1FXUA

Purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
278
Chain Sequence
GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calf spleen purine nucleoside phosphorylase: structure of its ternary complex with an N(7)-acycloguanosine inhibitor and a phosphate anion.
pubmed doi rcsb
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 86
structure length 278
sequence length 281
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fxuA00
1PK7A 1SJ9A 1Z36A 1JPVA 1ODKA 3SCZA 4QATA 1RT9A 3DP9A 1LVUA 1RR6A 3P0EA 3KU4A 1RYZA 1JYSA 1Z5PA 1PWYE 4RJ2A 1T8WA 4GLFA 3TL6A 4NY1A 4JWTA 4E1VA 1Y1QA 3BSFA 4DA8A 4JOSA 1K3FA 3OZEA 4OGKA 3NM4A 1U1DA 1YRYE 4NS1A 4MARA 3NBQA 1PW7A 1T8SA 3OZBA 4YO8A 5FAKA 3PHCA 5F7ZA 2QTGA 2AI1A 5F73A 1RFGE 2B94A 1Z34A 1Z5NA 1C3XA 1PR1A 4DA0A 4F2PA 4G8JA 1PR0A 1NC1A 4FFSA 1Y6QA 1CB0A 1PR4A 1Z39A 2I4TA 3OPVA 4YMLA 3O6VA 4L5YA 5C80A 2ISCA 1A69A 3GB9A 4BN0A 1PBNA 5F78A 2AI3A 5CXSA 4F1WA 3EMVA 2ON6A 5B7PA 1V48A 1Y1SA 1WTAA 4D98A 3PNPA 3NM6B 4JP5A 4L5CA 1K27A 5F7JA 1PR2A 1RXSA 2GUWA 1SD1A 1PF7E 5CXQA 1I80A 4TXHA 3MB8A 4D9HA 3KVVA 1RXUA 5IFKA 2Q7OE 1ODLA 2PGAA 4LZWA 1CG6A 1RSZA 5EPUA 3IEXA 2RJ3A 1RXYA 3DDOA 4EARA 5F7XA 2OC4A 1V45E 4GLJA 2HN9A 1T8YA 4M7WA 4DARA 3P0FA 3KVYA 1JDUA 2QPLA 1RCTE 1JE0A 3INYA 4R2XA 4WKCA 4DAOA 3QPBA 2AI2A 1Y6RA 3D1VA 1PR6A 3UT6A 2H8GA 1JDVA 4GMHA 4UC0A 1A9QA 1OV6A 3FWPA 4LDNA 2OECA 3FNQA 1K9SA 4F3CA 1B8NA 3T94A 3KVRA 3ENZA 4TYMA 2HWUA 4G89A 1Z5OA 3DJFA 1YBFA 1QE5A 5CYGA 5B7GA 1V4NA 4LNHA 5EUBA 5JPCA 1SQ6A 1LV8A 4WKOA 4BMZA 1M73E 1Z37A 3BGSA 4ECEA 1T0UA 5B7QA 4DAEA 4DABA 1Y1RA 4TXNA 2QTTA 4K6OA 2XRFA 1V2HE 1Y1TA 4OF4A 4U2KA 5ETJA 4LNAA 1U1GA 1YQUA 1OUMA 4OGLA 1VHJA 3EEIA 1SD2A 3FUCA 4TS9A 4F2WA 1JDZA 4GKAA 4YNBA 2OXFA 3OCCA 3E9RA 1TGYA 2IQ5A 3LGSA 4MCHA 4WKBA 4NSNA 4D8XA 1A9RA 1XE3A 4PR3A 4D8VA 1A9SA 3FAZA 3BJEA 1Z38A 3O4VA 3KHSA 2A0XA 4TTJA 5F76A 4I2VA 3LBAA 3FB1A 3MMSA 1PR5A 3C74A 4QFBA 2A0WA 3DPSA 3E0QA 4QEZA 1YR3A 3UAVA 4DA7A 4M3NA 1VMKA 4WKPA 1OVGA 4OY3A 4QAQA 3LA8A 5B7NA 4MCIA 4BMXA 4TTIA 4X24A 4OJTA 5CCDA 1Z33A 1PK9A 5EFOA 1RXCA 3OOEA 4EB8A 4H1TA 1A9PA 1JDTA 1G2OA 4M1EA 1ZL2A 5CCEA 3F8WA 1OTXA 1TCVA 1Z35A 3OZCA 4G41A 2OC9A 4YJKA 4LKRA 1V41E 4QARA 4TXMA 1ECPA 3UAZA 1ZOSA 1T8RA 2I8AA 1TD1A 1TGVA 1JDSA 1JE1A 4TS3A 5F7OA 4L5AA 3FOWA 4F3KA 1LX7A 3BL6A 1ODIA 3UAYA 4P54A 1U1EA 2P4SA 5K1ZA 1NC3A 5CYFA 2HRDA 4L6IA 5IU6A 3PNSA 2BSXA 3UAWA 4L0MA 4D8YA 1B8OA 4PNPA 3K8QA 3KUKA 2QDKA 3OF3A 1Q1GA 4TTAA 1A9TA 3U40A 4DA6A 1ODJA 1FXUA 4R2WA 4DANA 3OOHA 2QSUA 4TXJA 1TCUA 5DK6A 1YQQA 4KN5A 1PKEA 4OEHA 1OU4A 3E9ZA 3ODGA 1JP7A 2A0YA 3OZDA 3NM5A 4R31A 3UAXA 3EUEA 5KB3A 1U1FA 4BMYA 1NW4A 1VFNA 4WKNA 3K8OE 4TXLA 2HSWA 3ONVA 3IOMA 1V3QE 1ULAA 1N3IA 5I3CA 4IP0A 1A9OA 3DF9A 2AC7A 1ULBA 5F77A 1U1CA 4QASA 3GGSA 1VHWA 1OTYA 3PHBE 2A8YA 3EUFA
chains in the Genus database with same CATH superfamily
4QYWA 4DDVA 1N9GA 1SJ9A 2RGEA 3VU9B 3BT7A 1TUEA 4UBMA 2W11A 4K3VA 5BNTA 1FA9A 3QVGB 4FHZA 3VKWA 2HSZA 4EWLA 1KDRA 4ZYYA 2OAEA 3SCZA 1RT9A 3O4HA 2AN9A 3QITA 2HI0A 3AM3A 1RAHA 3AB3A 3FMPB 4ID9A 2IEDA 2PGOA 5C32A 4J0EA 3CKMA 4JBIA 4KR7A 2IYTA 2AQIA 4UPVA 4DLLA 5C8VA 2HJHA 4F5YA 4P0TA 1J0AA 4F72A 4CT4B 5ECYA 3OJFA 1ST3A 4MO2A 4RJ2A 3U7QA 2ARKA 4MUYA 3O31A 2CLEB 2B4QA 1NMSA 1N78A 5KVCA 1NF2A 2V5AA 4FLMA 2ZIGA 4U2CA 5C5DA 1CR0A 1YC2A 2ID7A 3FYUB 3MTEA 1OY1A 4OHZA 4BE9A 2ZM6B 3W0LB 5IC6A 4RULA 4FQ7A 4FJ0A 1P2GA 1Q74A 2GEVA 5EERA 3BD7A 1TLTA 3O94A 1U8CB 3PXXA 2GZHA 1FXWA 5CTJA 2O7QA 1A9ZA 4MR9A 2MSKA 1QMPA 2JRCA 1SU6A 2IYPA 3ISVA 5EXSA 4QFCA 2C42A 1NVVQ 1EFPA 1YR1A 2EFEB 5C4GB 4PYQA 3DAYA 3H6GA 1S89A 3HFGA 2ET6A 1SRQA 2X2PA 1KY2A 1RPNA 1T8SA 3I52A 4DV7B 4LJAA 1XJQA 1C3VA 2P40A 2WBLC 2PJDA 4HLUC 2IZ5A 1ODFA 1Y5NA 3V34A 1TEHA 2Q4BA 1EFRD 5K2MA 4B76A 1RJEA 2XYVA 4A8JC 4W9MC 3C6ZA 3UK2A 1T3GA 3T52A 3VO9A 4ZVRA 5JG7A 4QGSA 2BFEB 1ECCA 3BTSA 3PRKE 4JD5A 4M8IA 4QUBA 2F67A 3SIWA 4FMCF 4ENVA 4KE6A 3ILSA 5HFAA 3HXLA 4MWGA 5DN6D 2O8CB 4MTCA 4AJKA 1OLSA 2P8JA 2VT2A 1N75A 3KZNA 1GZ4A 3F7TA 2NO4A 2ZDHA 4A6DA 4RIHA 4Q47A 1NR7A 4Q1EA 3L07A 1J56A 1TUBA 4ND8B 3UQYS 5HXAA 3GLFB 1XTRA 3HL4A 4CMHA 4J75A 3VJRA 3ANSA 1DBPA 3BWDD 1CUXA 5I45A 3TK1A 5ARBA 2PMWB 