 3D1VA 2P4SA 3OPVA 4OGLA 4WKPA 1RXUA 1V3QE 3NM5A 2A0WA 3UT6A 1SQ6A 1TCUA 1PR0A 3NBQA 1OUMA 1K27A 4D9HA 4UC0A 4KN5A 4OF4A 3BGSA 3DPSA 4OEHA 3OZBA 3FB1A 1A9OA 1RXSA 2AI2A 5F7OA 3OCCA 4ECEA 1FXUA 1Y1QA 1Q1GA 1U1CA 5F77A 1PR1A 4L6IA 3OZEA 1JP7A 1A9RA 2HSWA 4L5CA 1Z5NA 1RT9A 2AI1A 1RYZA 1B8NA 1TCVA 3DF9A 1OV6A 1T8YA 4OGKA 1ODKA 1RXYA 4TXLA 4YJKA 4LNAA 1OU4A 4IP0A 1PBNA 4TTJA 1T8SA 3P0FA 1Z35A 3KU4A 3E9ZA 1B8OA 3DDOA 1SJ9A 4U2KA 4LZWA 3EMVA 5CYGA 4DARA 1C3XA 2OC9A 3EUEA 2HN9A 1A9TA 2IQ5A 1ZOSA 4QATA 3NM4A 3PNSA 4BMYA 1YBFA 1ZL2A 1V45E 5CXSA 4GKAA 1CG6A 4TTAA 1RXCA 3DP9A 1PR5A 3GGSA 1ECPA 2GUWA 2OC4A 4JOSA 4RJ2A 5B7NA 4LKRA 4YMLA 4D8XA 1VMKA 1LV8A 3FUCA 4YO8A 1YQQA 4NY1A 4QAQA 4DA7A 1YRYE 4L5YA 1Z5PA 3BSFA 4DANA 1T8RA 4F2WA 4BN0A 2HRDA 3OZCA 4D8YA 5EFOA 4GLFA 1LX7A 1PW7A 4F1WA 1Z37A 4TYMA 3FAZA 2A0XA 3OOHA 4R2WA 4MCIA 3LA8A 4X24A 3OOEA 1NW4A 2H8GA 1JDZA 1V41E 1I80A 2I8AA 1JDUA 4R2XA 4JWTA 1V48A 2OXFA 4PR3A 3K8QA 5FAKA 4F2PA 1OTXA 4DABA 4L0MA 4FFSA 3EUFA 1Y1SA 4E1VA 5I3CA 1YR3A 3ODGA 5EPUA 3MMSA 4WKCA 1T0UA 5B7QA 1U1EA 4TTIA 5CCDA 3PNPA 5CYFA 4QASA 1G2OA 5JPCA 2PGAA 1V4NA 4LNHA 1A9QA 1CB0A 3DJFA 5ETJA 1T8WA 4DA6A 1RFGE 3K8OE 4NS1A 4EARA 1OVGA 3IEXA 2A0YA 4TXMA 1NC1A 1Y6RA 3KVRA 1PR2A 3UAYA 1V2HE 1NC3A 1Y1TA 5IU6A 1VFNA 1QE5A 4TXNA 3IOMA 3MB8A 1A9PA 1Y6QA 2OECA 4OJTA 5B7PA 5IFKA 1ODLA 4QFBA 1M73E 3OZDA 4M3NA 4DAEA 5C80A 2B94A 1PR4A 3PHCA 4R31A 2Q7OE 2QPLA 4DAOA 1ULBA 3O4VA 3UAVA 5CCEA 3C74A 3T94A 3FWPA 3BJEA 2QTGA 4L5AA 4MARA 4G8JA 1ULAA 1YQUA 4WKOA 1SD1A 1JE0A 3UAZA 1JPVA 4M7WA 4TS3A 5KB3A 4BMZA 3KUKA 4MCHA 3SCZA 5EUBA 2HWUA 1PWYE 1JYSA 1XE3A 1VHWA 1Z39A 1PK9A 4EB8A 4G41A 4I2VA 1RR6A 1Z38A 2BSXA 1U1FA 5F7XA 3U40A 1VHJA 4K6OA 4DA8A 1JDTA 5B7GA 4TXJA 5F73A 1SD2A 3P0EA 4QARA 3E0QA 3ENZA 1Z5OA 4WKBA 4H1TA 3TL6A 3LBAA 3UAWA 1JDVA 2XRFA 1OTYA 4BMXA 3NM6B 4D8VA 5K1ZA 1RSZA 3BL6A 1PKEA
chains in the Genus database with same CATH superfamily
1XKXA 4BWYA 1FFXA 4EIWA 5LD2B 4FILA 3VJLA 1GL6A 5A9RA 1PFYA 1TZJA 3KHUA 1ZS9A 2CWDA 5AHKA 2P8JA 1BW9A 4MHTA 2IOFK 2QD2A 3NGXA 2QTHA 2QL5A 4O3FA 4CM4A 4JVSB 3E48A 2AKEA 1BH2A 4BNFA 1A1SA 3AERB 4MA4A 3RSLA 3WWYA 4AAYA 1ML3A 5G1NA 4R51A 2FSVA 2ATIA 2VNHA 2Z2YA 1HFJA 1ZHFA 5EI5A 3N8GA 2CB9A 3BWXA 1V5GA 4XIGS 2QSUA 3G0HA 1QVAA 4JLSA 4AY5A 1K66A 2O2EA 1YA4A 3D64A 1T4GA 1I3LA 3W4KA 2O2YA 4MVJM 5AM1A 4EPYA 1GAXA 5K8UA 1JAIA 5T3YA 4GGPA 4I1OA 3DC2A 3RG2A 3VOSA 5K01A 4GYYA 3C5EA 2PWPA 3PI7A 4L15A 5G4KB 3DDZX 4CV1A 2IBTA 1Y98A 3Q2OA 2XECA 1P62B 1I2DA 2A78A 2IHZA 3D02A 1KO4A 4LWOA 1KERA 1MORA 4C0WA 4L27A 5CTJA 1Q5PA 1RWXA 4DCTA 4DR6B 4L7QA 3G0DA 4KKVA 2G28A 2VBFA 2HHLA 4ISBA 3G6KA 3FNQA 1OX4A 2FR1A 4OQQA 4ZV7A 2BMJA 3G5TA 3A14A 3DO8A 2QVZX 1QC5B 1Z4QA 3P20A 4G25A 1KJ9A 2ZRCA 1OLUB 3HDHA 1IUNA 4NI5A 1UKEA 3UXYA 3DOCA 5KHOC 4JI1B 1RJDA 4YQYA 1WSWA 2HDWA 2R44A 3OAAD 2H29A 5EXEA 4C5AA 4K7JA 5L3SB 2G3YA 1KJJA 2O8FA 4YAOA 1IEWA 4B6FA 5EKUA 5E6RB 3R3YA 1LQ2A 3BK7A 4TV8B 5SYAA 3TX2A 3UTDA 1YT5A 4QU9A 5JD4A 5EUQB 4HQKA 4F3KA 3HUFA 4P2BA 1SD5A 2FFHA 3GRFA 5AR1A 4M0UA 1AOXA 3DBLB 3STWA 2H0AA 2DPXA 4BUJA 3O1IC 3A2KA 4YP5A 1MRSA 3AT1A 4DSAA 2AFHE 1GPLA 3Q7QA 2OVBA 2I6XA 4PXAA 4NBWA 3UCFA 4CEJA 1E79A 4HZIA 4BFSA 3DDNA 1ZN9A 3QFFA 5D8DA 3V1MA 4QFMA 1ICIA 5CFMA 2PE5A 3B9QA 4ZAZA 5C8XA 5HGJA 1D9ZA 3MILA 2VTBA 1G291 5DHPA 5EKXA 3W7AA 3NM5A 3LDFA 3M3PA 1VBMA 3F1LA 5A0FA 2CZGA 3IQEA 1UZMA 3L01A 3SD7A 1W46A 3WG9A 5BR4A 5ADHA 3TLAA 2WIGA 1H1LB 2X5KO 3QI2A 1OWNA 4J16A 2QRNA 2QUIA 3ECCA 4E30A 1NASA 2I4OA 2YZNA 3FMFA 2O7RA 3L7JA 5ALNA 1ULHA 4IDGA 4CYMA 1T2DA 4WBNA 5CM9C 4B3GA 2I1QA 3PJFA 4KO4S 1RRCA 2Z5FA 4HVAA 3IDOA 4FT2A 1ABEA 1Z8NA 4KNWA 1PZNA 2WHPB 2PRSA 1XZDA 1YS7A 3PA8A 2FGJA 3MUFA 4B76A 2DAPA 1H4QA 5CVCA 4N03A 4ARVA 4BBPA 2H2GA 5LN1A 2GBIA 3Q6MA 2XUZA 4LHWA 4QPDA 4EKEA 3T9BA 1XZKA 3AO0B 2AI2A 2BWJA 4RZSA 2OD7A 1F8UA 4ZIRB 1GG2A 1MQ8B 2V7EA 2AN3A 2NVBA 3K2QA 5CT5A 1NZDA 2AVNA 4ENWA 1UC5B 3N2EA 5COBA 4PAMA 1SCNE 4B7UA 4FYWA 3NBFA 4DY4A 2XXAB 4ENQA 1OF1A 4LJ4A 1JP7A 1PHPA 3PVZA 1FMTA 4I1YA 4N39A 4XIYA 2ZE5A 2HSWA 1QPZA 4WERA 1G8PA 1W5AA 1I6LA 2MYPA 3H8VA 2PBZA 1U7ZA 1KHTA 1RC1A 1YOBA 1SXIA 4CZ2A 5K8VA 2ZANA 4U7JA 3WLPA 3TW0A 1KVSA 2GR9A 1AKYA 4GZ3A 4W99A 4S0XA 1Z88A 1T91A 4PHTA 3I73A 1Q0TA 5THKA 2VF2A 3AV0B 4ROTA 1T26A 3HUDA 4R1LA 5D1HA 4UUAA 5EGSA 4ARBA 4D3SA 1T0PA 5DX0A 1F9EA 2FZ5A 4C6RA 4EA7A 5BV7A 5HMMA 2QP4A 5E9WA 5ESDA 3HEBA 2FG5A 2VJQA 2ZI9A 3CIFA 4ZEVA 3AJAA 1A9XB 1XJ5A 3WNVA 5JQWA 1M2VB 3SBOA 1DI0A 3ETCA 2QJFA 3EMVA 4IKPA 4HI0E 4MHOA 4EUFA 2PY6A 1MX1A 1GZSA 1W5TA 2A88A 4H60A 4UMVA 1WB4A 2Y9MB 3ZD9A 1EVKA 4YCAA 2CLOB 5CX4A 4KQGA 4KR6A 1J8MF 3ZU6A 1VL1A 4OQPA 2D2IA 1J2YA 2ZIGA 4WN9A 3ZHTA 1L7QA 3B1WA 2H51A 3BWEA 4HXFB 4P31A 1TYCA 3RROA 4KPEC 5A3JA 4YPOA 3JQ7A 5FRDA 1CUZA 3HLKA 4DCCA 4YH1A 3RFVA 3AM1A 3TLMA 5KQMA 3S68A 1N2GA 3LI2A 1NNLA 3GCXA 1IPFA 1WSBA 3W6ZA 2EBUA 2IQ5A 1L1EA 3EHDA 3OM0A 5DXAA 1G5PA 4XRRA 5AKJA 