4JEHA 3VNVA 4NDNE 2ZBGA 4Q1DA 1QVZA 1M2EA 4UTPA 2BW0A 4B4KA 3GZ4A 4QPDA 2V6IA 1TTHA 1GGJA 2XZDA 2WKQA 4M38A 2ZZKA 4U7HA 2CLDX 1PFQA 3PC4A 4BRUA 3ELBA 5DWQA 4EO4A 1YI8A 2Q4RA 8OHMA 1I5RA 2NO1A 1U31A 4MLPA 4EF6A 2JLSA 3BTOA 4OM8A 4AVYA 1S2LA 2CCGA 4LRUA 4RLSA 1UDXA 1LSOA 5CAEB 1J20A 4DUGD 2Z1MA 3L1IA 2WM2A 1JEQB 2UAGA 1ZW1A 1QZ3A 1H85A 2ZJFA 4HOYA 3LLSA 3V4VB 4PS0A 1HBJA 2IUEA 4IFIA 5TMEA 1YNOA 1U0EA 2R00C 1UBFA 1FTNA 3WLPA 1MJGM 1B43A 4BNDB 3ILYA 4KYVA 2JIZD 1YIDA 2FFHA 1QIFA 1U04A 4OVKA 4QZVA 5B4VA 2EBHX 1TVKB 4CE6A 1IHXA 1KAMA 1RQ2A 2D5IA 4LYAA 4RV5A 2FSPA 3E8XA 1T5SA 1EK1A 3TDNA 1YFKA 2QTLA 3KKOA 4KPYA 4TZ6A 3TIGA 1AJEA 1L2TA 1GTZA 1NONA 3E5RA 1CQXA 4OLBA 5IKEA 3RVMA 5TLSA 5A02A 1AB6A 1OB5A 1GEEA 4ZZ2A 2OSBA 2LWIA 3LV8A 1CG6A 1P60A 3D0QA 4G65A 3VR6D 1MOZA 2WC1A 4ZEWA 4CMBA 5EPUA 1L4EA 1KP2A 5BQPA 5ENVA 1UODA 4K86A 4TL8A 4PG6A 1KJZA 3KLBA 2ZCJA 1RXYA 2ZYRA 2WUGA 3NAMA 3I2FA 1II9A 3AF5A 4KGXA 1ARZA 1U3WA 3IVAA 2HBQA 3HWSA 3R9IA 2UUBB 1YZ3A 2O8NA 3N0RA 1M1XB 4QRHA 1DOAA 4JVOA 2BUCA 2DFKB 4P36A 3ZJTA 2NGRA 1K6MA 3ZC3A 3LPAA 1A82A 5JWOA 2BP7A 3FKSA 3R7NA 1LI7A 4RAOA 1PZNA 4Y18A 4CQLB 4DV1B 3PCTA 1A04A 4DYVA 2ID4A 1YWGO 3T7AA 5JZOA 4Z7JA 5EZ5A 1DAHA 1QTRA 3NP9A 2HC9A 1FL9A 1XEWX 1IXRC 4WFQA 3TOVA 1VCMA 4D57A 2H11A 2I29A 3GC6A 121PA 1F06A 3ORRA 3REQA 3WIDA 4GPD1 2C7RA 2MMGA 2Y1WA 2IXDA 4PLYA 4W5JA 4YI5A 2CFCA 3QJ5A 3QPBA 2CNBA 2I3ZA 4KWCA 1PR6A 2IUTA 3SVLA 1U2GA 2HT6A 2QGFA 4GNKA 4E4TA 3FZYA 3UOWA 4Z7NB 4UVIA 2WJWA 3FWPA 3WOHA 1CZKA 3PQ4A 2GSWA 1QNLA 1EZ4A 3I39X 1SB9A 3KVRA 1LS1A 4E14A 2ZVPX 1D2CA 2ZE8A 3JWPA 4UD2A 4J2OA 4HH3C 2RHJA 2Y1GA 3G23A 1U9YA 1T24A 2D1YA 1XMSA 4OATA 5HQJA 5EJ9A 1MAVA 2Z8ZA 2OCXA 3AZOA 3QE4A 4NMWA 4S2EA 2ZCUA 3WHLA 2OK8A 2G77B 3BWCA 1M1UA 5C7YA 2X8WA 1GJRA 4I46A 4IKPA 4NQZA 1J06A 4MIEA 3PUZA 4YJDA 3T9CA 2GF0A 4EB0A 1P73A 2XR1A 3C85A 3JQ7A 4YJFA 3WGYA 3L49A 3HVIA 3BK2A 4ZI7A 2PWPA 4OYYA 4EG7A 3D4BA 1JIIA 3WNZA 1BFKA 3SJCA 4CM3A 3F0TA 5KDDA 5HKOA 2E82A 3CW9A 3RRYA 4RY2A 1JR4A 1EWYA 1VLHA 3WKDA 3M6WA 2ZPUA 4H2DA 4B48A 5KX5F 4RVUA 3ZZNA 3ORFA 3SFZA 3PUKA 2FKAA 1T26A 4TV8B 1G9TA 4UMFA 3V3KA 1PDWA 1UBMS 2A30A 3Q11A 1QF6A 1B6SA 2C4HA 2W0MA 4MHTA 1AU9A 1SHKA 2X9QA 3QZUA 5JUWA 3MOIA 1N2CB 1GQ2A 1E3LA 2F1RA 2AOWA 1YFZA 4MR7A 5LC1A 3FHCB 1JQEA 3K9WA 2X6QA 4EMSA 2E1RA 2VLIA 2D54A 4I4TB 2XRFA 4DIMA 2O7RA 2GR9A 4F1JA 5DT2A 1N6IA 1ZNZA 1Q1ZA 1ZVKA 4ZOLF 2R6HA 2JD2A 4LNAA 3E27A 5EJ5A 1SKMA 1T6XA 1SG6A 2QL7A 1HL7A 2G88A 2VSYA 2P8SA 3QF4A 1KI6B 1YUNA 2HL6A 4F9GA 3VZRA 1NXOA 3A4TA 3IP1A 3ZGLA 2GXAA 2C0PA 3E1SA 3FTDA 2QU7A 3C3YA 2WSYB 1G5PA 1L8QA 3GLQA 2H2DA 1GUAA 2NWQA 3GPIA 2PO5A 4FDTA 4TLAA 3VU0A 4F2HA 2PDAA 1D4ZA 2ORYA 1NMYA 4JT2A 2ZIXB 2JGRA 5F4ZA 4C01A 2HCBA 1ZEMA 4B3TB 4CW7A 3TL3A 4QDUA 4CGYA 3AONB 3TSZA 5JD5A 5FWYA 1KAQA 1DKUA 2XVXA 3K4QA 3ZQ4A 2JASA 4C4TA 1A5SB 4LSZA 2C5GA 1VMIA 3B9PA 4JBXA 5TF0A 2VXCA 1P1RA 5FORA 3VH2A 4JHXA 4MHOA 3T3GA 5DLYA 3R3UA 4DBZA 4WZAE 2F9FA 1UPUA 2Y27A 1IXZA 3C6MA 1NQWA 3I9NA 3LYAA 3M9XA 1G7SA 1JB1A 1KJ9A 4N03A 4NZMA 4P08A 2Y9MB 3ZG6A 5FTKA 4YJ2B 3BA6A 1OBVA 4EKIA 4OFBA 2XITA 4P33A 1KFKB 4A2CA 1QG4A 1JDNA 4ZC1A 3E9YA 4ER6A 1XALA 3N8DA 3Q72A 4RPIA 1COZA 3GN1A 2DULA 3H4IA 3TZ6A 1VYVA 4O5OA 4Q4AB 3T3DA 1RQNA 3ZHBA 1M0EA 3EFBA 2AEMA 5KYYB 1Z6GA 1KDOA 2C3OA 3L8CA 4Y6OA 3MGAA 4RYLA 2PE5A 2HXGA 3HR8A 4ZD6A 2ZLBA 3PQDA 2D4AA 3VU9A 4H31A 4Q19A 5KNCA 1GU0A 4G5FA 1T9DA 2WJVA 5BSVA 2YQ4A 2WVHA 5BV1A 1GPUA 3P9IA 2C00A 3K94A 4H27A 1WXEA 4HEA6 3GLHA 4JAVC 6Q21A 4LXXA 3RFTA 2IZOA 4US2R 5EEHA 2FF7A 3FPKA 5CLQA 3VU3A 3AT1A 4ZYXA 3OQ6A 3SQLA 1H4TA 2P9GA 5GJWC 1LWOA 2PRIA 2PNFA 3FDXA 3O7MA 2FSFA 4DYDA 1EWVA 1EFLA 1KP3A 3HP4A 3WB1A 3CCBA 2HDWA 1R2QA 2WVAA 1Y1KE 4W8HA 3EWSA 5BRAA 2FQXA 3A1SA 3L8HA 4IPTA 3PEFA 1MJ5A 1VP9A 1X7YB 1QHNA 3BFPA 2F9MA 2XQJA 3K5WA 4UNPA 1QHEA 3NOOA 4OJTA 1HY3A 1QS0B 3N59A 4QQRA 2XDWA 5IBCA 3RGGA 1H2ZA 2DPXA 2EJTA 2F7SA 3N0TA 4PX9A 4B3BA 4GI2A 2OV4A 4DCNA 4KO1S 5AHKA 3DBLA 5BOVA 1DQYA 1EFPB 5IMSA 5IJAA 2Y66A 2J31A 1NYQA 2EEPA 2R6DA 2ENUA 3ESQA 2IXAA 3ZQUA 4MGZR 1ZL2A 1EFHA 2VK8A 2FMXA 3HSYA 3P4UA 3EEQA 2FWNA 3ETDA 1ULTA 2I2XB 2TMYA 4FSHA 3ZTYA 3BD6A 4D6PA 5AUOB 1E1RA 1K3UB 2JAWA 4TRMA 1CHDA 5AOAA 3L4SO 1J2TA 2A9JA 4ZWNA 2VZ9A 3N2YA 5TXGA 4ZI7F 3GLSA 1E2EA 1QNFA 4YJKA 4LKRA 1RWBA 2Q62A 2R2AA 5T4EA 4XGRA 5I4IA 1VKNA 4HNHA 3LOQA 4S1PA 2PA3A 1L3IA 5THKA 2ID8A 4Q48A 4MQFA 4R9UC 5D3MB 4DSOA 9LDTA 1B8UA 1O94C 3MCZA 2G63A 5K0BA 3CVWA 1T0JB 4XUDA 1ECLA 1GZ6A 2I0FA 1TU4A 1NNI1 1U90A 4II7A 4P34A 3SY8A 2I3AA 1IAQA 4ZCSA 3LO8A 2AEEA 4JELA 4PO1A 2VAWA 1SH7A 1FNDA 3QUQA 1QDEA 1Z7YA 2XHZA 4HJRA 1K8YB 4XPZA 4MRMA 4M36A 1E6EA 1SBQA 3WNDA 2AE1A 3AWDA 1X74A 2OAGA 1ADJA 2B69A 3MB5A 3PD1A 1BE6A 2GCOA 2XX3A 4OLHA 3FUTA 1E1DA 1RJWA 4WBSA 2D8MA 1AIPA 3HDTA 1TOAA 3IUYA 1DJLA 3NHWA 4RJKA 2OCBA 3WNBA 1SVNA 2R79A 6AT1A 1H4QA 2EP7A 1LPOA 4LGCA 4UULA 3LT4A 1CS0A 4TMKA 4L0MA 4TUYF 4W9NC 3S2SA 3TNJA 3WICA 4ZC8A 4CL2A 5KNCH 2GBFA 2FW0A 1P75A 3K8QA 3EBLA 5GVRA 1GZ5A 4JL8A 4RE5A 2FXIA 1ZUHA 2WU3A 3GLHE 3JAWA 4YONB 4AFNA 3H7IA 3I5XA 4P31A 2OG2A 2V5VA 4KO2S 4GPZA 2GVNA 3DL4A 2PS1A 2WD7A 3OUUA 3PK0A 2B6NA 1DV2A 4FYIA 4BPRA 2IPAB 4GF5A 3TDMA 1ISHA 4MB2A 1CEYA 1CQJB 1N5LA 3G5UA 3H9UA 2ZJ5A 3VKUA 3ZQKA 5K3EA 2BGRA 5C46F 2CLSA 4CMAA 2F3RA 3X1ZA 4YRKA 4FLEA 2HBRA 5H3HA 2FPPB 1OXUA 2AWNA 1RQ7A 1YQQA 4OQ4A 1LUAA 3HGMA 5DWVA 2XBUA 2AFRA 2F43A 4LOKA 1DXYA 1OA1A 1FYWA 1ZC4A 3NM5A 4U7TB 3IMFA 4O2BF 5HUQA 5JXGA 3WJ1A 3BRSA 5FNVF 2NV2B 3VC3A 2ZR8A 1ZOLA 4EPWA 1TVKA 3WDKA 3DMFA 4X95A 1WDLA 1K6IA 2PSHA 3MPOA 3EJWA 1XA0A 3WLFA 4YCSA 2B9EA 4WESB 1OGJA 3DHNA 3ZWXA 5KMGB 2GH1A 3QQ5A 4NAVA 5T41A 1A2BA 2FPSA 5CCXA 1JVNA 3K8ZA 3OZVA 2XYPA 1POXA 1C1HA 5ELLA 1G3UA 4PRKA 1GG8A 1HURA 4RC9A 1QRAA 3V4FA 1RBQA 1KQNA 1KFJB 1P45A 5FP0A 1ZIXA 4PSKA 2IEBA 2YYSA 1QORA 1I32A 1WZEA 3T3MB 2PUDA 4YMIA 2WSLA 1WG8A 1E63A 3FCSB 3N76A 4KKXB 4QOEA 4L5JA 3V6LA 4G0UA 1V11B 1W5SA 4OD0A 3A4VA 2EJWA 1Q2XA 6REQB 1I2MA 3I9FA 2R6JA 4HNGA 2XMQA 1IQPA 4HXFB 2WZDA 1DINA 1VL1A 721PA 2RIPA 4N9WA 4CVNA 2O19A 1YQXA 5DM60 4MGKR 2UYHA 1Z8HA 2ECFA 4BNTA 4J1TC 4MW0A 4RDHA 5D5PA 1IG3A 2O7VA 2HD4A 1PEDA 4MP3A 1OLOA 3HACA 1N34B 2AG1A 2ZQ5A 4WW0A 4C3VA 5J5CA 4R1LA 1H1LA 2FLWA 5A9TA 5HCIA 2I6UA 3PQ6A 4WKGA 4BKQA 4NIMA 4LS3A 1PYGA 3ADKA 1VG8A 1LNZA 3WHKA 2PAFA 1VIVA 1T8WA 3QEBZ 1ZQ1A 1U1IA 1FU7A 2GF9A 3A9RA 3F73A 3Q0TA 4MRPA 1NVKA 5KKAA 1GLNA 1J2JA 1SXJC 3CTMA 4HLUA 3JWHA 1RQLA 4LW8A 4U5XA 4CTMA 4MV5A 4ARIA 2PKXA 3DBIA 2ZPAA 3AMVA 5LNK6 4F46A 2ADMA 2Q6OA 3DD5A 2NYRA 4RV4A 1RLTA 1OFIA 1UZNA 3JWGA 1N33B 1JHRA 4G63A 4NXMB 1EA5A 3INGA 2OHIA 4F6RB 4MB6A 3B1FA 4OQNA 2CL5A 4INJA 1JMVA 4HDQB 1M8JA 1ZAKA 3EXFB 1Z5ZA 2OZLA 4LWOA 4YJHB 2I1QA 5C1DA 3TPCA 3OZBA 4H16A 3DV0A 4YJFB 2OXTA 3OHSX 4PHHA 1PDVA 2JFHA 2ZFUA 3I0ZA 3PHCA 3PGJA 2J3JA 1UJ6A 1Z68A 2IV3A 1BX0A 4WCFB 5FTLA 4LFCB 1W4BA 1PWXA 4KLCA 1OBOA 1R18A 1IBKB 3M33A 1XZAA 2F1OA 1AN9A 2LIPA 4LMBA 4B84A 1WKBA 4RACA 4WOPA 4S04A 2RB4A 4QNNA 2OHGA 3QBEA 4P3XA 3VZDA 4FGKA 3KP1A 2OKCA 3FPLA 3V4SA 2NNLD 3N07A 1E2MA 2LCFA 3JYLA 1O2DA 4B80A 1TJ3A 4YJ2F 5CBPB 2W8ZA 5JVDF 4DLXA 5EQFA 3LK7A 1WB6A 1YTUA 3LBNA 1QRRA 2RH5A 1VC2A 4G5RA 2PT9A 3P19A 4ESHA 3K6KA 5ICSA 4D9MA 5LLTA 4G0WA 5C80A 4JR1A 2FQYA 3MMXA 3ZDRA 1XCLA 4KLAA 4Q5IA 1R5JA 1T1RA 4D0LB 2QLTA 6LDHA 4AF6A 4BYMA 1E2BA 4B6RA 1E77A 3W6OA 5KQRA 4HDOB 2FEPA 5CITA 5EKUA 5ESDA 5C8YB 3KL4A 1UPCA 4PX5A 3NETA 4XM0A 2ON6A 1QIEA 2H4FA 1LPPA 2GCIA 1FNMA 3Q10A 4PZYA 3ZYCA 1ISSA 1KQOA 4A10A 2P2SA 4B2PA 1GLGA 3I0NA 7GPBA 4JWKA 3CRRA 2YMQA 4JOBA 1G16A 4JDPA 2DLCX 1V48A 3FBTA 1Y1SA 1VSUA 2EP5A 1WSAA 1QK3A 4TTQA 4OMDA 4FOLA 5L40A 2Z3VA 4LF7B 1XTSA 4ANFA 3ABZA 1DVRA 1X1BA 4QDKA 1R8SA 4RHFA 3WMGA 1E4EA 1Y7TA 5FL7A 5B36A 1AK2A 2G17A 3VSAA 1OWLA 3W90A 1W49A 4JXXA 4IDAA 2QUAA 2V0NA 2PUTA 3NWPA 2XUGA 2VDMB 2DKFA 4YQZA 4NWIA 1RZVA 4AN4A 3RYTC 2IZZA 1MVLA 2QRZA 2D7JA 1EUCA 3HBNA 1IVSA 4CL3A 3KTAA 1BMFA 4CLOA 1FS6A 3EDMA 4DV3B 1U2DC 3ESBA 1Y7LA 3B7WA 1K98A 3T6KA 4E13A 4PZLA 5AI8A 3UV3A 4OBWA 4ALLA 1XAHA 3PEWA 2IBTA 1R9MA 1MC1A 1MFZA 2BD0A 3B2EA 3NLLA 4TUYA 3S7ZA 3ML1A 4D9HA 2I6TA 4FEEA 5IC5A 1FLVA 2HA6A 5KYYA 4RPCA 4B35A 1Z47A 3A1CA 1YQWA 1IM8A 2B7LA 3PC8C 1GR1A 2WT8A 3LCJA 1PE0A 3OQMA 1WEKA 2BF4A 3IBTA 4B73A 3O3OB 1U2RA 2K2QB 2QN7A 4RJIA 4Q4CA 2VPWA 1O5OA 1Z6YA 2GK6A 3AC0A 1Y80A 1J5XA 4G4JA 5F9MA 1KI8A 4TS4A 2K5UA 3ZV4A 1MA3A 1V9CA 1W88B 2RGXA 2V6GA 3FYTA 2WB4A 1XQ1A 4EARA 2OPBA 