3CLUD 2ODEA 3DOIA 2GN2A 1NPDA 2ZITA 3I2JA 4OA5A 5HCNA 5HZHA 4BWFB 3IUBA 4YXFA 1X1EA 1HNXB 5BPFA 4BYMA 1YZYA 2ZUEA 2XOEA 4L9SA 4MLPA 3J7AC 1WPGA 3EA0A 4QGHA 4CMIA 4CM3A 1D1TA 1WB9A 3AUFA 3DXYA 3DKRA 2I4IA 4ZT5A 4HLUA 1EEXB 4M46A 4RZQA 1OZGA 5GJWC 3OZTA 1E0KA 1FFWA 1VL5A 2E1RA 2QRGA 1U8TA 2JFNA 5DGXA 4BUCA 3WB2A 5B3LA 4CCAA 2Q2OA 1P39A 4RJ2A 4ZVSA 2C94A 3WC4A 1XTIA 1YK1A 1ZVMA 1RZUA 5AM3A 5BN3B 3RRMA 3ETNA 1K2WA 2W6JD 5DX8A 4BX8A 5LOVB 1JH8A 4FMBB 4ZRNA 4ZYVA 4RVUA 4AQ7A 4PGFA 4X3PA 2PMBA 3LV8A 1R15A 1YZLA 1D2MA 4HDMA 4EM6A 4Z7NB 1XTZA 2QG4A 2XNDD 3GYGA 1L5HA 2FQXA 1H6DA 2YN2A 4Q9KA 3V8NA 4A4DA 1Y7PA 3QSGA 2H4XA 2BEWA 3AG5A 2P9YA 1D2GA 2PWYA 3AY6A 3FCSB 4CCYB 4DMFA 3IVRA 3V8EA 1KIFA 4NZYA 4IQ8A 4X20B 2GXQA 1EINA 3JQGA 5AWFC 4CU2A 2I9PA 2C88A 1X7XB 2G71A 5SYMA 3NEJA 3B3JA 4JL8A 2ZCJA 5LMZA 2EEPA 1FSGA 3PKZA 4ZOLF 4BN0A 4C04A 5L3ZA 2HRDA 2IP4A 1MB3A 2HBRA 5A4FS 2XZPA 3WKAA 5CLIA 5IT0A 1G98A 5LZ9A 4MVXA 5GMOA 1MRZA 3L3BA 3L1VA 3LM8A 1J09A 4F1WA 5F9MA 1NIJA 3PSAA 4LJ5A 1NI4B 4H4EA 2H07A 3C3WA 3VOTA 3OCYA 1U2TA 3EGWA 3UMBA 1X74A 4NMLA 1KC3A 5ARDA 4YQEA 1CEEA 4P3XA 1LF5A 4RE5A 3BXHA 1E1CA 5KHAA 3CEMA 2RHBA 3O3OB 1SO8A 1E5TA 4LJ8A 1CP2A 1GYQA 2JJ1D 3H11B 2V65A 3EWIA 3T7TA 4CLRB 1MDBA 1T1RA 3H1GA 4KYTA 3FUXA 4QDXA 1USVA 1HQYE 5FBQB 5GY7A 4CJXA 1U3DA 1UANA 2NMVA 1O94A 2I8AA 1NVTA 4AVYA 2CY0A 2R8YA 3ZY3A 3VPHA 2WVGA 3R5FA 3L0BA 4H08A 4B0PA 4R2XA 4RD1A 1XTPA 4ZOLA 3RVOA 5DBFA 4EVSA 3RC7A 1V48A 2QJTA 1ZNYA 1VPDA 3LXRA 3R3XA 3QX3A 3DOHA 2HK7A 5I5EA 2AOTB 4Z3DA 4C1NA 2HL6A 1L7AA 2IKSA 2AKAB 4DABA 1OLSB 1T6ZA 3F2IA 3JVEA 3LUAA 4E6EA 3BILA 3OPQA 2GCEA 1XPJA 3B6EA 5A4AA 1NW8A 3QFSA 1C9MA 1BVYF 4J90A 3OQHA 4OL0A 5IK2A 1IRIA 2QW1A 1ZXXA 3KSUA 3LHSA 4FNGA 4CM6A 4ZGBA 1FJ2A 1LFAA 1UINA 3EGIA 4QXMA 1M1NA 1P4SA 2QY6A 2BFPA 3AW9A 4AXBA 1XJ0A 2X23A 2EATA 1DHRA 3F6RA 3IP5A 5AO9A 5ELMA 5G0TA 5MGBA 4PC7A 3DHEA 1W1UA 4L1KA 2ZUFA 2WWXA 1WV1A 2IXBA 1LI4A 1OPXA 2NWQA 1Q0RA 2PA0A 5FTNA 1Z06A 3GAAA 1NI5A 4XM0A 4RVNA 3EVBA 4A1OA 4OSOA 5BOSA 5FOSA 6AT1A 5L51A 1R8YA 4Q48A 3FJYA 4UFNA 5EIAA 3TQSA 4I4CA 2WMNB 1XJCA 2JAHA 4G67A 1ENPA 1Y4SA 2DPLA 1H2WA 4BVAA 5IS2A 4MYHA 1PSDA 5LYJA 2ZRDA 2WV7A 2WD8A 3IPYA 2KJQA 3DEYX 3QEKA 4RY2A 4XASA 1T43A 1D0SA 3C5HA 4G5QA 3DMFA 3JARB 3HV2A 3QVVA 5D3MB 4DLLA 2MT9A 4ICIA 3Q9SA 2QAGA 5EFZA 3RSHA 3G9ZA 3WAJA 2JVKA 4P08A 5AKHA 5FL3A 1WKCA 1S96A 3GBPA 3LLUA 1NLYA 4H1HA 4KZKA 2NZWA 3C15C 3NTXA 5ALJA 2ZRFA 4RDXA 1BMFA 2J7PD 5JADA 3W5SA 2O2JA 1HTTA 4BVKA 3KS9A 4DCSA 2Q1XA 4IEEA 1FLAA 4LRTB 4PS0A 3WGNA 2ZJ1A 1ONPA 6LDHA 1KC1A 1DDGA 1QDLB 3RIHA 4Y9TA 4BLQA 1TECE 3HZOA 2OECA 1W19A 4IPTA 1SCBA 3TZKA 3VJKA 5C5IA 3OMWA 2CEKA 5DGHA 3T5CA 4HZGA 3FCEA 4PBRA 4YXWD 5LYJF 3CLTC 2YFYA 3RAJA 2B94A 4KYVA 1V3VA 3LAWA 3I1YA 3PFCA 1QO0D 3A28A 3MWFA 1BYUA 4HYQA 2ZQZA 5CEEA 4KN8A 4DLZA 3FGZA 2YJTD 1P7CA 2Z4RA 5BSUA 4DDVA 5AJWA 2X1MA 1FUKA 2PN1A 3AR9A 5TR9A 3BF8A 3O8QA 2QD5A 3OSZA 5ERYA 3PFNA 3QY0A 1NXSA 1NZFA 4BNGA 4MWBA 2JEYA 4P7FA 4E31A 2IH4A 1OIWA 4MWGA 1XPOA 2CZCA 2JZOA 2QTGA 2OQIA 1EAMA 4YAJA 1K6XA 2WLTA 1S3IA 1J9EA 3VYWA 3AESA 1T1JA 3UFXB 2FEAA 4L6AA 1ABBA 3CIOA 3LUBA 4C0BA 3I30X 4MUAA 1U99A 2CLLB 4CG3A 3SWWA 2RE8A 1ZSNA 4YI3A 4A23A 4AG3A 1EP1B 2FW9A 5DNAA 3EXHA 3M5WA 4A8JB 4O63O 1OMOA 2WRZA 5E4FA 4RLQA 1K7FB 2OK8A 1WA5A 4H77A 1CR0A 1SD1A 5JNUA 3AVYA 2H4YA 1E9CA 1JF8A 2DHDA 5ERXA 1N2BA 1SVMA 3BKXA 3UKDA 5HNKA 1NG9A 1C7ZA 1HR0B 4OFWA 4L9RA 2VZLA 1PDVA 1Z75A 4IMRA 4RC9A 5EQJB 3GWZA 1W9HA 2CMHA 5BW8A 2NO9A 1H4TA 3KD3A 4IGKA 3OPYI 2Y68A 4XGKA 4EY7A 4TROA 1U4NA 2QD1A 2CYAA 3PUIA 4P36A 4P92A 3OECA 1J9ZA 3LQKA 4D4KA 5D6NA 3B51X 4DC0A 1N9GA 1AURA 5TGZA 3WMXA 1OBVA 5JXJA 2JGJA 1GPNA 2I3ZA 3CW8X 1CHDA 4K40A 3DULA 1F8GA 3KUCA 1XALA 2UZ4A 4L4XA 4WD3A 4B3RB 1XP8A 3ERCA 3TH5A 2ZZKA 3I8OA 3ROGA 2YUIA 4C89A 3OQJA 1O94D 3AF0A 4IRXA 1BKDR 2DBYA 2HT1A 4JYCA 1BXZA 4I6GA 3QBJA 2I65A 2FUG6 3KNZA 1KZ7B 1N2IA 4NU6A 2GK4A 2OBNA 3E5NA 5KQGA 1SVKA 3DEJA 3OQPA 5BUQA 4JIMA 2Q62A 4MS4A 4K88A 3SLGA 1CDEA 1UUFA 2P4HX 4FEAA 2O0JA 1DX4A 4RVCA 1JU3A 2YWGA 1P0FA 4CGYA 1UIRA 2X4DA 3R5JA 4UCWA 2M9MA 2FP4B 1NF8A 4QJIA 4TXJA 3RYFB 1YZTA 4E2WA 1V8OA 4EHHA 3G2MA 1KA9H 1IRXA 4N5NA 5SY6A 3RVNA 3QQPA 4AICA 1LQTA 1BOFA 3TRDA 3DLBA 2Q5EA 1SG0A 3W3ZB 4WKBA 4B7AA 2Q5OA 4F06A 5J47A 5E1OA 1N0IA 4F46A 1QORA 3JQEA 1VIMA 1G8YA 1RAHA 2OXEA 2XRFA 3NIWA 3QI7A 4P38A 2M6KA 2O8EB 2YRWA 3EOBI 4P4SB 4HLDA 4CMJA 5AW7A 3DNMA 4BZPA 4ER3A 3I2IA 3RSZA 4FQ8A 4MVJF 5AVRA 3WP0A 4I9GA 2PD3A 4DBVO 3NUZA 3JRNA 3O75A 4J0QA 4NATA 1RWPA 4ZCLA 3OU6A 1DCKA 3RYFA 3N7UA 1LPAB 1ZD4A 1CRWG 4MW0A 3RFUA 1M5UA 3H1FA 2YV3A 5CD9A 1PJTA 2Q7DA 2NNWB 1T1GA 2FZGA 2PYZA 4B35A 1CYDA 1PTKA 5JXGA 2LRHA 3TLZA 1DBQA 1N0HA 1VXRA 1CF9A 1G19A 2HEIA 4BAUA 4MQFA 3TTWA 4UUQA 3BB1A 2HWKA 4PPGA 1G1MA 5EP3A 3WK6A 4DCPA 3IKTA 4ER6A 4FP9A 3IDQA 4FYYA 4YIKA 1NP3A 2MSCB 2ZRIA 3QU2A 2FQYA 5D3ZA 4GL4A 4D79A 3QPAA 4ESHA 3CEPB 3AR3A 3PITA 2ISCA 1YJCA 4INJA 1YQTA 4MWTA 1Q0SA 3QV1A 4NESA 5KKCA 4FR5A 4MO9A 5CT4A 3GZJA 4MIYA 1BD3A 3WWDA 4NBUA 4BP1A 3IUYA 2QRZA 3KPYA 3NPMA 2YW9A 3AHEA 2LWIA 5H80A 1CLEA 2JK0A 4G0ZA 2AG1A 3SX4A 3UHFA 4KFCA 2XADA 1YAHA 3CVUA 3K0SA 2RGRA 3D43A 3J7TA 5DM2A 5EJ2A 3AYXB 3E22A 1GCOA 1WF6A 2BE7A 2OFPA 3BERA 1T4DA 1J70A 2LD4A 4DM7A 2QUJA 2C4MA 1C4KA 4RHUA 1CC1S 3I01A 4D2IA 4OUDB 4DNOA 1P8AA 1WKBA 2HSDA 3HYSA 4LMAA 4IJ6A 1U5AA 3RSQA 5CA0A 821PA 1UC4B 4IM7A 3SHTA 5HS4A 1Z8DA 2R5FA 3GB9A 3G5AA 1QUEA 2JF0A 3HKDA 2UVPA 4G9EA 4YS6A 1AHIA 5EHQA 1NMYA 2IDZA 1IXRC 4ZAVA 3CZ9A 2O2XA 3GJRA 4PXYA 4IHAA 4M76B 1RU3A 1GFSA 3GBVA 1KS2A 2D0PB 2GLTA 5JBQA 3AVXA 3BIJA 4CF5A 1MT0A 1NSFA 4IV0A 4XR9A 4B6RA 3SZOA 2G88A 3DGFC 1P5FA 4N1AA 4ZDIA 2GFHA 4JI7B 3KE8A 4C2AA 4X8HA 1O95A 1U9ZA 3OJEA 5BWLA 4UOEA 5AVXA 1EK2A 5DLYA 1D9XA 4BNDA 2HBYA 5FUXA 4E22A 1HDYA 1QGDA 1PJ8A 1T5DX 4CU5A 1I2CA 2ZVPX 3WB9A 2WHQA 1DRUA 3PL5A 2XUOA 3HLTA 4C4OA 1ECCA 2ECFA 3LBHA 4R0VA 2XH8A 4RTQA 5KYGA 4WKPA 2C9MA 2DR2A 3SE0A 2LIVA 1F7VA 2A0WA 2P5SA 5LUAA 2JFVA 4LMRA 3Q98A 1OWOA 3L6CA 4BNXA 4ZZIA 3IOCA 2QY9A 1JAZA 1YGYA 1KPHA 2J59A 1T0JB 2IEGA 1FYFA 2XNKA 2Y1DA 3RV3A 3TNDA 4AN4A 1EWKA 2G17A 5ALRA 1Q6YA 3GGGA 3IVGA 2DFPA 3GPIA 1KI3A 1Z6TA 2Y0BA 2WICA 5CIYA 1YR2A 2Q49A 2QM3A 1QLJA 5FCDA 1TVMA 4MW1A 2UVDA 4KQCA 1UT8A 3FB1A 4ZXPA 4YJGA 5J63A 1Q12A 1JDPA 5LM3A 1QHXA 4PLTA 1AMNA 2XUFA 2A1UA 1TO1E 1Y1QA 3ANYB 4KCGA 4P35A 4RM2A 3N70A 5IJ0A 3QX8A 1XQ9A 3TKLA 3TVDA 5BVHB 4PYIA 3USES 4RD3A 4GDFA 2XBUA 2DPYA 1A7JA 1MW9X 1TVKA 3EODA 1KYYA 4TPKA 4P2GA 1S89A 4BPBA 4AUKA 1SVWA 2PGIA 1DEKA 2CNWD 3PZBA 4FGZA 4PXSA 2Z9CA 3GPDG 5CJPA 5BN5B 1A9RA 4MDHA 3VR6D 3W4IA 2H7VA 4GP9A 3X2EA 4B85A 2VZ0A 1Y8ZA 1IXSB 1K0FA 2AJTA 2C7GA 1TCVA 3DMGA 1ZYUA 3HVKA 2CF6A 4QGGA 5DB4A 3VH1A 1R8SA 4DLSA 4QRIA 1X9IA 1QFMA 4YVFA 5A6SB 1YDFA 1JHOA 1PUJA 1QH0A 2QMEA 4DSOA 3VU1A 1ZI6A 2HAEA 2WNHA 2YJGA 3IJPA 4RHYA 3UT6A 2C8VA 2XNSA 3B3QA 3KALA 3VTZA 1ZM9A 2AIRA 3EARA 4C0XA 3W4JA 5K4GA 3OTQA 3ASUA 1GCGA 4QC2A 2O8NA 4R3NA 3GMSA 2EEZA 3ESAA 3FCXA 1W5BA 1NN3A 3S2SA 4AS3A 4CF3A 4MV6A 1CS0B 3F8SA 1UQRA 4FFLA 4MI3A 5JRJA 3NS7A 4IUDS 4RPKA 1U2DC 3G9XA 1WW8A 4DARA 4RACA 2O57A 1XD2B 2J3EA 3TI9A 2QN9A 1SG6A 4MICA 4PRZA 4V0QA 3VI3B 4LF9B 1L7PA 1WTCA 4PWZA 4MPTA 1NF3A 4NE2A 3GPCA 1P45A 3NC4A 1Q11A 3HWWA 3NAQA 1VJ0A 3GHHA 1QAMA 3ZDBA 4IOLA 1M7BA 3ZKWA 2IYQA 3HO1A 1BWRA 3TQIA 1N6IA 2JI9A 4ARZB 5CDGA 1H9AA 5DEOA 5KX5A 1MEEA 3LWDA 2X0NA 4C4SA 2DGDA 3TPZA 1RMQA 1JN0A 4W9NA 1SZDA 3NM4A 3LYLA 1LPMA 3EXG2 4H3VA 1GRQA 2HQOA 3L9XA 4RMIA 1V45E 3QFHA 5EIBC 4AWBA 3ZCVA 4IFEA 3TZQA 1CG6A 3EGVA 5KHLB 3PT9A 2IBSA 5EG5A 2ZS9A 1D6SA 3AB8A 3FF4A 4TUYB 3RWMB 1MG0A 1YCFA 4EUNA 2JA1A 2OBXA 5FPQA 2H31A 3B12A 2YV2A 5D1NA 1G8KA 3MBIA 5BT9A 3U26A 3HUEA 1ZIPA 3V2HA 2JLYA 1U9YA 4CKWB 2L82A 2E55A 1CLUA 4QYSA 2OORC 3RANA 1BH6A 3MCUA 4EABA 1BE8A 2V0CA 4ZCMA 4JLPA 5CVEA 3WBBA 5IYZA 2QTVB 1W52X 4IS3A 3A6ZA 1XL1A 4B2IA 1Y5MA 3WGKA 1AY0A 1NUPA 1DCTA 5HOEA 1P29A 2VP9A 3F7OA 4REQB 5DRTA 1Q0UA 4YGYA 1M2HA 5K3AA 3RYCA 2DFNA 2ORVA 4NCAA 1JRLA 4TMVA 3DKKA 2MSLA 3JQQA 4IZOA 3I9JA 1DXQA 4LXXA 3BSWA 4QQKA 3T41A 3PRYA 3WLJA 3T5TA 1JMKC 3FPLA 1KVTA 2JFPA 3LY9A 4UVIA 3I2HA 2V4MA 4ZWNA 2DCUA 2D74A 2NZXA 3K96A 4JLMA 5BMVA 1O2DA 2M32A 1GTMA 2VJMA 3FRHA 4H7KA 1Z5PA 1NMZA 3BEOA 5DTRA 2PTHA 3ZZ1A 3AFIA 3C43A 3EIXA 4K9LA 2IDKA 5FI3A 4BNMA 3VO9A 1XVLA 4B7CA 2G5PA 2X8JA 1H69A 1I4DD 1O97C 3T0IA 2VDKB 1EU1A 1U04A 2OCBA 4GLFA 4XWTA 1A7UA 4EDHA 3PRJA 3DV9A 4O1IA 5C8YF 1YQDA 3K15A 1A72A 4LRSB 4DQUA 3I28A 1T36B 3DVQX 1XVTA 3MYRA 5IYZF 5EMHA 3ZNOA 4H1WA 2KPOA 1HT3A 2HRCA 1TMYA 4ZQGA 5L7TA 1IVYA 1F3OA 4JAVC 5H59A 2AA3A 4U7DA 2DFDA 1Z07A 5K3SA 4IIJF 2NU8B 1P6XA 4J7AA 5IABA 1HNZB 2UZAA 2YW2A 4R1OA 3S8MA 3LIPA 2HLDD 1KEEB 1V8DA 3GLSA 4KLZA 4BC0A 4Z9XA 3JQ7B 1IHPA 4RMNA 1QG4A 4MJ3A 2WFLA 4ND8A 3U2QA 5CDUA 3JX9A 3EPKA 3GLHA 3T1YB 1FDSA 4HWTA 4MGHA 3FNIA 3F6BX 4OBEA 1R16A 1WY5A 4YJHA 1Y3BE 1GTJ1 3P2OA 2I3AA 2A57A 1VIVA 1COWD 2VUHB 3ZV3A 4JWTA 3T7KA 4YACA 1PS8A 2ZRMA 1II9A 3H1EA 3TTTA 4C0SA 3F47A 1GKUB 3BZBA 1Q7GA 2AC2A 5DYWA 3SNHA 4Z54A 1GSOA 1DC4A 1KAOA 3FF1A 4LGCA 3UUGA 5FWAA 5LNK6 1KMNA 4CR6A 3GZNA 3WIDA 3K3PA 1OAOA 3NHPA 3QEOA 1TJ5A 2JIBA 3BHJA 3ZLVA 4FUQA 4ZD6A 3ZIAA 2B4YA 2G8LA 4ALKA 5M2QA 2BRUA 1XNGA 3HM2A 3HGMA 5F35A 4EPXA 3CW9A 5ECGC 3QUCA 4EW3A 4I50B 2NXCA 3KYIB 3MJEA 2ZIAA 3C4VA 5LU9A 3L77A 3GFPA 3K6SA 4XDGA 1Z2AA 5DWVA 3TPCA 1T3ZA 2IXAA 3VUFA 3EF3A 3EAGA 4QICA 4G9GA 1IUKA 4I6JA 3NRJA 5HJEA 1KRWA 2JGIA 3DT9A 5KBYA 1F9AA 3TOXA 4JBNA 5AKKA 1UKYA 3HEMA 1S8NA 1D2AA 1U3VA 2CXQA 4UQLA 3HS3A 3T06B 3Q7EA 4LNHA 2GHTA 1CT9A 4U7PB 4HDSB 4HK4A 1Z0UA 2E4VA 4XB6B 3B48A 3ZEAA 3ZHSA 2F3UA 2FPUA 2RAUA 4QOGA 4OPMA 2IPMA 3FW1A 1L6RA 2OSBA 5DVZA 4ZIRA 2YJ4A 4UBIA 4NABA 2YZKA 2J87A 4EHAA 1ORIA 3A6GA 1B74A 2HQBA 4JC8A 1X7ZA 2C04A 1ENYA 2DQKA 3ZGLA 3ZW8A 1X1CA 3HL0A 4MKFA 4BVLA 1JI0A 2G08A 2IUFA 4NV0A 4A0SA 4ZFNA 4YRZA 4EATA 