2I66A 1IY2A 1PLLA 4YAGA 1YDHA 3B78A 4HSEA 3LLUA 4DTCA 1XDZA 3E9CA 4L75A 2VH1A 3UJAA 4CMKA 3LVBA 3KLPX 3E4CA 3ZY2A 2OT3B 1QWOA 2XGMA 5K5EA 2JAUA 3V1NA 3TLXA 4I14A 4D4KA 4B0PA 1FNBA 1R8YA 3ZV6A 3EAGA 2YVAA 2QQFA 7ADHA 1P74A 3SS8A 3FNGA 1IHPA 2BZGA 3GWGA 4FGSA 4P5EA 4ARUA 2XMBA 2GGSA 3K1ZA 4GC9A 4R2XA 3H19A 3A2MA 4MOWA 3VZBA 2X9NA 1SELA 4YCMA 1Z5UA 3E8SA 3HN7A 4LGVA 5MFZA 2ODNA 4PONA 2NO0A 4PZCA 4ZO9A 5HIIA 1KEEB 3D31A 3ZTWA 2PIDA 2QZZA 2X5JO 5KDOA 3HCDA 3QNWA 2Z95A 3KE9A 2RKBA 4G67A 2PL3A 3H1PA 3IR5A 3DBLB 1N2EA 5KOJA 2NTJA 3ANNA 4YV7A 2G1PA 2P4EA 5CB0A 5JTUA 2GBCA 2IP2A 2LP4Y 1Z0UA 2ZI5A 5REQB 4U3JA 3VNSA 4MI9A 5DX0A 2Q45A 1JLLA 3GQBB 4IEFB 3U6BA 1Y6FA 2OILA 2ZE7A 4JA2A 4V1CI 3H99A 2QL6A 1OPRA 2XWQA 1U7UA 2YWDA 2X5NA 1NQ5A 1UKCA 3FRJA 4GM1A 1N2XA 4LJ7A 5EJ2A 5FUQA 3DJFA 5J2TA 4L4SA 4RGBA 3VR0A 2B30A 1NOJA 2GPBA 4PPNA 4EHLA 3GY0A 3OFJA 2WQ6A 1P31A 2IITA 1B0ZA 2Q6VA 1FP6A 5ER6A 5JPCA 4PWZA 3KPYA 3MEQA 3LJKA 1A4UA 3IUMA 3TZBA 3P2IA 4KXMA 3W2HA 3ZLJA 2Q4DA 2VDJA 2HT1A 1Z3CA 4ZI3A 1M73E 3CLRD 4LOLA 4ASUD 1ZD3A 4ZHQA 2R0QC 5CA1F 3DFMA 5JZ9A 4NZ9A 4JENA 5B1DA 3CWCA 4V02A 1TUIA 1IZ8A 1GO2A 1NUUA 3G8AA 3BH6A 3JCZA 2GAAA 2EKQA 3LFUA 2PD4A 4LHEA 2PAAA 4CNQA 1AUVA 1G41A 2VWQA 4IVRA 3ZJVA 2LZ0A 2QD2A 3DYBA 3L6CA 1Q19A 1Y98A 2QZJA 4RIFA 4GL2A 5AIAA 4KJXA 3VPBA 1MG0A 3EH1A 3AOEC 5FBHA 4EJSA 3JW8A 4XB6B 4O59O 2X5KO 3DE1X 3GJ8A 3B8HA 3RC8A 1KMHA 2TMDA 1N5DA 1KGDA 1QO0A 1U7PA 4ITVA 5DHRA 4J29A 2PR7A 3Q8WA 4JLOA 2FSGA 1ZPDA 4LYYA 3JAKB 2V0GA 5DX8A 1ZZGA 4J90A 1N5RA 2VWHA 3I12A 3G2OA 4OF4A 4ML3A 4U2KA 5DTMA 1HTWA 3KYDB 1QYVA 1U1GA 4DR2B 1NI4B 3AXSA 5DW3A 5IDVA 2Z08A 3KPUA 1OUMA 2UVPB 3OD5A 3GPBA 3KDAA 1JJIA 4QU5A 3CJRA 3THSA 2DCMA 3HXPA 2FZLA 4YV0A 5KNBH 2VP5A 4UTOA 4ZT2A 2X58A 1VGRA 3BK7A 3IQXA 1TM1E 2G71A 3DA8A 2H3HA 4A91A 4V0MA 5JD6A 1A2QA 2I4RA 2WF6A 3L46A 1IU9A 5J59A 4YY3B 5KKCA 1MDBA 1UMCA 2IWHA 2VYVA 3GRRA 1YCDA 3KQVA 4Z6KA 5C31A 3DHEA 4HRAA 5GGXA 3TUZC 1CY8A 1TVMA 5K0NA 5E2IA 1MF7A 1BYUA 4AXBA 5C5CA 2A14A 4M83A 3D8NA 4LYHA 3WIOA 1JSZA 4N48A 1KU6A 4MVWA 3G5AA 4MRRA 2WAMA 3FUXA 2P7IA 3F6SA 5FA5A 3KT0A 5CYOA 2B37A 2J33A 5U9CA 1CHNA 1U2SA 2O4CA 2CUNA 2X0KA 4TMZA 3WYBA 4YRNA 3ZW9A 2YWEA 3GG2A 2RKOA 2ZSBA 5GWXA 5CPBA 2BEKA 4FDUA 1L8XA 3II6X 4MUFA 4B71A 4WI1A 5ALFA 4NSNA 5AKIA 1W47A 5BO5A 1IK6A 4IHJA 1JEEA 5ITZA 5KO2A 4KFTA 3JYOA 3OLWA 3IHLA 3TGWA 2ZB3A 1E96A 2GZSA 3WLNA 3RG2A 5AK5A 1G7CA 1VRVA 5G3YA 4V39A 4XA8A 2C2MA 4BQQA 6REQA 2CNWA 3LKVA 4LSGA 3O4VA 2VG8A 4RVGA 2JGKA 3OE7D 4P8RA 1VI5A 2PL5A 2QWXA 4Q03A 2QD3A 3D02A 3M6XA 1I1HA 4OXIA 1XQYA 3AQIA 3AY6A 4IH1A 3KKNA 2QB5A 3HEBA 2NT3A 1VGVA 3QVGA 2XZLA 5KNBD 1F14A 2VQ6A 1FTYA 5AYVA 4BUJA 4C7KA 1SCBA 2WUWE 5TQVA 2O7NA 3LUAA 3N05A 2CJYA 2F64A 1CUAA 3LOUA 2NUTA 1FX0A 1IUNA 3LYUA 4QFBA 3NIFB 3ZWWA 2RGAA 2PUGA 4FDAA 4GQIA 2DH5A 4JBLA 3WGTA 3ZNPA 2PZBA 3FFTA 3DPSA 3ZUPA 2GHQA 3RK4A 4QM6A 2X4DA 3QLUC 4RK7A 1JT9A 5LIRA 4ZEVA 2I55A 4M3NA 2C54A 3SJ7A 3T4XA 3PDJA 2ZGVA 4J03A 5LZ8A 4EJ6A 4Z2AA 4PGFA 2C61A 5HS6A 3QE9Y 1GTSA 1BEUB 4B8ZA 3N28A 1X7XB 2IPMA 2XWSA 4ER7A 5HGJA 5ADVA 3I4LA 3OFND 1SXQA 1E3IA 2QGNA 3PSAA 2BKEA 1ZAYA 2GD1O 1E66A 1C8LA 3LDGA 5GV8A 3G9TA 3UBMA 3ZBUA 3BXZA 4MWSA 3V8BA 3KQHA 1CZOA 1ILWA 1HOTA 3F4KA 2PV0A 2HWKA 3DDUA 4UOZA 3G0BA 5T6BA 1JAIA 2FK7A 3BWYA 2HREA 4G1EB 4Q9NA 3L6DA 1WP9A 4FDLA 3MRTA 5LDGA 4WWHA 1QP0A 1GCGA 1XO1A 4JCOA 1VP3A 2Z5LA 1ZGHA 2QPAA 2CXOA 3DT8A 3O9ZA 4GBGA 4IX9A 5HHTA 1PNRA 2NMVA 1X42A 2Z2YA 2ZIAA 5HDQA 1B2RA 4PYRA 3C6XA 4DSZA 4F3NA 4DUGA 4EPYA 4FINA 1Z0JA 3LPDA 4YP6A 5AKJA 4AG6A 4OAQA 4XVUA 2E5FA 4M0FA 1VKJA 2HF8A 2QX6A 2C9ZA 1EUDA 5IK2A 4EHKA 3ZV5A 4UM8B 2RHRA 5CIYA 1DCTA 1Y4ZA 5HJ2A 1ZOSA 1U7TA 1RJGA 4PR0A 3IVCA 4ER5A 3GROA 4Z54A 5IEBA 2O3RA 3WZMA 3L6OO 3AHIA 4H0FA 5BP7A 1SN7A 1DUSA 1RTKA 2YIMA 4WK2B 1O57A 5BWBA 3NEYA 4B3SB 3IDZA 2WTEA 4RH3A 1D1QA 1V3TA 5BPHA 5IPFA 4LNUA 3BHIA 3OE4A 1VDZA 4L5AA 2OHVA 3B2NA 4YUVA 3IV7A 3QHQA 3CV3A 4Y0VA 2JGIA 4XDGA 5EIWA 4A16A 2GMWA 2JCYA 3AGPA 1SCUB 1U1EA 5K1ZA 1ISJA 3C1TA 2PQMA 3NONA 3QLUA 2J07A 3OM8A 2DBVO 3GGGA 4YAOA 1YDMA 3TPZA 3BTUA 3RUAA 1KQPA 1WUHS 3CB4A 5HK9A 1PV1A 1Z74A 2WP0A 5JXWA 4P98A 4P7KA 1EZ1A 2HNAA 1UH5A 4D56A 3C3MA 2H57A 4X8OA 