3ZN2A 2OHXA 4KTVE 5H8WA 4B2PA 3JAWA 3JZFA 6ADHA 2VPPA 2DUJA 1QQBA 2NTNA 3IAFA 1EQUA 3L6UA 1WMDA 1EFPA 4WQMA 1AS0A 2OG1A 4RABA 4R7TA 4WESB 1WQ3A 3C6BA 3F3KA 4HNQA 1TJYA 1WHSB 4YALA 2WUDA 3HI6A 4QSHA 5ARBA 3ECSA 4I8IA 1SBNE 2ENUA 3U9TA 4CETA 1DC6A 4U7HA 1K2VN 2DX7A 4B3DA 2AWOA 1Z0AA 2X9QA 3OICA 3ZE2B 1R27A 3IALA 2KBFA 5EAIA 3WKEA 4LJSA 4LVCA 3WFIA 3PHCA 4NG4A 4M60A 3IIKA 1SULA 3QUAA 2IHJA 4HWGA 3JALA 4TRRA 4A16A 5D00A 2UUBB 4WDQA 1HQDA 4HMOA 1DQPA 1O6ZA 2WSIA 3OE1A 1V3UA 5EIBD 4Q82A 1R66A 1PYOA 4FYVA 5BO5A 2EKLA 4MW4A 1NBMA 2BFEA 2BTQB 3C1TA 2J3QA 3GZNB 4P53A 1Q16A 5HEKA 1Q0ZA 2RIPA 4W6ZA 4DLBA 1ODCA 1NHGA 4WLFA 5DV9A 1TF5A 4B5LA 2VK2A 4FUTA 3R9IA 2ZRHA 2A9QA 3IRVA 2CXXA 4DDMA 1SPBS 2BKVA 2B4QA 4IAOA 1SUBA 2EYQA 1BQEA 1ULAA 1P9LA 2IY9A 1D6JA 2KWIA 1QK4A 3BWVA 1FTWA 4DDTA 4OXKA 4CIYA 2DHEA 4OMUA 1N2OA 4E2YA 4I99A 4DREA 4M0KA 2J5RA 4K3UA 2C2BA 1RM5A 4HPWA 2A7XA 2VLIA 3ZCXA 4C87A 1XZ8A 3FHTA 4Y6PA 2BEVB 2E85A 1JBEA 2G80A 1TA4A 2RHGB 3FMVA 4FXOA 1WDTA 2XT6A 3LBNA 1HE2A 1EESA 2JEOA 1GPJA 5JG7A 1FFEA 1JPVA 2RGDA 3O4JA 3PDIB 3WGTA 4HH0A 2OCPA 1DC5A 1WQ4A 2JH9A 3R7BA 4Y3UA 3T12A 3DE4X 1P91A 3ZJTA 2FF5A 3IUJA 3RYTC 3OCXA 3ZNNA 5GVRA 4R9SA 2DKFA 2Q4TA 4KDCA 1QP8A 4ZYXA 5EUBA 5FL7D 4HDRA 1O6CA 1TU3A 3ORRA 1XU7A 2XUKA 2HDNB 4L4ZA 1AQLA 5IC4A 3OTOB 3IPXA 3ROEA 1DB3A 3LX8A 1X42A 3L9WA 1Q6ZA 4IJMA 3K09C 5AVYA 1KH1A 3RUEA 2NTYC 4HATA 3QOXA 2P5YA 1JEJA 2DBVO 5I8WA 1KJZA 1BA3A 2I67A 2XA2A 1E5VA 3ZDRA 2IZ0A 1OI4A 5BV8A 1SUEA 2AQIA 3ABZA 1E61A 3LOPA 3L7BA 5DWDA 3RSCA 3U48A 3M4JA 3HU2A 1BDHA 3QUQA 2AG6A 1I7DA 1TMKA 2DQSA 2DQ4A 2WIAA 2XW6A 1J20A 4O5OA 3TDMA 2IKQA 3TSYA 3UUFA 2ZIEA 4ED9A 1BW9B 5GM2A 1L7NA 1C29B 1O9BA 1O6GA 4GI7A 3RVJA 4RM3A 1O6BA 4L95C 3DCJA 4XDYA 4BHTA 1VMDA 3KZMA 4OHZA 5IW8A 3BJRA 2Z1MA 3GDWA 2BP7B 1H94A 1OYOA 3SBEA 3LKBA 1U7DA 2O19A 2CHUA 2X4GA 5JDIA 5FPYA 2Q1UA 1EPUA 3O9ZA 4G37A 2XA9A 3IB3A 1QVWA 3NOQA 4JR2A 4RL4A 4F9EA 5BW5A 4K9NA 1HYGA 3NHYA 2OO5C 1ZHOA 1K68A 4CTNA 3B2QA 1XU4A 5BSKA 3G5MA 3SXUA 3IV7A 2YASA 2VHEA 2GZDA 3B85A 1L7BA 1V0JA 2GARA 4WKGA 4N0DA 1BXRB 2ZJ8A 1X1BA 3GT4A 4ARUA 5GQSA 3DAGA 1HGXA 4RWEA 4UBLA 1CUYA 2FI1A 2QVGA 5EMKA 4D8VA 4LF5B 1JG6A 3I2KA 3ZZUA 1SIOA 1EZZA 5BRNA 4D43A 5ES4B 4RF2A 4XD2A 2E21A 4FN5A 3OU2A 4OQFA 2CUZA 4DQDA 2YBDA 3CMCO 1FVOA 3D3KA 2OXCA 1YXMA 5DTEA 2BN4A 4CVNA 3VPXA 1GOTA 4HAZA 4Q9AA 4CI9A 1D2EA 1JSCA 1CJBA 1G5QA 3O5AA 3AJEA 4KO3S 2J5KA 2GJ8A 4Y6SA 2J9YB 1J7JA 3AI7A 4OYHA 2YCLA 5J5CA 1SGWA 3CGWA 2J4CA 2XZOA 1E2EA 1ZIOA 1W6RA 1YI0A 1ZOPA 4GM0A 3HN2A 1NXWA 3PYXA 4U6QA 2Q0QA 3EULA 1LVUA 1D4FA 1FTQA 2IZ5A 4MKXA 2ID7A 1E3MA 3R24A 2HF2A 2W7TA 3KTAA 4UBKA 3P71T 3ZHQA 1P2GA 3TCXB 3SC2B 5K8TA 4B4VA 1CRPA 1F17A 5CR9A 4XCVA 3ENVA 4B34A 1NQWA 3NDIA 1DE0A 3QELB 4OXRA 2VRBA 4MUGA 3AVUA 4EPRA 5HKLA 3ZG6A 1ODIA 2XWJI 4RADA 3W0LB 4E15A 2DUWA 1XELA 3TOSA 4OY3A 4EJ6A 2UYGA 4HYEA 2DQYA 1C3VA 2YX1A 3K0FB 2GASA 4DQKA 3CKMA 1ZKDA 2O2DA 3S81A 2IGBA 3KLBA 2PU5A 3OA2A 4KLRA 4MJ7A 4N82A 3K9FC 5K2MA 2KSQA 1ZK2A 3GRAA 3G68A 4PX2A 4CM9A 2G1KA 2ZWPA 1GZDA 2Y0PA 4LZZA 1UOPA 3W5IA 2O1SA 1Z7BA 4KSBA 5AI0A 4AULA 5JAOA 4J94A 1KAQA 4D92A 4PRYA 5I9IA 3AEQB 1TGVA 2Z5GA 3H5WA 1EJBA 1MEOA 4G0NA 4OGGA 3TB6A 3F46A 2QX6A 4BKMA 4BIMA 9MHTA 1DIGA 1G7RA 4XIJA 6REQA 1SCAA 3C8MA 1QQ6A 1RM3A 3B38A 3PPYA 5J3JA 2HZ7A 3FIUA 2ZJ3A 2VJYA 2V03A 5EJ8A 1Y1RA 4EEZA 5WRFA 3GLKA 4TWIA 5BSRA 3MBOA 4B0OA 4D0RA 4GOXA 4MA5A 1WO8A 3FCYA 1FDRA 5LZ7A 2P1ZA 4AP9A 3ETDA 1LEHA 2H2DA 2ZT8A 3VSCA 2FWPA 3GAMA 3R23A 2WIDA 3RHSA 3THXB 5H4HA 3SYNA 2R751 4NX2A 3TXXA 3HRIA 3WK5A 5SZKB 3W04A 2HPVA 3R1IA 1SOVA 1Z5GA 3ZU4A 4EJMA 5FBZA 5K0SA 1UBJS 2P9QA 2RC5A 3A3OA 3FTDA 3JYPA 5FO0A 4TMWA 2HR1A 1PTJC 1DC8A 1VIAA 5FBWB 3RBZA 2PJZA 1CZLA 4RA6A 3ZQUA 1FU7A 2OHOA 2Z8ZA 2QZJA 5JASA 1MLDA 1U2PA 4MOWA 4QRDA 5JH7F 2V7WA 1S2GA 2W2QA 1CIJA 1OD6A 1VGQA 2VHZA 2D1TA 1A4XA 1JJFA 1WJGA 3BFKA 2B8EA 3QPWA 5B3JA 3OT1B 5KTKA 4BNDB 2I87A 1BG6A 5DYYA 1XKQA 3FCAA 4RAQA 4DG5A 2DWQA 3C8HA 3IIMA 4BGIA 4BQFA 1DFHA 3OQNA 2GAAA 2VRCD 3SC6A 5K3BA 2G04A 4FFWA 1I14A 2HX1A 3A37A 1RACA 1VGRA 4FMCF 5DO9A 1LBEA 4RGYA 2FSFA 3D6JA 4XUEA 2D13A 3TUIC 3NI2A 2G9QA 1PWZA 2OPBA 4OHRA 1RW4A 1FP6A 3GD5A 4Q9NA 5F77A 1E1MA 3HVJA 1HEUA 1WMSA 1SBQA 5CK5A 1FLDA 4XR4A 2QRLA 2ZSBA 2MSWA 3CZRA 1U0LA 3OM9A 1TO6A 1C9JA 2QYOA 2P2YA 3KOYA 3NTRA 1YDGA 2JAPA 3ZTWA 4AZVA 1U28A 3VO8A 1JFFA 4FE4A 1NLZA 1Z5NA 1RJ9A 2R65A 3KJEA 3PD7A 5TPWB 1M5TA 2HA7A 4B3JA 2FR0A 1BIFA 3TNJA 2A14A 2PWBA 4CMKA 1Z18A 2LBPA 4LYGA 1CZOA 2DVMA 3KPJA 5G41A 1A2KC 4AZ0B 4DSNA 3NH6A 5K8IA 3RTEA 3F5SA 2HQSA 4Y7CA 5T64A 4NH0A 2AK2A 3UC5A 4DQXA 2H4ZA 5JCZA 2PLFA 5AVUA 3KEFA 4Q00A 4XFJA 4O4JA 1M2WA 1AKWA 1H23A 4LIPD 1Z73A 2PAAA 4B45A 1OYWA 1D8AA 1H0SA 2WUGA 3DUFB 3KU4A 5EWJB 3U7GA 2J0UB 4I46A 1YCDA 2DUUA 3SYMA 1JQAA 3CPJB 1RNLA 3MRVA 4HH4A 3RS5A 2JBAB 2Q5FA 3SM9A 5CLHA 1SUSA 2EFYA 3BXGA 1OBHA 3HV0A 2VZ9A 1G42A 2VF4X 3K9WA 4BQQA 4YJ2A 4TOIA 1AUPA 3K72B 1KEZA 4G8DA 1E2DA 1GQQA 1UJ5A 3HBFA 5DJ5A 1M6EX 1QGOA 2BFWA 4R3WA 4AO6A 4EBBA 1XTQA 1NW7A 2GCOA 4UASA 1E9RA 1TAHA 1C3XA 2WSSA 2HI0A 1W2GA 4KQEA 4PNZA 1XAIA 3A32A 5EXDA 2AR9A 1XWWA 3O94A 4HZUB 3I5XA 3E9DA 2JJ1A 3V9AA 1UOOA 3HR4A 3GDFA 3TVTA 5HKKD 1IUOA 2IVFA 1QRUA 2FB9A 2ENWA 1VLLA 3ANNA 2SCUA 4QDOA 4RANA 5IN4A 3F90A 1FDTA 3VPCA 2ZU0C 4DIKA 2DLCX 1KI8A 3BJZA 4S05A 1VCIA 1WCWA 3D1JA 1XQXA 1Z4KA 3AIMA 5FF9A 1ECFA 2X0IA 4I55A 2CDCA 3MELA 4IILA 3V6LA 1GWNA 3M4XA 3MPOA 4KE7A 2V6JA 2EHDA 2FTKE 2JHFA 1NF9A 4IF6A 5B3AA 1VYVA 4NCJA 4TTAA 2B35A 4O0LA 2V6BA 1F51E 3EGDA 4ZQFA 3ZJUA 4F9GA 1TK3A 3N0XA 4H7IA 3TZCA 3VZSA 1SN7A 3EAFA 3KUXA 5BSWA 1K63A 1VJRA 3NP9A 1N2EA 3BC1A 3PPVA 3GBSA 3QVLA 5LZ5A 5ITZB 3JV7A 4YRAA 2HYIC 4R40A 2PMDA 1DG3A 5A03A 1VP3A 1CXZA 1U2RA 5K6AA 1A8UA 3K0FA 4V24A 1V71A 2WJ4A 1Z6PA 4OOEA 4UAJA 4AWXA 4Q4CA 4UUBA 4B4WA 7MDHA 1WZ2A 4GVXA 3WAKA 2GVDC 5KWEA 3ZDCA 2JCSA 2FKAA 1LSUA 1P3Y1 2O2HA 1FXWF 1KQPA 3MAAC 3NIGB 4ID3A 2GCIA 3AF4A 3LT1A 3ZHCA 5AVVA 4NR0A 3GNLA 1E4VA 2WJAA 3I92A 2PXXA 1YQXA 2I55A 4M9QA 1EX6A 4EB6A 2DFTA 3BQNB 3UQZA 3OD1A 3I61A 1E1NA 3FPJA 3M6MD 421PA 3PRKE 1LLUA 3PQ3A 5IX8A 3HYRA 3LUFA 1GZ3A 4I4TF 3T4EA 4AJ2A 5KOJA 4JI0B 1T3LA 1U2GC 1WPRA 3EZLA 2BBSA 1EFAA 4LZOA 1LBHA 2FPIA 4P5PA 4EYEA 2Z56A 1SOMA 5ENDA 1UBLS 3FAZA 4PM4A 3EF0A 1WSDA 4CQJA 4KXMA 1NTRA 4AW9A 1GKYA 1E0JA 4HMPA 1U2SA 2VYVD 3WYEA 4EUEA 4MCIA 2CK3A 4PR0A 1VB5A 1ES9A 2MSKA 4O4HB 4I5EA 1JJIA 1QKJA 1XLVA 4GX2A 2ZTMA 3H7AA 4HGQA 2R87A 4KWHA 3GFRA 2XCOA 4HFNA 4WWHA 3B7WA 4KKXB 1V41E 5JT1A 4KQIA 4JYAB 4PHGA 3VR0A 5KSYA 5UKDA 4I5IA 1M1UA 3N8KA 5IXYA 5CT9A 3M4ZA 4R7GA 2F3RA 1XDWA 3IEMA 2VP4A 3SXUB 4FSDA 3HCRA 2YINC 3CZMA 2WDZA 3AKCA 1NOKA 3A2LA 4JCOA 4UCQA 2MSEB 4V0KA 1T0IA 2PKCA 4ZQBA 5GONA 3U0VA 1USUA 1SM4A 3IURA 1UMKA 4L0MA 1NUUA 2ALJA 4NP6A 3NLLA 3RKSA 4C7XA 5A6VA 2Q3BA 4FYMA 3T34A 3T1NA 1CEQA 3HPQA 1AZSC 1ADJA 4NHOA 1FMLA 2M6RA 1VC2A 3ODGA 3C48A 1LBSA 3EFOA 4RSHA 4RV9A 5EPUA 2V0GA 3B1FA 4NCKA 3BIXA 5JMOA 3JQ9C 3CNOA 1LTKA 4OUKX 1K98A 4CT0A 1Y6GA 1YS4A 2J46A 2NO6A 2RG1A 1E3WA 3AGPA 2BTOA 3P9PA 3IYLW 4LXGA 3GLUA 1FP7A 4WNCA 2NU7A 4FWIB 4WNAB 3GT0A 4C29A 1GEEA 4UTOA 5KDLA 4JBLA 5CYFA 4BB6A 2O4UX 2HF8A 2JKZA 3UMVA 4Z53A 3ZDAA 3NETA 3LHDA 2JFGA 3FXAA 3TD2A 3FOZA 2YS7A 1SA0A 2O5CA 1X14A 2JD1A 1EGAA 4QT0A 4UD2A 5KYUB 2HD4A 1ZHHA 1YL6A 2QVBA 2Y1KA 3CX3A 2QZ9A 3EWNA 4RX1A 1J8QA 1CQIB 2MSNA 3MOIA 3BCRA 4DLRA 3HKBB 3PCTA 1X86B 5DF1A 5JV5A 2QAGB 4A15A 3Q6IA 5JJLA 2CXOA 4DJTA 1F5SA 3RTAA 4NAVA 4WNIA 4OFZA 1RHUA 4M8LA 1JAXA 2I2CA 2G1UA 1WXGA 4TVBA 4JR1A 1C1XB 3HBMA 2VJBA 2IPXA 3KZCA 3RTGA 3TLJA 4ZI7F 4ARCA 3TGLA 2GRUA 3RYHA 3N07A 5D87A 3ORHA 4PSAA 3P8ZA 1RPJA 1DLIA 5G0VA 1ZC4A 3WNCA 4CKBB 3HY4A 3QOFA 3UAYA 5LDHA 3NORA 4ISCA 1UBKS 1U65A 4HAUA 3NDRA 5KSZA 4Z7JA 3GRYA 2HXSA 4LX0A 2HMWA 3KG2A 3MSXA 1V5EA 4JZYA 4BOYA 2Y1FA 1GQSA 2RB4A 5HQ3A 3WGMA 4D6XA 3AC0A 2QS9A 4LAFA 1VCMA 3IOMA 3MYYA 5F21A 1EUCA 3CNLA 2UUPA 1K8QA 1TLTA 3E23A 3T7EA 1RWWA 3LD9A 5D84A 3T9EA 4BVJA 5J2UA 5FPPA 3RSFA 2Y1WA 1R8XA 1FB5A 3BHNA 3GUCA 3HKCA 3D0RA 1B4DA 2VOJA 4KMMA 4LYYA 5EHGA 5C80A 2GNAA 4R31A 1DS6A 3L4KA 1CJVC 4Z2YA 1Y3DE 3QYPA 3OIVA 3CG0A 4J6EA 2NT3A 5T4BA 3USCS 3AR2A 1A7KA 2YDYA 1G17A 1GZVA 4IDQA 3DS8A 3F9CA 2ZBUA 3TLEA 1KKLA 2CE2X 3F67A 4E70A 2AMVA 2B4AA 3VYVA 4FYPA 2H4FA 3I42A 1N6LA 1H6BA 1RJEA 2Z58A 3RGWS 1U0JA 2FMIA 3BTOA 4O1MA 4QDJA 3LF2A 2NZ8A 1WZEA 1VJGA 2KW5A 4F85A 3VPDA 3EBLA 1XK6A 4YRJA 1TJ3A 2IYEA 3HKEA 2CD9A 4X1KA 4K0KB 3GFGA 3ZXIA 4KDFA 1XDGA 5HW0A 4JQZA 1SOWA 1FYWA 1DBSA 2F1JA 4G2TA 1KZGB 5BYBA 5EN4A 2NM0A 2HK9A 2O8VA 3OWXA 1ZWLA 4INZA 1CQZA 1L5YA 2BDTA 1XG5A 1D2CA 3ZJVA 3NT4A 5EUMA 1SVIA 3H9EO 4X91A 1RRMA 2RBGA 2WTMA 2G6TA 3MN1A 4RJIA 1WHTB 2FWAA 1IBKB 4TS3A 3VKFA 1FNNA 4AKEA 3FVRA 4V1CA 4V1CB 5K0GA 1MZPA 1RHQA 2GI4A 4GGMX 3H18A 5TRTA 4ARIA 2EKDA 1RAIA 4BFZA 7REQB 5FR1A 5K20A 1SCKA 2UUOA 3M6LA 2ZM5A 2WT8A 1J8VA 4Y67A 3ZUPA 2I3DA 1RWKA 1AM4D 1HEYA 3GZTB 1KVRA 3WKDA 3AEKA 3EASA 2W8BA 4GHWA 4QVKA 1RPAA 4XAQA 2XMCA 1U5CA 2OP0A 4FZ3A 1PFKA 1NDQA 3H4MA 4JJZA 4TMYA 3Q87B 4FI3C 4OAOA 4G9BA 4KAJA 1V35A 3TIGA 1XBTA 4MV9A 3GYBA 3DUWA 4RCZA 3DNPA 3MBKA 4RQAA 4F6CA 4B3FX 3OX1A 2Y9PB 2FUEA 3IVCA 4RQTA 5EXSA 2HU8A 1E62A 4ITUA 5A71A 5KOYA 2Z98A 4I50A 4MV8A 4BP8A 1RRVA 4HDMB 4LOJA 2BM9A 1A4UA 2JJ8A 4NOJA 3KOOA 4MUJA 4YQFA 3T1TA 3SZGA 3GNSA 2X42A 4JBWA 5HWSA 4RS4A 5T57A 3LGXA 2RGCA 2AW5A 3M6FA 3G1WA 3OAAA 3QKUA 4LECA 3EK2A 2C00A 1T13A 1ZI8A 5JZMA 1US8B 2C92A 3CWQA 3TXAA 4G1UC 1HDRA 1CF2O 2WIFA 5ICMA 4JJAA 1LCIA 1Z0ZA 5DNUA 4F2HA 2YWHA 1BGVA 3O93A 2MMGA 3OD5A 1G5TA 5LLDA 1JI3A 5LUBA 1E7RA 4B09A 2WZDA 4PANA 2X14A 5K7SA 1D1QA 2AEJA 4P5DA 2B4TO 4RPGA 4TQ9A 2XHZA 3NNSA 1WRBA 4C6TA 3W8EA 4BMXA 4CKBA 2H9AA 1WVGA 4ZN6A 4O8ZA 4EY5A 4DCNA 2OILA 5IT5A 3E15A 3R6GA 1XTRA 4TLCA 4ROSA 3D4OA 5JJIA 1YSCA 4O1HA 2ZREA 2PPVA 1LV7A 4HN2A 4IYJA 5BSVA 3FTFA 4LDRA 2PMKA 1G0OA 4MZDA 2CJWA 2O50A 