1U2ZA 2AN3A 1QDLB 3PPYA 1G6KA 4OP1A 4ZVSA 5JCJA 4B2LA 1YULA 3TG2A 1NFFA 1TRHA 2B92A 3KHKA 4LY9A 3OJLA 4MDHA 4Z7QB 4EAQA 1OFHA 3LX4A 3ETEA 3ANXA 2QY9A 3CT4A 1FPQA 4F3RA 4I66A 5ITWA 1M0TA 4FWBA 3UNXA 5CAEA 3LUDA 1CZRA 1AQ6A 1I4EB 1TB4A 1HKHA 1XNHA 1P61B 3DZJA 3EGOA 2IX9A 2CK3A 3J81A 5GVSA 3W5DA 1IUPA 1IK4A 1CERA 1CIVA 3FSEA 3AKDA 1BW9A 4ZFNA 4TXJA 4JU8A 4TVSA 4YHHB 2YDXA 2Y4OA 2PQ0A 1P0PA 4I1IA 1S5PA 3GDWA 1UBOS 5E8JA 2XE6A 4XR9A 3GJ4A 1KSGA 2IVFA 4JJ8A 4M76B 4AD8A 4URVR 1A98A 2C8VA 1NKTA 1PFKA 4DV6B 2HYDA 5A4JA 3C16C 3EUEA 5IJXA 3ZLBA 2B8NA 3B3AA 1SG0A 5KBYA 2ZREA 1ZU5A 3E5NA 2Q1UA 4DIOA 3X2SA 3OQHA 3JASB 4JJEA 1UQTA 5SZIA 1J70A 8ADHA 3V4RA 1RRFA 5TF4A 1XKLA 5LMZA 4QM7A 1RQGA 5D1HA 1GUBA 3QKSA 2A4MA 2D5AA 1HO3A 1II8A 4PEVA 3NIGB 3TIIA 3A1NA 4IEEA 1L7RA 2A5YB 2D2EA 3FVVA 1G60A 3ONVA 2ZI9A 4UZEA 3H5IA 3R8CA 1T15A 5C5EA 1FUEA 4BPBA 4BV8A 2H5LA 1UFOA 2WYVA 1PBTA 3FHJA 3KC2A 3NCHA 5KDLA 4N01A 8ATCA 2NXEA 1KK2A 5EJAA 4DHEA 2HK7A 2VNHA 1GTVA 2FFBA 1C9JA 2N1BA 4DMRA 2VRNA 2ZSKA 1QHFA 4LY0A 4OQQA 5C7LO 1TM4E 3COZA 2ZRBA 1IHDA 2Q2NA 1T9GR 1UXKA 2XIJA 3DT6A 4X60A 5F3RA 3GPLA 3AERA 3CWZA 5JADA 1N4AA 3RHZA 1RYHA 4BP9A 3TKLA 1ODKA 4ZYUA 3N2ZB 1AB5A 1CY1A 4G4SO 2PS9A 2Z3WA 1OIWA 2Q2OA 3RS2A 3NCTA 1KK3A 1R74A 4ZVKA 5DTRA 4FW9A 4XRGA 3KRTA 3MILA 2GEUA 3DJYA 1ZJZA 3AOEA 3T1TA 3LPNA 4KDRA 2A78A 4B3RB 1KH3A 2X0DA 2RAFA 4BUZA 4ROTA 1TF7A 4PZPA 1T91A 1KEEA 1G7TA 1KRXA 2FP3A 4OGGA 3E35A 3DVRX 3LVQE 2ZUWA 4QJ5A 4BE4A 1IEVA 3W2FA 1UCFA 4EATA 3ZD7A 1NVGA 5HFNA 1O6CA 2QTNA 1RHQA 3H5RA 4AKIA 1GDDA 2IYWA 4HP8A 1NPDA 3KJZA 3GFOA 4AXXA 4P5DA 3L77A 3PWKA 4CG1A 5IM4A 3LUKA 1JLLB 1U4NA 1EHCA 3GQBA 3F71A 4JB8A 3VDQA 3TR6A 2RE8A 2IS2A 1X7ZB 3Q3IA 1Z0ZA 2FFAA 2G4CA 3NH6A 5FUYA 5BV2P 1OHHD 2AYYA 2OYSA 4TWBA 4Q16A 4X64B 1IQUA 1HDGO 3L79A 5LDDC 5I7UA 3RYIA 4I8IA 4P92A 3EPHA 2R6CA 4GI1A 2G28A 4OGKA 2C8JA 1E89A 1YRYE 2IYAA 2Q9BA 3AJDA 3PS9A 2HEGA 3CY6A 4V2IA 3NBQA 2BFBA 4WGGA 1UEIA 4BGVA 1WL8A 4D3YA 1K2WA 4N7RA 3FWHA 5B1EA 5FNVB 3ONDA 3C3XA 4XAQA 5BVGB 1QX3A 2GN0A 2HWXA 4JITA 2IGTA 3DDCA 1T9ZA 2DUUA 3W2TA 2RKWA 4UDYX 3L7KA 5HG0A 2Q0XA 4COOA 1YRHA 1RACA 1TO1E 5A2GA 3WC4A 2YDYA 3NBYC 3L7IA 3OIDA 4KWIA 3QG5A 4P58A 4RCVA 4R81A 4F2PA 2PFKA 3DZGA 4P7GA 2O6LA 4YMUA 3AUSA 4LF5B 4L8VA 4YYZA 4CEJB 4IH9A 4BHTA 2GWHA 4C2TA 4Q4HA 1P2FA 1QVAA 2OO7A 4HNSA 3L0YA 1N6NA 4U2EA 4Y2UA 5J5AA 2VRWA 4CV0A 3OECA 3MT9A 5CH8A 2I4TA 1TZ2A 1NVFA 2D5CA 3FM9A 3KX2A 4H15A 2WDPA 3Q7SA 4OHOA 2WTAA 4N3CA 3WSTA 2AKEA 1B23P 1U5BB 3HY4A 1XPOA 4R8MA 4QSMA 1KHHA 2JK0A 1UDCA 4KNWA 3I6IA 3MJCA 2KBFA 4F96A 1QF7A 4TWRA 5AHOA 3JRXA 2QW8A 4IHAA 4S1NA 4EG3A 3S1SA 3NJ8A 3FFWA 5EIEA 3KSMA 5KQPA 3QPWA 4UHEA 1ABFA 3W4IA 1BAPA 2H5JA 2HPAA 2GBPA 1FRNA 4DM7A 3IB6A 3VM6A 2NOAA 1J2UA 2E9SA 3FOZA 3RJ9A 4QOGA 1P0MA 2J41A 3H42B 2SNIE 3JRNA 4J0HA 2ECQA 2FQQA 2HO4A 1TD9A 1AOXA 1ZD9A 3A4NA 1AF4A 1WMBA 2VEOA 3UG7A 5I7WA 3ZWVA 5JAPA 4YPVA 2Y92A 1L7NA 2R66A 4URFA 1OXXK 1UMCB 3CZ5A 3LKDA 2XGJA 4A2WA 2KSQA 1TZKA 4MMYB 5CLJA 4IJ5A 1XEAA 4DSAA 3GVCA 4M0PA 1D2MA 4RPJA 4TWAA 5K03A 1QTIA 5BW6B 2PH7A 1TEVA 1PL6A 5DPMA 2AH5A 4NJMB 4FZJA 5F7JA 4DLYA 2VQFB 1P9WA 2WQ7A 4OOFA 1OKKD 1XD2A 2G4LA 4MJLA 3SZGA 1EQUA 2MSCB 1NBMD 1FNCA 4F71A 4R1PA 1I7NA 3CLSC 1LW7A 3VYWA 1XCBA 1YVDA 5L9AA 1XEFA 3MHPA 4L8FA 1Q16A 2WF8A 3P2JA 1EE9A 3D4NA 3HWWA 2BM9A 2IUSA 3IIMA 3MB8A 4UAUA 5MN4A 1XV5A 3EQ2A 3G9QA 3NS7A 1XZCA 1Z06A 2QX4A 2ZYAA 3FVRA 1WVGA 1RXUA 2FW7A 4I4LA 1CWUA 3VH4A 4EECA 3KSBC 4F4FA 4TLMB 3TTXA 2D7DA 1U8YA 3W5IA 5JHGB 4GRAA 3OTHA 1VOTA 4HXYA 2ZEJA 2YN0A 3I6ZA 5M34A 1CJMA 5FQOA 1SK8A 1CE8B 1KP9A 2NQ8A 2W2XA 2JA2A 4PQYA 1Q77A 3UUEA 3AJRA 2BGJA 4Z0NA 1X7HA 5ICCA 1YONA 4YJ3F 2NUTB 3C4QA 4LJ4A 1Z15A 5ICEA 1HI9A 1L5FA 4PY2A 4DIEA 5HZKA 3OTOB 3WLEA 1NJ2A 2BTOA 1JR2A 1BHO1 3EOZA 3RABA 1K6JA 1SXJE 3WRYA 3FTCA 4AUKA 1UQUA 2H18A 1YZKA 4UD6A 2WMNB 3M6UA 4F93B 1F0PA 1A50B 2HHJA 3WTCA 1MZPA 3WGZA 2Q3EA 4IX1A 1E0KA 4IV8A 3WHIA 4UHCA 3SXJA 1DL5A 4KW7A 4EIWA 1QYCA 1Y4DE 5M2QA 4XARA 4DDHA 1N7GA 5FUBA 1RP1A 2YWFA 1KR2A 2C4NA 2ZYVX 1RCTE 3CEAA 4HWRA 1LC3A 4UEJA 2I2DA 3OFNA 3TIVA 3L3BA 4YCJA 3RE1A 2R1TA 4NU8X 4EELA 4L9RA 4IZIA 3LSYA 4MPTA 1QS0A 4UCWA 4LJ5A 1GNQA 1OE0A 3EGWA 4DJDC 3RRNA 