3G2QA 4TGLA 1E8DA 2P6MA 4BO5A 1F0KA 2CVPA 3DYVA 3L4SO 5DNYB 3F9RA 3AH8A 2Q3JA 3HP7A 3K30A 1P2SA 4HJXA 4C1BA 2C7PA 1S3SA 4QYTA 1I32A 2B4KA 3AYZB 4J16C 1YS6A 3PWSA 4BRSA 3B60A 4MUFA 1DRVA 4E3ZA 2H06A 3WLOA 5K6TA 1O4WA 2XYRA 4Y2QA 3ZVMA 1YK0A 1GUFA 4CT4B 3HC7A 1HFKA 4LDAA 4PCLA 1XQVA 3CINA 4UNSA 4X0EA 4RK4A 3B6ZA 2RCNA 1O6FA 5LJLA 2VHWA 3ZGYA 3BRSA 4V0SA 4ARAA 4BXOA 1RQNA 3SFTA 3R5HA 2PANA 2ESRA 5JCXA 2AXNA 3QPVA 4L02A 4ONEA 3N05A 2CVQA 4DCMA 1X7YB 2AD1A 4UHDA 4ZZ0A 2EKPA 2DC1A 4FMDF 4HGPA 4RS3A 2Y0CA 1OXKB 1FEZA 2YFHA 3N3AC 4F6RB 2C42A 3AKDA 3QQ5A 2OFFA 1G20A 3RSGA 4D3ZA 2WWTA 1AS2A 1N0VC 2WWVD 3QXGA 5DNEA 1H8EA 2VIIA 2XCRB 1SC3A 1V6AA 1IMOA 3T99A 3ZR4B 1OT5A 1KYXA 1LFDB 2JBHA 4JUIA 4URUR 1UPAA 2AC7A 4JT2A 3ETJA 1B00A 4BRUA 1DOAA 4PZYA 4CHTA 2F4VB 4TT3A 4C76A 5CFQA 2NSJA 1JMVA 1UMCA 1Z2OX 1EFVB 1LXCA 2YCBA 2CUNA 3G0BA 1HURA 3I0NA 4EECA 1EI9A 2E4ZA 4MP6A 4MVJD 2IPOA 1TJNA 3QKRA 3N28A 5FA8A 4G0XA 1KAEA 4PNPA 4NBRA 2YVUA 5CVUA 4R3UC 2VYFA 1CRLA 2C5GA 3GT3A 1WXXA 1K5GA 2W4QA 1WD7A 5KNBH 4ZI7B 1V1MB 2C5FA 2Z2XA 2WWYA 4ALLA 1Z36A 1SCUA 4G1MB 4ENSA 3MLAA 1Q15A 3LQFA 2AG0A 5KYWA 4AKTA 4ARZA 1QV6A 2ZIUB 4TL9A 3I52A 4Q66C 3WBFA 5C1DA 1FJHA 1YRBA 2WHPA 3PQ4A 3NEYA 1RP7A 3SP1A 2XPCA 1PFUA 1JQLB 2ON6A 5SICE 2R5NA 3BFJA 3OLCX 2P11A 3P9RA 4M38A 4AP5A 1TF2A 3I32A 3FJOA 5CFLA 1W4AA 3VPSA 1IY0A 3UXHA 2AEMA 1UPTA 4KYIB 2YICA 2Z95A 4YX9A 2JZNA 2YC2C 2YXPX 3B89A 5LQSA 3VDRA 1A1VA 1E66A 1AH2A 2P9ZA 3JVUA 5LXTF 1E3LA 1GITA 1PWXA 1XJQA 2B1IA 2XDQA 3BL8A 5J2TF 5KIAA 4ZJYA 1TTHA 3EZ2A 1E0DA 1O3YA 2RKWA 1APBA 4D8TA 1QRDA 3NOOA 3E7DA 3K70C 3QEBZ 3B7PA 3HDTA 3AONB 4R2HA 5DGTA 1PZHA 2F3TA 3PSHA 1IN7A 2LNDA 3UGTA 5JI2E 5KQRA 3BGSA 3IXLA 1PJLA 1X87A 5C0OE 3VPBA 1YZHA 2O1EA 3DEAA 4KXWA 4E33A 4JODA 4YAIA 1JWBB 2Y2VA 3MG9A 4HFJA 3IX7A 3NWEA 4MUIA 4WEOA 1SKYB 4ZRMA 4RTOA 4O4LA 2EXXA 4RW0A 2VQFB 2QRVA 1H3FA 2VS1A 1POWA 2I8CA 3GG2A 5AIAA 3BS4A 5EJ6A 2VDJA 1MGPA 1O0SA 1ORHA 1LC0A 5DBGA 4V39A 2B6NA 5LPNA 1IXKA 1JR6A 4Q3KA 1P5HA 2RKOA 2PCJA 2XVYA 3VMFA 4BGUA 1ZKMA 2X3UA 3OI7A 4ZC1A 2XKKA 4CL0A 2H1IA 4B84A 1PX0A 1JG4A 4GEKA 1AK9A 1TE2A 3VGJA 3KAKA 3EYWA 3ZWOA 1HDOA 4BV9A 3LOQA 2XUGA 3D7SA 1YBAA 1NJSA 3OEHD 2QN7A 4HS9A 4EGAA 1N78A 2QVXX 2CXSA 1N8NA 1L4MA 2WYOA 4YJKA 3STVA 4LJRA 4W1RA 5JYCA 2IPLA 3QE9Y 2WWGA 4Z4CA 1YB7A 1XQWA 5C52B 3O82A 3GLIB 2O8BB 3HXTA 4D5GA 4L0DA 5BQXA 4EGFA 2K5UA 3CEJA 4RYDA 4PX5A 1DAIA 4M1MA 5CYOA 3U49A 1PUIA 1R5OA 4C0QC 4BO0A 1QU2A 4OQMA 1LNZA 3K5HA 1ZU5A 2HSEA 4JY7A 3I5YA 4YONB 4L4RA 3T95A 3M4NA 4E32A 4PNEA 1UEIA 4AZ3B 3PEYA 1HM5A 2FPKA 1EXVA 2EGUA 3EMDA 4P4UA 2J07A 4MMYB 4PCUA 3JD1A 2RGUA 3R3VA 5JIBA 4GWGA 1QVVA 3MTQA 1XV5A 3L0PA 2VPTA 4EGCB 3BMQB 5KOHB 3PGMA 2M6LA 3JSAA 2WVAA 5M3BA 3KZNA 1WB6A 3GFTA 5EJ4A 2QD4A 1WUHS 1OI2A 5BWBA 1UZNA 3DBHB 1SNYA 1ZCAA 2VK1A 3B6IA 1A9TA 3HJUA 4GQIA 2IODA 4HXGA 4QBFA 1FFXB 2VWGA 4KR2A 4PC3A 4F4DA 3L0SA 2PH5A 1NKTA 1SRQA 1M1YE 4AZ0A 2CHEA 4BX3A 1GP2A 2AMYA 1K88A 2P75A 1PR3A 3GQBB 3LX4A 2FRDC 1G20B 3FFXA 3B6JA 4QXAA 4HAIA 2PMFA 5GIPE 2ECPA 1N8SA 5B1SA 3DH0A 2CLIB 2EW8A 5EIHA 1T8PA 3I53A 3TD9A 3BWDD 1X0XA 4KQ6A 3I9OA 4M1WA 4MQ5A 2NOAA 5AFSA 2C97A 3Q3VA 3IT3A 2VZ8A 4FNAA 5JSFA 3ZXXA 3I39X 2ZP1A 4KO1S 4YTEA 4GOKA 4ND2A 3WFJA 1DQSA 1O08A 3F4LA 1S2MA 2OHGA 3CUTA 3ST7A 2C3YA 4OGWA 5E6SB 5KNDA 4DUYB 4BVHA 2ZDGA 3IVAA 4HGYA 4LSWA 2FZEA 4FOLA 3DWIA 4R8MA 5JS1A 1Z4NA 3AP3A 3FMGA 3WTBA 1QYDA 5EL0A 3ZWAA 1O9GA 3DWEX 1BDJA 5KEIA 5B7NA 3NXKA 1OFIA 4HEJA 2R1VB 4L16A 3CF4G 4OAPA 4WOPA 3ZW7A 1PU2A 5I47A 5IKMA 1VMKA 3QWAA 4LDPA 1CQWA 5AM2A 2BFOA 3AKYA 3OT1A 1PL7A 3PUHA 1VCNA 4L0CA 4YMUA 2FRDA 2OE2A 3T7CA 4YT4A 5FX2A 1NJ8A 2CJWB 1WULS 3GJ4A 4W82A 4QAQA 3LH5A 4NF2A 1LKZA 2QLTA 4JUAA 1WQ1R 5AOCA 5TEVA 5IT4A 5HE8A 1I5RA 3NKVA 3KOXA 1TQHA 1V26A 3H1AA 1BHO1 4P1ZA 3F5DA 2AG8A 1GEGA 4QEDA 1HSOA 2YHIB 3STYA 2BGWA 1CJKC 2NXWA 2YZMA 2VNAA 1CK4A 5DTJA 1DJMA 4PYKA 4EYQA 3KD2A 1HA3A 2WM2A 3PG5A 1DJLA 2DJ5A 5J4HA 4BPRA 5CCBA 4UE2A 5BQFA 1NWCA 1RZ3A 1GG9A 1TW2A 4OMDA 2QB5A 2NUTA 3DZDA 3RT1A 2ZR9A 3EDRA 3MM4A 3ILYA 4L50A 3RRXA 1C1YA 2AZXA 3QLEA 3OOHA 3P9IA 3OPYA 1AC5A 4A2CA 3HWRA 1F6BA 1YMUA 3D5QA 3O8OB 4JB8A 4A2PA 4AUEA 4Z1MD 4ZCSA 4MVJG 2DWCA 1XFDA 1XDZA 1NW4A 3DV2A 4OLBA 1V9SA 3H5IA 3PGVA 1DTWB 1WXHA 3BGDA 2ZUCA 1ZD2P 1P7ZA 1XEAA 4U6SA 1ONNA 3LLVA 2X5OA 1QIHA 5HBGA 5AI5A 3KDSE 4F5EA 1J8FA 4WFQA 4LZPA 5A1JA 4ZI3A 3FTPA 3KCQA 4R8RA 3TCNA 3G2KA 1JDUA 3P9QA 3TK1A 3S7ZA 3ZWKA 4ZHQA 4UJ5A 4Y1RA 3IHKA 1EFUA 1HH4A 2JA2A 4F2PA 2DSTA 4RK0A 3GMTA 5AESA 1WZIA 2QF7A 4F4JA 1QO7A 4DR1B 3M81A 2ZYAA 4E1VA 4XI9A 3U3ZA 5BYJA 3OWHA 4Q4HB 2W8BB 4PG7A 4TWRA 4AJNA 4I66A 1NTOA 4KFRA 3TW8A 5A9SB 1YWGO 5COQA 3MMSA 2WF6A 4IEFB 1IPHA 4HWRA 3IT1A 3SYKA 1GGFA 3UMCA 2PQ0A 4DZRA 3OZGA 3RNLA 3BE4A 4TTIA 4RZXA 2NTEA 3X1XA 4WZBB 3TIIA 3K9NA 1GUAA 5D5QA 4PICA 3R6TA 2D5CA 1NX6A 3A3KA 2GHRA 3EBPA 4DXHA 4XSVA 4BNKA 4IIDA 1DKPA 1ZVJA 5A1TA 3MQ2A 1NAHA 1I4WA 4LYFA 2CNBA 