3VNAA 3SBXA 1USKA 4EF5A 4ENWA 5KQMA 1KETA 4J16A 4Q3NA 2RG1A 5LIPA 4LY3A 4L28A 1E4OA 3S2IA 2L2QA 2W4QA 2NXJA 4N7MA 2LR0A 3ZCPA 4BYGA 1A8UA 3ER6A 3OAAA 4C0JA 4JYAB 1JKJB 5CYPA 5HA5A 4FDVA 3VR4A 4PN3A 2HY7A 1GQSA 1TX4B 5TSDA 4C7OB 3OURA 1ZGBA 1GP2A 1S8OA 1TMYA 3NAQA 4EITA 2O5RA 2QUJA 1YSCA 4AO7A 2HWYA 1ZM4A 1JH8A 5LUBA 3EF0A 2TSYB 2PZ8A 2ODQA 3F5DA 3P9ZA 5JJCA 2ZYSA 3LY5A 3HRIA 4Z1MD 1BEEA 3C5HA 1QE5A 3L0SA 3FFBA 2W70A 5AW3A 4ZQCB 3AG5A 5DI9A 3WSWA 3OCWA 1WDTA 3KEOA 3ZGXA 5IAEA 3V8EA 2BRUA 3CNNA 3VUFA 3KWLA 4MYHA 1LV8A 2VT3A 3NTQA 4IIEA 4LRSB 4ZOCA 4JGGA 4LBZA 4ACAA 2AZTA 2ETVA 3WMRA 5JJIA 2P2LA 4ALMA 3RNLA 4M88A 5DEIA 5BSTA 3ND6A 4MRMB 1QGDA 2ZR7A 3K1JA 1H94A 4MIKA 1V8FA 4MW1A 1QYXA 3OD1A 2WEKA 2QDXA 2YWHA 3VVLA 4EKGA 3IPLA 2BYTA 3RSHA 1XG5A 2CF6A 2CMGA 2I4OA 3FYUC 3MRXA 4RE6A 3IRVA 1H9AA 1ABEA 1YZFA 1GZHB 3AIOA 1R9NA 1X94A 2ZTMA 4CIWA 1ZK0A 2ZXEA 2O8CA 2J4DA 4BP1A 4MKRA 3DE2X 1PJCA 2AK2A 5C51B 1A8QA 5KAMA 3G49A 4NG4A 2PFSA 4EX6A 1XUOA 1I0IA 1IWBB 10MHA 3UPDA 2QNIA 4ND8A 4WT7A 1ONPA 1W5AA 1RRMA 3NHFA 1KAGA 4XH9B 5I9BA 2C7VA 3H2BA 3C1UA 2JW5A 5HOQA 5CDGA 1R6XA 3H5NA 4RF5A 3MS2A 3REGA 3H6KA 5DM70 2WD7B 1LRKA 1WEHA 3IJEB 1HEYA 4PANA 2B1RA 1YBHA 5B37A 4MVYA 1CQJA 1NFRA 3VNRA 3IA7A 4GYKA 3KSZO 1JJAA 1A97A 1U8AA 3AP2A 5D3QA 5FOSA 1Q17A 2WYWA 5ALDA 1AQNA 4MW9A 3OQ1A 3QF7A 4TN5A 2F43B 3T5CA 3AB7A 3O92A 4KEAA 1SHZA 1QO0D 2Q2QA 1E62A 3DM9B 1ZUWA 5FLKA 3MMPA 3W05A 3OPYI 2GDZA 5KHLB 4NXNB 1A7UA 3UV7A 4B43A 4DM4A 1COWA 1VBKA 3DV2A 3JASA 2XODA 1CP3A 4BNJA 5B3KA 3O2JA 4LE1A 3D6UA 3EPPA 3ZK7A 2ATVA 3SX2A 1QU3A 4JLAA 5C5IA 1ZEJA 1KI4A 1P5HA 1MT0A 3BWMA 3LU1A 3KDPA 2N47A 4C87A 1QRDA 2WUVA 1D7AA 3GQVA 4NULA 4WSOA 5BYJA 3FBGA 3F7NA 1RC0A 1HYGA 1N1GA 5JAHA 4CFYA 1P6QA 1SCNE 2WIGA 1SPBS 3B6MA 3BD8A 4B7CA 2PT7A 3DC2A 2ZT6A 3HVKA 2OUKA 3QVTA 5CT5A 3UGJA 2CXQA 4B9AA 2NTVA 1RAGA 3LXXA 2FEOA 1ZSYA 2V7XA 3UT0A 4BNZA 5A06A 2ZDQA 4HVTA 1O5TA 1NGSA 4UZSA 5IM4F 3FH0A 1V6SA 5I8PA 2KX7A 5EHXA 1GGEA 1E9DA 2ZU6A 3OWXA 3KTFA 1V43A 3AERB 3N2NA 3OICA 1QIDA 1W30A 2RAUA 4TMTA 1MC8A 4TTJA 3WV4A 4E08A 1XXLA 2O2XA 4JI7B 3JVIA 1EM8A 1HDCA 3OIUA 4MNTA 1VE7A 1Y4UA 5LQCA 3A3KA 1J1IA 4QYIB 4IRUB 1CEQA 4C22A 3FYCA 3N3BC 1BNCA 4KIFA 1BVRA 4Z9AA 4HYYA 5KVVA 1YDFA 2IOFK 1JI0A 5D87A 1KYWA 4FE7A 3AF3A 2ZT7A 3OT1B 4U9HS 3B6IA 4KR6A 5AW5A 1JGTA 1LBTA 2RBGA 3L6UA 2W8BA 3VHXA 1H6BA 3G0CA 3KWFA 4HRYA 1BX3A 3REQB 3EUWA 1ULSA 1C7FA 4QIHA 5PNTA 3ZR4B 4B4UA 1I2BA 3OEHA 3TQRA 4YP0A 2BGWA 2F6RA 3K9FC 4AF8A 4D26A 3N9IA 5G0TA 4FGJA 4L74A 5EZYF 1DP4A 2PZFA 3W77A 2HFJA 2F8SA 3U1BA 1X1EA 2TMGA 4K8RB 4ZARA 4B5LA 1Q0LA 3ASVA 3GIWA 1Y3AA 4NR0A 1ZGGA 3RFVA 3ZWBA 4F6RA 2AF4C 2C3PA 3U48A 2H2WA 3E1KA 2AOVA 3M83A 4HGNA 4W5HA 5TMBA 3EXFA 3WJ2A 4DDUA 4YV1A 1UPXA 3MLBA 3NIBA 2Z6VA 4C3OB 2JCXA 5BOSA 4XLLA 4D9CA 3QV1A 3OZWA 1VSBA 1LLCA 4WCFA 5ALVA 4GYYA 1NUTA 3HXTA 3K9HA 1GAXA 4AKEA 1N8NA 1CUHA 1PW5A 2OC9A 4H0CA 3OTWA 5DKFA 5J4YA 5JY1A 2BUBA 2OO5C 2VT7A 1KZ6A 1NF3A 1R4NA 3GCXA 3KUUA 5TC4A 3ZIAD 1YD7A 4C0QC 2ANBA 3R09A 2J1LA 2PYDA 1BOFA 3V7NA 5KTTA 2LUOA 1BSVA 1AM4D 5ALNA 1NX9A 1CPYA 3QU2A 1IN6A 4ON9A 2A9KA 5IULC 2V7PA 2IDKA 3H11B 3RT1A 1RQRA 1KO4A 1MZVA 4MUNA 4PLHA 1Z7BA 3KKZA 4ZI7B 1SCKA 1TGVA 2VATA 7MDHA 3CNOA 3G8YA 3QU5A 1M0WA 3SM9A 1LRLA 3W5BA 1C2TA 3AFIA 5B4TA 5KNDD 4NBTA 3MBIA 5HGXA 5F7OA 1VJ1A 1BJKA 3QI7A 5KQSA 1ONOA 2C88A 3CLUD 3IELA 1DJQA 4XX1A 1M2VB 1RU3A 1Z4KA 4KODA 1NTOA 3OMXA 2VL7A 3ZDCA 3F2IA 1C9KA 5TPWA 1VPEA 2XLCA 5EFZA 4N6OA 1J8FA 1Y4SA 3ZY3A 1R00A 2BFMA 5SZJA 2FZ4A 4I5DA 4GE3A 2EF0A 4LHSA 4QE3A 1CNFA 1KBQA 3EIFA 4RPGA 5M5BA 1N2GA 4PINA 4YAJA 2X0RA 3DO6A 4ILKA 3ZCSA 4YAIA 1XTKA 3ETHA 1OPXA 2H3EA 2BVNA 1A9TA 1QE0A 3FYSA 2HSDA 3PYXA 1J1UA 3U39A 2Q9CA 1Q91A 4OQLA 1XZMA 3CRNA 4Z5XA 5TR9A 3DYIA 4Q00A 1ADFA 5EVJA 3QJGA 3QF4B 1BU5A 3EDRA 2J5RA 4YPFA 3ITDA 2H1LA 5AVUA 5IDYA 5TX7A 4WY2A 4R2WA 3TTYA 3CH5A 2PL1A 5JSYA 1EGHA 1JG7A 1ZIYA 4URZR 4HMQA 1KO7A 2Z0MA 4MUBA 2F00A 4NJMA 4U8GA 5LA6A 3SEAA 4YT5A 5F1KA 4F1KA 1ICEA 3DLIA 3RBVA 2LW7A 1J00A 2MOKA 3WIVA 4UCQA 2ZBQA 5B1HA 4DPLA 1EUCB 3K0CA 1NSFA 3ODGA 4MJXA 2AKYA 2R65A 3MZ0A 3PFFA 4INAA 4R7ZA 5CT8A 2IY7A 3RJTA 3UAXA 5CA0F 4A3SA 5IM5A 3TRKA 3B7GA 3UK7A 4DCJA 1TJNA 2A9PA 4MWOA 3WFIA 5ALPA 3D8SA 3QU4A 3W4JA 1OBHA 1U28C 3SM3A 1Q0UA 5K45A 1PX2A 1QIIA 3C1AA 3HNOA 5H4GA 2F3SA 4L5IA 4PGGA 4GMFA 2ABWA 1G59A 4R1MA 1WNFA 3RSCA 1UPFA 3EG9B 1X8XA 4L16A 3M1LA 1F6WA 4ZTBA 4D0SA 1N1MA 2V4MA 5E6SA 5IF3A 1L4GA 3IOMA 3HSSA 1PYDA 1T2EA 2M1XA 3H2JA 3ANYB 3FF4A 2EL7A 3W9SA 1JSCA 4KWEA 5KNBA 4MDEA 3GL9A 3JQBC 1Z75A 3D3NA 1W88A 3IB3A 4Q4AA 4S0XA 1GAWA 2NU9A 3U4HA 1XOIA 2FSVA 3IURA 4PSAA 4CV1A 1E9VA 1HMYA 4YRQA 3GAMA 4MK4A 1CR1A 3N8GA 1SB8A 2R8YA 4U0KA 3UHPA 3AEYA 2A8YA 2J46A 4LRTB 1FSSA 4MKGA 4MYTA 4P1ZA 4JL6A 1GUFA 4XYGA 1QVWA 3VC7A 2OORA 2W6JD 1P17A 3J80A 2Y0CA 3IVRA 3AWIA 3VPDA 1E0SA 3VNBA 3TSWA 1GL7A 4JFAA 1QSGA 1ZH0A 2DWCA 4WX2B 1I4WA 1UKEA 2VBCA 5ILQA 4CM7A 5H68A 3A04A 4DPMA 3TRFA 1Y6GA 4Y2GA 3VR6A 3KTOA 3M1AA 4FR2A 3SD7A 1ZBQA 3AFOA 3ASZA 3DCJA 2H59A 1ICIA 2PUWA 3PFWO 3PQ3A 1NSTA 4QWMA 1CUDA 1V4BA 5AVSA 3S8YA 2VT6A 1YASA 4NKRA 3V5NA 2ZATA 1Q83A 5IG2A 2I6GA 2R6ZA 2ZJ7A 1XEXA 2WQZA 3K1TA 3QIAA 4GLFA 1B4DA 4JWTA 2KBEA 3QVOA 4I4TF 3D0KA 2YRWA 2OP1A 5DCLA 2H85A 1ZK4A 1SBZA 2R5NA 4YJ3B 2QL5A 5CM8B 3RC9A 5AUPB 4JASB 3TF5A 2IHNA 2YCLA 5FTWA 4NU6A 1M2NA 1L4MA 2BGIA 4WPGA 1SUBA 3WGIA 2XTMA 1GTRA 3RJMA 2O2HA 3BBLA 3LK6A 2QUKA 1H93A 3DB1A 3OE5A 4ODIA 2H1OA 2ZBVA 3H0EA 1HG0A 4YBRA 5EQDA 1JMKC 1AKEA 4DDWA 3E48A 1CQZA 2MCFA 5H4HA 1N1EA 3K0EA 4MHSA 5AH0A 5EIAA 4CDNA 4D3XA 3F4LA 2ZIVB 3GLKA 2QTGA 421PA 1KMNA 4NZNA 1XZKA 1R27A 3OZIA 4JJGA 3ZW8A 1FFWA 5AI5A 4ZHQB 1C3XA 2VF7A 4FSXA 3CEPB 3U81A 4PC3A 5ALOA 5I5EA 1OI7A 3BC1A 4BKUA 4XB2A 1TTTA 2P3LA 3DQQA 5LOVB 5IAAA 3CYFA 3M6IA 4CQNA 2QE7A 4YCCA 1Y6QA 3RKUA 4Z4QA 1RAFA 4IF6A 1KHTA 2G8LA 2JC3A 2QQGA 1PR3A 4FN4A 4WNYA 1SRRA 2Q1YA 1IWOA 3IUQA 2BI8A 2ICAA 2UUOA 1I0ZA 2P41A 2UZ1A 3ZWMA 3BEOA 2YZGA 3WBFA 3DBHA 3HHPA 3JQDA 4LECA 4PNHA 3WLTA 1LFAA 3EAQA 3OCZA 1NW8A 1ZMOA 3INNA 4RM2A 1YBAA 2FV8A 4FIZA 3D8UA 4PLVA 1FJHA 3N6VA 3MD9A 4F1WA 2BSQA 3O8DA 3BMNB 3G1UA 3KZCA 4CL8A 1KI1A 3O75A 4PX3A 1YR7A 3COYA 4XZ3A 5DHAA 1PNOA 4NH0A 4P6VF 3CLRC 3NNDA 1D1TA 4X1KA 5DXJA 2CV0A 3FGOA 3VOBA 4JT8A 5K3FA 1VZ2A 4B81A 3GDOA 2EX0A 1UDRA 1AKRA 4U6NA 3PUXA 2VVTA 1LV7A 3KHUA 4HH0A 3GUCA 3RVRA 3ZE6A 3HJHA 2QRGA 5ALSA 1I0LA 1MGOA 3VUEA 4A9AA 1BN6A 1WCYA 1LNSA 4X92A 3DZHA 1GT6A 2ZRQA 2OYCA 3WOVA 4MYDA 1XQVA 2DUWA 2XNDD 3ZU6A 4AMYA 1MEEA 1F12A 1CJBA 1HE5A 2BOVA 2H1CA 4BNXA 1D04A 3O0TA 4PXAA 4WFIA 4PHCA 1TADA 2CBGA 2XF2A 1FB5A 3I01A 2XSZA 2IYFA 4JLKA 3MMNA 3FOFC 3CVOA 1RXSA 1WZ2A 4V1CB 3S0JA 4A36A 5AHRA 1IXKA 1KZ9A 3GNSA 2DKNA 5CEFA 1L1RA 3GRUA 3STUA 3KKMA 5ITZB 3HWX1 1GLVA 2P4HX 2CXHA 2PH5A 1PZXA 2J9YB 3A06A 3ELYA 4BJ5A 3Q6IA 1DO8A 2XZTA 5DNWA 1QXSA 2QI9C 2CHUA 3GGDA 3AF2A 4J9UE 1Q20A 1U0LA 4RVFA 1TA9A 2OVBA 2FWBA 3DF7A 3PUWA 3GRPA 4O0MA 1D1PA 1WOYA 5JO0A 1H9BA 1BQ4A 1U2EA 5AVJA 3M4ZA 1ZI9A 3OM1A 4RK4A 1OFVA 2I65A 2QJRA 4GKVA 1M1ZA 2PL9A 1G21E 4G9GA 1W34A 4ZMBA 1I7DA 4KR2A 4LTNA 2HOQA 5IVKA 2BFPA 3RHSA 3QEJA 4XQ9A 3LLCA 2DH6A 3IT1A 1I1NA 3TQFA 1A72A 3W7VA 4FYWA 4EEXA 3F49S 1W93A 1V11A 2DT5A 5ULLA 3U6KA 3R5KA 4EGCB 1MC4A 2IPOA 1M6EX 1XTVA 2OOKA 3C4VA 5AJVB 5B1IA 2ALJA 3TB4A 2IP4A 4MEAA 1D8AA 3QPCA 4KMOA 1VE9A 1L5SA 4F21A 5FOXA 4PSVA 3NVMB 4JS0A 2O3TA 4B4OA 2VQ3A 5J9FA 1FC0A 5AK3A 1SQ5A 4YRLA 3ZCVA 3DEAA 3MK31 4L5BA 3EZFA 3PZRA 1N6OA 1THTA 2AQKA 4Z8YA 1RJFA 5FI1B 3JQAD 3WMEA 4ZVMA 1ESNA 3H4VA 3GJQA 1Q1QA 2VWPA 4HX2A 2JFPA 4K9LA 4RVCA 1WZIA 4QJIA 1IBMB 4MUGA 1TKRA 1RRCA 4WNIA 1OTHA 1F8XA 1T5DX 1H1LB 4PV7A 2UZAA 1VE6A 4PHGA 1AHNA 1YJCA 2P9TA 3JYPA 3M4NA 1V1MB 4CEHB 3HU1A 3ZCUA 4GUAA 3D1VA 4TQAA 2A1TS 2HPVA 2XVYA 1JVSA 4GBJA 4JYCA 3OPYB 4FTWA 3MCAA 3RSQA 4CF3A 3ENNA 3EVBA 1KO5A 3UOAB 2GPTA 1V1JA 1HM5A 1XJ5A 1ZMTA 2HF9A 2Y0PA 1G5QA 4U7GA 4YROA 4PN7A 3D4OA 2LGJA 1U02A 2CLIB 3AUXA 1LI5A 4LQCA 5F64A 1W94A 2VI5A 5I5GA 3TZCA 2WMOB 3K70D 2PSDA 4IDCA 5ALKA 4BLSA 1BROA 4U4AA 1EYZA 1Z0SA 4PGMA 3R75A 1BCRB 3BMOA 2VHCA 1H0RA 2OB2A 4D9FA 2J67A 2PO7A 2ZUSA 3JS5A 5B7GA 4F92B 1PN3A 1XQWA 2A57A 3G2QA 4UTZA 1I3LA 5U1PA 3AL0C 1DX4A 4I08A 2QUIA 4X7PA 2I91A 3DT9A 1NJGA 1UMDA 3AGQA 9MHTA 4I3GA 4P38A 5B3LA 4X65B 1R10A 2J5XA 2PNJA 5AVVA 2EKLA 4H7HA 3G02A 1BFDA 1EJ0A 3OLXA 1QUEA 2CEKA 2PX8A 5A9RA 1I5OA 4ZJYA 1S4QA 2VNKA 3PRHA 3L7LA 3E3MA 3CUWA 