3HCWA 4M9CA 4B6JA 5DBHX 4RZ2A 3NHBA 5FKJA 4HH3C 4L0QA 1HMPA 1IULA 1I9GA 1ZD5A 2PGAA 1V8PA 3HR8A 4Q6BA 2G9NA 4G81A 1R00A 3U0BA 2PSHA 4FJ2A 1DNPA 3VZBA 1ABFA 5HUJA 4UM9D 3UEOA 3ABSB 3ZDQA 1Y42X 3KT3A 4GP6A 1E99A 3O0TA 4UAUA 3PHLA 2WR8A 2ZYTX 4DXAA 3X1DA 1GNSA 3DD5A 3CKLA 4FHZA 2GAJA 4KRXA 1P0QA 4QSMA 1WBDA 1T2AA 4A1FA 5AK5A 4A8TA 3N2YA 4AJLA 1QHGA 1GQRA 2VPYA 3BG5A 4C7OA 2GFQA 4MTCA 2ZIWB 3VQTA 2QZPA 4Q9LA 4IFBA 4EA6A 5JQGB 4LC1A 3RF7A 4EKNB 1V43A 1NV8A 1GNVA 5FTLA 5JANA 1YMVA 1D5CA 5TX7A 2G9ZA 2EIHA 3QYFA 1F12A 1V2HE 4Q9JA 4CUJA 1BXRA 4M8SA 1CDDA 2QTBA 1Q2UA 1TUGA 1TXGA 3QVUA 4O8CA 3B1YA 3QKRB 3UFXA 4E2ZA 2VSYA 3E5MA 2GM5A 3C3AA 3AUXA 3WQSB 4XWOA 3O2SB 3R8CA 2FU5C 2XY4A 3WL4A 3GJXC 1WVIA 2BBOA 2VCHA 2WAXA 3L0IB 4GPD1 4J49A 1T25A 2AMJA 1M73E 2AC4A 4G4JA 5AICA 4RIIA 3PNKA 5JFTA 2DTEA 4PHFA 3OZRA 5D51S 1QP4A 4GNRA 2BM8A 2RHLA 3CHYA 5FBKA 3BHMA 3W2IA 1LD3A 2FMTA 2CV2A 3ABRB 2CWWA 2X1LA 2VBIA 1C0LA 1QV9A 1M3SA 3GMIA 4DNFA 1NXQA 1ULBA 1ZJZA 2WA1A 4L3OA 5ALLA 2Z6QA 1A50B 3CE6A 5A06A 1PL8A 4AI6A 3H9JA 1M0TA 4V2UA 5H68A 4B4KA 2NT4A 2C31A 3H0KA 5KMGB 2Y1EA 1HC7A 2C7RA 2I4MA 1EWVA 2JFHA 4H1UA 3FWPA 1ZFNA 1R37A 2HTFA 1T5OA 5BUSA 3GHYA 4RTMA 5I9SA 1RP1A 1QH8B 2XUPA 4IJKA 2QRJA 1VG0B 3E58A 2DU8A 4TYYA 3V34A 4YRBA 5LU8A 1YDWA 3PDUA 3JYQA 4D9MA 5CPFA 2Z3WA 3UICA 1RHKA 4MRVA 3C97A 4KSCA 3L7CA 3NANA 2FFBA 4J75A 4HDRB 1FNBA 1G3MA 1QHHA 1XEXA 3HLYA 3K53A 3M1YA 1ISMA 4Q12A 3VR6H 3WNQA 1CETA 2QMZA 3WK7A 5FLXA 1PKXA 2PO7A 3FI0A 3DXZA 1XMIA 3PC3A 3QXCA 4OHOA 1R6UA 3N7TA 1FTGA 1EBBA 3R7LA 5J4YA 4LHEA 3GK3A 2RSLA 1IQ0A 2OV3A 2VBCA 3BK1A 4M7WA 4JNKA 1YJ8A 4H17A 3S7TA 5DM60 1NXVA 4LTNA 4MS3B 3IEVA 1NBIA 2BBWA 3A4TA 1UDXA 1U4SA 2FJPA 3F7NA 5JBNA 5LDDC 1L4YA 4K9SA 1G7TA 3CG4A 5CDHA 2X0KA 3EFOB 5EE9A 1ADCA 3MT7A 5FI0B 2GCNA 1Q20A 5IZCA 4I1UA 4EJSC 2A58A 4JEMA 2ZBGA 3DL4A 3K1YA 2GBCA 3PCXA 3ROZA 3AOEC 2XGJA 2W6CX 4E1AA 1A77A 3AWDA 1DX9A 2EF1A 5C5CA 2MU1A 3EIEA 5H3LA 4Z9AA 3SQWA 5IKOA 5D5HA 4LS3A 4L8VA 1IEXA 4Q1VA 1ZH8A 2X6RA 2FZWA 3KV1A 3GCGA 3NAMA 4K9OA 2ZXFA 1WEKA 2HJWA 3G2NA 2YYZA 2BFEB 2BTQA 3C7TA 2V8BA 3MHTA 1KMHB 2FN4A 4UUOA 5LC1A 4EUHA 5HJ5A 4UHHA 4J6FA 4MAFA 4P3KA 1VI6A 5DI3A 4EFKA 3VYSB 3CT6A 3W5HA 1AF4A 1SCQA 1E1KA 3JALB 2R2GA 3IVXA 2IW1A 1ML4A 2O1XA 1P1KA 4K1LA 4O4IB 4XOUA 3CZ4A 3DE7X 5E8RA 5LFAA 2E5FA 3PHGA 4FYHA 1Z5OA 1KO8A 5HE9A 1VJDA 1U4OA 2QTAA 3MWGA 3FNGA 4M0DA 5K0BA 2FPIB 3ZHBA 4YAWA 3JR7A 4IIUA 2PRIA 2GDZA 2HV9A 1T2UA 1EFPB 3RRNA 1C1DA 4WXRA 4DUGA 4DR2B 4XPZA 2GPSA 1Z56C 3JD3A 4LNUB 3G7NA 2XNJA 1OTYA 2E6UX 3T7JA 1Y9ZA 4ETNA 2DB3A 4C43A 1ID8A 2P68A 1WU8A 2HGZA 2Q0SA 2WZBA 3FZQA 3IHLA 4B6EA 3PIRA 3BL6A 5FL7A 3CNNA 1DRKA 1PFVA 4EB6B 1QCDA 2D2VA 1JKXA 1CQJA 2R3SA 3C5CA 3NB0A 3PR3A 4RKFA 3DM9B 3N75A 4A6EA 4BS9A 3ASVA 4IKEA 4BKUA 3OF2A 2O4CA 2QX9A 2AQKA 2G6BA 2C5HA 3G59A 4JYMA 2PZFA 3VSDA 4WFJA 3DEIA 4U5QA 4YEDA 3N76A 1VHTA 1A04A 5HXAA 1J2JA 3A2MA 3S8EA 5K3FA 2ZGVA 1JIIA 3M6AA 4DKXA 3MZ0A 2SNIE 1Y1LA 5IP5A 5KJEA 3NUGA 3R0JA 4EH1A 2L17A 3IQHX 1JDSA 3WGOA 4ALJA 4MEBA 1J56A 2WMYA 4XGQA 1HSZA 5F52A 5F7JA 5AUQA 4ADSG 3P9SA 5AOBA 1LDYA 4IR7A 5JZSA 5IM4F 1GT91 1JE1A 1KDTA 2DBRA 4GYWA 4X84A 4YASA 4CTMA 3D6AA 2GM4A 1XRJA 2IYYA 3C3MA 1EUDB 3R4VA 5BQ3A 3RIGA 7GPBA 3KUUA 1D04A 3R3ZA 1LRKA 4ML3A 3CW2A 4UUNA 4C07A 1FFDA 4JQCA 4MVJA 1CBUA 4BJ3A 1OCEA 1ONOA 2VFAA 3ITKA 5HK8A 4BNLA 4ZGWA 3ENKA 1T2EA 2HDOA 4N5DA 2P62A 3FE2A 2Q99A 2CLHB 1HF3A 1GZHB 4X1IB 3ZBPA 2I2FA 3Q3GE 4O2BF 5LOVA 2Z5LA 1PF7E 1GPMA 3KWLA 4QRHA 2DUNA 4ZZ2A 3O8OA 4QFCA 3WLIA 4C01A 2RJ3A 2GXAA 2CMDA 1XTTA 1EFRA 3D8SA 2JGDA 1HYBA 2WG0A 3LTEA 3WL7A 3PC6A 1QQAA 3NYQA 1B23P 4HLUC 1P1FA 1JYEA 1R0BA 1JKJB 3L7MA 3NWPA 4KPUA 4P81A 4MUEA 2W8ZA 4GS5A 1Q1EA 1V3TA 2UZ0A 4ILEA 5BRAA 3F3YA 4DLTA 4KC0A 1AQ6A 2VG8A 3W77A 5T4HA 3L8YA 5HIMA 2XCLA 1RHMA 2P35A 2NO4A 2XNDA 2JBAA 5CHEA 5IXSA 4TRJA 1RHRA 1MVNA 3HNRA 5E3JA 2BFCA 2ZBVA 3BB4A 3RYHB 4CKYA 5CIWA 1RPZA 2EJUA 1ULUA 2AF4C 2JB9A 4IOMA 2W70A 3NVMB 5EWJA 3PBKA 3QJYA 4B46A 4CV2A 4F5ZA 4UEKA 5AHRA 5IAJA 1PL0A 3P94A 4O2BA 4PYLA 4G97A 1BKSB 1YGPA 4C3VA 2CJYA 2Z0MA 1PK7A 4R9RA 1ESEA 3DV0B 2FZKA 1PE0A 1JJ7A 4LX8A 3A8TA 1NUHA 1QOPB 3OJCA 1S4MA 1Z62A 1P1JA 3VX3A 3VRHA 2GYVA 2R6ZA 4YT2A 4W8OA 4PSKA 2PLAA 3M1IA 3U5TA 5A04A 5DASA 2QV0A 4O33A 4LKOA 4NBLA 5EKTA 3SZLA 2IOQA 3AU8A 1RVV1 2CLDX 2P5TB 3P0JA 4M83A 3ER9A 3DOEA 4DWVA 2GZSA 1BHJA 2MR6A 4IFIA 1JPNA 3V4LA 4AN1A 3N39C 1TTQB 2HMYB 3J80A 5HYVA 4PU0A 3N2IA 3FCUB 2CFRA 4YRKA 1ZRMA 2B25A 5AXBA 4EY4A 3MT0A 3GRZA 4RIFA 3JQCA 3IP1A 4M1QA 5H0IA 5JNLA 1BEZA 1YHNA 3H5LA 4AJEA 3RJTA 1PWHA 5D5PA 4IJWA 5E38A 3GAZA 2WWHA 1QMGA 4EHBA 4CIWA 5ESRA 5AJHA 3S2EA 4HOYA 4HPJB 3HU5A 2VJLA 4A36A 2EHJA 1ODSA 2ZTUA 3C98A 4H7JA 4NENB 5DHFA 5JISA 2NU9A 3ZI4A 4RTSA 1R1DA 1C3LA 5E7MA 2YY7A 3DBHA 3VVCA 1XZPA 1IAQA 1KDYA 3SKXA 1U1CA 3HSYA 1M1ZA 1NIPA 3PNMA 1VRWA 4EYOA 3OQMA 4L6IA 1CIVA 5MFPA 4RF4A 2PJUA 4KGXA 5H5JA 5SY9A 1VECA 2UYCA 1GKLA 1MA3A 2R11A 1NUQA 4IVRA 4JCCA 2DPMA 1UBMS 4TUYF 4ECAA 2ZVJA 4QM7A 3KVOA 1QPBA 2EFDB 3DF9A 1HORA 4US1R 4ETIA 3E3OA 2WJYA 1YR7A 2P6PA 4O4HA 4FKZA 4MV3A 4W5TA 2QMOA 5FNVF 3HUUA 3FWYA 4GZ6A 2FX5A 3H65A 4IP0A 5K5EA 4C3ZA 2RH9B 3C6ZA 4GT1A 1NKSA 2YHSA 1XHFA 4RNDB 1TKCA 4RY8A 2IWRA 3RC1A 2CGEA 4TTVA 2JIMA 3D81A 1T29A 3FZEA 2XVMA 1XD2A 5LP6C 3DE5X 1L8OA 4KXNA 4LGYA 5CLFA 3DDOA 5TJHA 2GWRA 3ORSA 1I7LA 2XDWA 4G5RA 3SHQA 3ZE7A 4B3XA 4MWCA 3OCUA 2FEPA 2RBKA 2AYZA 1H2BA 1KSJA 1TFUA 4ERNA 4LQDA 1SHLA 1ZD9A 4JVMA 5IZ4A 2P2CA 3PZRA 4KIFA 3WIBA 2PJRA 1SXJD 3L05A 4QU0A 2WBLC 1N57A 1ZH0A 4NU8X 5K0JA 3MERA 7ADHA 3N8NA 2VTBB 4OX9Y 4D6PA 3FSJX 3ADCA 1SELA 2G63A 1EHIA 1MMFB 3WWOA 1TUBB 5C46F 1G5FA 4EO4A 4Z4FA 2ZE8A 2WSLA 3TLXA 2FWBA 3LYAA 5FNVA 4EMSA 4ES6A 1TZ2A 3D6HA 3N7AA 1UFKA 4WLUA 2ZJAA 5JSYA 4TT8A 1Y0BA 1CEYA 3WLEA 1DSSG 4RLHA 3CNBA 3DMHA 3SICE 3RAGA 1CCWA 1Z74A 2I4NA 3IIIA 4IMJB 2UU9B 3I76A 3DAYA 2XZDA 4NTZA 3MS4A 1XTVA 4KQMA 3FY4A 3IA7A 3G0IA 3GXOA 5K2OA 3TR0A 1YBFA 3HCPA 1PL6A 1PQUA 1E2MA 2VL7A 2YWFA 4GKAA 4V03A 1A3CA 1FTNA 4WW0A 1NFQA 2AOXA 1FX0B 1J2EA 1Z0SA 3O8NA 4JXZA 1JQEA 3OMXA 2B78A 3C3DA 1U0FA 2OFXA 3KTAB 4Z9BA 3L5KA 2VF7A 3DP9A 3O8LA 2AL7A 5E0OA 5JAQA 3VKVA 2IOFA 5BMOA 5HF9A 1OLUA 3CJRA 1TC1A 3SN6A 5A4IS 1GDDA 2W9XA 2ZRQA 3NDPA 1B1AA 4Z0NA 3PTAA 1J97A 2C61A 3EA5A 1N2ZA 1BC5A 2L2QA 4M0EA 1Q0HA 3J81k 1LLFA 3U56A 2QRMA 2WAOA 3N8DA 1P7WA 2WYUA 4YMLA 4IXDA 4DGSA 4F2DA 2QT0A 2HRRA 3X2SA 3G8AA 3WNBA 1E1RA 5G4KA 3ICVA 3C2QA 4H0CA 3SHFA 1M2JA 1ADBA 3K0KA 1GPH1 3ZI7A 4B9AA 2O05A 3UHOA 2W6QA 3K70D 3HN6A 5F3RA 1AZTA 1LZKA 1PYGA 5ALOA 4M4SA 2ZT7A 1UT5A 1VKHA 2GN9A 2JFBA 5ICEA 2I8LA 5C1PA 1CFZA 1ZGHA 1Z7EA 3MJFA 4IWYA 4MB6A 3IR5A 1SK9A 1QFSA 2R7NA 3WL3A 3CT4A 4BMNA 5EJAA 1HY3A 4QOIA 4D96A 1ADGA 2F6RA 3AERA 3AM5A 4R05A 3EXIA 1R0ZA 3JWEA 2A1IA 2HJGA 2J45A 3W5VA 1PGOA 1JJAA 4ESOA 1U8AA 3M0EA 2X7XA 3D8HA 1P2FA 4ND1A 2ZUSA 3P2EA 1LH0A 1IIBA 1YQGA 4MRPA 4F9FA 2ZAGA 4NV3A 4ZALA 1GGVA 1UMDA 3C4JA 3INGA 4RA9B 3SKVA 4CN9A 1M2NA 2B83A 4DE5A 3WMWA 3DHVA 3OOEA 2JFYA 3M9WA 1A4IA 3QVKA 3SF0A 4BZWA 4QECA 4CT5A 3N2KB 1VL2A 3FUTA 4OKSA 5H9WA 2IOHA 3MJVA 3W06A 2W42A 1QIMA 3JD0A 1Y7LA 3WBJA 3PXAA 1P81A 3MGAA 1EA7A 4DHWA 2OHIA 2WZQA 2ZUDA 3BIFA 3R77A 3R7WA 1JHDA 3GN1A 4RFSA 4TV8F 3V46A 1PEKE 3LCJA 2Y92A 3NONA 1JB1A 5IBCA 4CGZA 5C8VA 3VYTB 2MINA 4A0RA 3HKDB 5JZBA 1HNWB 1CU1A 4JP3A 3R8XA 2BGIA 3K8QA 4MKGA 2OHJA 4JA0A 4DVJA 4JX8A 3L06A 4K6FA 3VR4A 2ZAYA 1N5IA 5AT1A 3G2HA 4BX9A 3OM8A 1U28C 4ZVLA 3TS1A 4ACAA 4UXIA 2XJ4A 4QBKA 1SC9A 1KPIA 1NUAA 1CY6A 1Z0FA 3QLVC 5FPSA 2CBGA 4CHGA 4EI9A 4WKCA 2YZGA 3LZCA 1S2IA 2GKGA 1VYTA 4CL2A 4DR7B 1DBRA 3A1UA 4UVHA 5IJ9B 4ZOCA 3D7NA 4PPNA 5DBOA 4D8WA 3GJ6A 4DXDA 2F4NA 2GEVA 2GS9A 1LPOA 1YVUA 4LRWA 2WINI 4P4LA 1NVDA 2PBFA 2ZROA 2Q27A 2R6R1 3H1TA 3RFCA 4BJ1A 3AL3A 1T2FA 2Q9AA 5AOAA 3V7FA 4LFBB 1A2OA 1YJAA 2GTIA 2DR0A 4MP8A 3LSTA 4WFIA 3AUTA 2I7TA 1V11B 4MRRA 5HJ2A 1AKTA 3UWPA 4QOEA 2BJWA 2FXVA 1U7WA 3L6EA 4QXRA 5EPOA 1A9QA 1R6AA 5B1IA 1NUSA 4N3BA 4ZMRA 1QVRA 4QLOA 4LYEA 1EDBA 3C3PA 4IDAA 2BE9A 2QL7A 3ZTTA 5HOQA 3EGEA 3L5OA 3V1KA 5ETJA 1T8WA 1ZONA 4X62B 1BMFD 4MV4A 3SIRA 2XQFA 2G1AA 2YDXA 3LIIA 3HN7A 3FDXA 4EFNA 1IZ9A 3ZHZA 1AA6A 3G2PA 1G8MA 3IEXA 4OGFA 4WFKA 5JD6A 3JWJA 3S0JA 2ODPA 4LOLA 5J1TB 4H59A 5FOVA 2PFSA 4L8FA 4JVNA 4BAZA 2JVIA 4Y1FA 2H5EA 4Q4DA 5BSGA 1UEXC 5LMCA 4X63A 1YQ9A 1OB5A 1U2EA 2FCRA 3O90A 2ZJ0A 4MRAA 3O38A 4BIIA 1BQ4A 4UZEA 5MHTA 5BSFA 1AG9A 3EIWA 2BKUA 2F90A 5B2ZA 2IZ7A 3LCRA 3IAHA 3NJRA 3QNWA 3A10A 1ZCBA 2XVZA 4LF8B 4YIHA 1T8TA 2W2VA 5CH5A 2E87A 3QKWA 4TXNA 3OJFA 3ZIDA 3AW8A 4OJTA 4RTPA 2IS6A 5B36A 5CP8A 1X38A 4H0FA 1DUSA 2NVOA 3PX3A 4M3NA 2O52A 3A1NA 4R68A 4OM8A 1DQYA 4DBZA 5FWYB 2V1XA 1D7OA 4N49A 3H5RA 4Y2PA 5EMJA 3RYIB 4EUSA 5ADUS 1MOZA 1OIXA 2W2PA 1UC9A 4R8KA 3DKIA 3MQ4A 4HUJA 2K4MA 1U6KA 4CIBA 1DBIA 1WX1A 2NZJA 2BSAA 2OO5A 3ZS9A 1J0AA 4B48A 2V1UA 5CCEA 1O9HA 2IK8A 2QQ0A 3CU5A 2OA0A 3BL5A 1Z13A 4J3FA 1DIHA 2XUHA 5HKOA 1WHTA 1U6JA 2FMKA 5EP4A 2COUA 5JFGA 1ZN8A 1CYEA 1YFZA 3UWDA 3L2OB 5CA0F 5JYDA 3BAFA 3T54A 4MARA 1KAHA 2PK3A 3FOCA 2QP9X 3V1UA 3SVTA 2R1TA 1N0WA 1LK7A 4Q7MB 2AKYA 3DLAA 1URPA 2RHOA 3W8FA 5J4VA 4Q3CA 4BX0A 3QOWA 1KEPA 2YV4A 4FHFA 3UNXA 3IILA 4MPPA 2ZXUA 4QTXA 2BONA 2Y2UA 4BU1A 3EF1A 4KGZA 4XM1A 5JJKA 1GAEO 4M8IA 2JDIA 1JXOA 4G0QA 1EEHA 5BW6B 3TQTA 3WE7A 1QH1A 2PZGA 5FV4A 1Q77A 5TMPA 1ZD8A 4J9VA 4IWXA 2A59A 2RJOA 2FDCA 4AKGA 5D7BA 1G6HA 1CR2A 3UJ9A 1GPAA 2ZE7A 4I9HA 4NEGA 3ZE8A 1I2MA 5IVIA 4HVCA 2D6FA 4DDUA 1TOAA 1LS6A 4MRMA 3MVEA 1LTQA 2VA9A 4J3JA 5CU7A 4NOLA 4KK3A 2RARA 3B53X 2NZUG 2WE8A 3LWNA 1E32A 4D3XA 1ULZA 3SZMA 2IPAB 4YROA 3KQWA 1XYYA 4EGQA 3HKCB 2V6GA 1CIPA 1SBZA 1U7UA 3CLTD 1D8TA 1N2XA 3NRBA 1IY1A 1F20A 5JMPA 2NYAA 2MJLA 1OXSC 4QG3A 1SUIA 3MLBA 4D44A 4FZVA 2PUFA 1G8AA 4H1VA 4RD6A 2NQ8A 2BSXA 4MR8A 3KR9A 4HL6A 2A5YB 3U37A 4EB3A 5FV7A 2O0KA 1Y1PA 2D0OB 2PH1A 4YRDA 2N1MA 4ZMS<