1J24A 3UMCA 2O5CA 5EIHA 4KE8A 4OMCA 2R8BA 4WLNA 1P1HA 2C07A 1LJLA 2O2ZA 1TTQB 2M6SA 1M34E 5DTIA 2C2KA 3DE3X 5AUQA 5IXYA 5JI3E 4GR5A 3ROGA 5KZMB 2QM7A 4LVOA 2REXB 1CDOA 2O3JA 4PAQA 2GM4A 2YQZA 1RHRA 3TZLA 3CJQA 4PZDA 1GPLA 1CC1S 4MQEA 4EMUA 2O0KA 1EM6A 1TZBA 4AN0A 1Y1TA 3T61A 2P30A 4JYPA 4U1RA 2C3YA 3REFA 2JBAA 4EB3A 1JA1A 1MAUA 3HVHA 3LX6A 3H5AA 3CT6A 3GRZA 4PSUA 5A6SB 1W1WA 1UK7A 3NHRA 4IJ6A 3IDOA 3FUCA 4HPJB 1S7GA 1JQKA 4GW3A 1CUSA 1G17A 1T8TA 3WB2A 1BW9B 1E5LA 1T1JA 4LZAA 4O8CA 4DIKA 4ZZIA 1ZITA 2WWGA 4GKAA 3DUWA 5HM8A 1KF0A 4EHIA 1X3LA 1WX1A 1ZVMA 4KH1A 4YNBA 4GL4A 221PA 2HRRA 3P9QA 3KPWA 4H18A 3RRZA 3WP1B 2VCHA 4HWSA 3BRWD 5LYJB 1RWNA 1Q7BA 3W5AA 4EPTA 1E2JA 1E4EB 4EYGA 1LXCA 2OQIA 2C95A 4QDJA 2IBSA 2VDKB 3AL3A 3RV3A 1DT5A 1HRDA 1I3MA 1X2BA 4D5GA 3O8CA 1G8FA 1EWKA 1RFLA 4NARA 1VHDA 3PLAE 4L8GA 5BWNA 1VSTA 4L3VA 1Z22A 3EVCA 4I81A 5AKXA 1DIGA 3NFRA 1NDHA 1YK1A 2JFBA 1E5DA 1OREA 2VP6A 4RF4A 2FMIA 3STVA 1A4XA 1JBEA 5AW9A 3FI9A 5EHQA 2XRZA 2A5DA 2ZRIA 3WGQA 3RVJA 4O4IA 4WN9A 1XP5A 4OU5A 3CZMA 3IPYA 3MTIA 1DC3A 2R4QA 5JAUA 3HR4A 2UU9B 4DQVA 1DEKA 2O8VA 2Q0SA 1MENA 1D3AA 3IT2A 1EA7A 4LRXA 1F1JA 1JS1X 2QRUA 2NUPA 3SSMA 5LWQA 5DCWA 5AUNB 1L4NA 3GEEA 3RUHA 3UCEA 4EBFA 4UUPA 5SYMA 5IAOA 1AUXA 3VHQA 2W9XA 4KN6A 3HU2A 2ZQZA 3DEIA 4DY6A 2PX5A 1AXGA 1MOQA 3LC7O 3KE8A 1FFCA 1LZKA 2Z83A 1M34A 4A0SA 2YC4C 3F3SA 1MB4A 4JEUA 3ICCA 3IJRA 4YLYA 3T7SA 4HSGA 1PYOA 3ZN2A 3DZKA 5K0TA 3KQPA 4RTOA 4HDRA 3H8WA 4RCYA 2HA2A 3NKLA 2GM9A 4OQFA 4GUDA 4R3NA 3HNRA 2WWVD 4HDSA 1UJBA 4BCDA 4HUTA 1RHMA 2IU6A 4EUSA 3MCUA 4U39A 1QPBA 2XE8A 3C8DA 3U4DA 1M7HA 3JQGB 3W7AA 3MGCA 5ESWA 2BDEA 1TM5E 3JZDA 2NO9A 2W6QA 3WRXA 2JEOA 4BZPA 3SN6A 2YBDA 2WWTA 3K3PA 1J21A 4Y2VA 3M6MD 3K0BA 2J3LA 3TM4A 1EZZA 5F21A 2GZ3A 1PK9A 3F97A 1RXCA 1KC1A 1IB6A 1ULZA 3A3PA 4WRRA 4BNIA 4BO8A 1A9PA 3FHTA 4GI5A 4MUHA 3RHTA 2XUAA 2DTEA 3DBRB 1VCHA 2H06A 1UKYA 5REQA 4UOQA 3FWNA 2E4ZA 5L7TA 4RVDA 4BLTA 5A9SA 3OHMA 5HIJA 4YRBA 4C5AA 2J8ZA 1OTXA 1Z35A 2DPLA 2Q28A 4ZXPA 4FFDA 3KQYA 3TH5A 1ISGA 1U80A 4O25A 4CPDA 3DNMA 4H17A 3SEZA 1LPMA 1TYBE 2OGWA 3GFBA 3O74A 4BQNA 1E2UA 1BE1A 4LHXA 1VG9B 5JYEA 3QVKA 1M7BA 5AO9A 3AVYA 1P0CA 3P7MA 1SO8A 4B7UA 1CY6A 1SOVA 1RRKA 3I1YA 4NCIA 4RMGA 2CMDA 3QVXA 1FFXA 4NECA 1M33A 3PKJA 3PWSA 4GZLA 5FF9A 3SHOA 3THWB 2W2PA 3G59A 3I1IA 3I64A 3I8SA 4OK5A 4CF5A 3A6EA 2JIOA 2RHGB 3PZBA 1YIOA 3PFBA 1LX6A 3M3DA 3E82A 3FDIA 4ABYA 4BATA 3VRHA 4DZRA 1U98A 5EGSA 1EP1B 2ZRNA 3D59A 4IYJA 4FFPA 4L57A 2RGNA 1F2DA 2ZRAA 1W29A 4OREX 4UKDA 3DBHB 3OCYA 2PVSA 4JBHA 1LVHA 4MITA 3T4UA 3BZWA 3ISJA 4QJ3A 2ZBUA 5D5HA 1W9HA 5A0TA 2PU7A 3AHHA 5D1NA 3LSTA 2GZDA 3R3YA 5DGCA 1R0CA 4EJSB 3BFVA 4FKZA 4AZWA 5IJ9B 1VL0A 1C29B 5E9JA 2PX6A 1B74A 3U3JA 1NG9A 4CLHA 2VUHB 3FMIA 5D7NA 3JAKA 1VA4A 4UE6A 3GBVA 5JALA 3SF8A 1GL6A 1WQ3A 1SGWA 1HG1A 2CE7A 1OH7A 2Y4NA 4C4OA 3ABOB 2R9VA 3R4CA 1JG1A 4HNAB 5D5QA 4WY5A 3OLYA 3FUVA 4BO3A 4LYGA 3T7KA 5FYQA 4J7XA 1KMQA 4LISA 4NJEA 4QDZA 3JD4A 2AFIA 1PDOA 3TB6A 5JRZA 1HL3A 1ZH6A 4UQOA 1E9FA 1GRNA 1P7PA 5T6MA 4LDZA 2XTNA 4M0LA 4QUKA 3HXOA 1KI7A 3CF4A 2RGWA 5JZBA 2WG1A 1NVVR 5DK6A 1U7DA 4JBWA 1CR6A 1HSOA 2EARA 4L7VA 4DVJA 1OU4A 2HDHA 4CM8B 2H1SA 4ZDJA 1S4MA 3FLMA 5FIUA 2XLBA 5FO0A 1SFRA 4RM3A 1B0PA 4MWCA 4EI8A 1U4SA 3NUZA 5I7OA 2R6AA 1M72A 1PT8A 3CNHA 1DE0A 3NC0C 3P26A 3OP1A 3CPSA 1CSEE 3HA3A 5IBRA 3VZPA 4BN5A 1F3LA 4PIVA 2Z43A 3SQOA 4CT0A 1D9XA 1TC1A 5HCNA 5EKTA 4WADA 1GFWA 4W7SA 3THOA 1LPAB 3GRFA 4LXHA 4JLPA 4YQYA 1J22A 4MGHA 3PC3A 3IQEA 1T6NA 2IOYA 3HJNA 4IHJB 2B9VA 3OLVA 3R5FA 4Y6SA 3RU2A 4B6GA 4PLWA 1UUFA 3DONA 4LJ9A 1GZVA 3ED1A 3F47A 3R24A 2PRJA 2JHCA 3QHPA 2XWJI 1HNNA 5AIBA 3EEOA 4IRMA 1AQYA 3V4PB 4QDXA 4J7CA 4BMVA 1LBSA 3U44A 2OHOA 3THXB 2YHBA 3W34A 4YMTA 2NZWA 4GSLA 5JD3A 4D9GA 4UHJA 4CIXA 1E79D 2O20A 2PUCA 4M1ZA 2XTJA 3Q85A 4Z9XA 2VJBA 2W0SA 3L8FA 4YRAA 4HLNA 3QXSA 1SEPA 3H86A 4X6UA 5DSTA 4D44A 3EIOA 1ST2A 4DL9A 4EGAA 1I6WA 1ONSA 4WZBB 5AM2A 1APBA 2A9RA 2ZTUA 3LRTA 5KYTA 3AVVA 4I1VA 3H04A 3IAM6 4W63A 3S99A 1PUXA 2BFDB 5G4LA 1IXYA 2ODBA 4W1RA 2BFCA 1MV5A 4KOAA 1AZWA 1CS4C 1FS4A 1WSWA 1UBKS 2XD4A 3NI2A 2O1WA 3GF4A 4K9MA 1QQBA 5C0OE 2NUAA 4FD3A 4N0QA 1PWHA 3F1KA 3VDRA 2AE2A 3TL6A 4NY1A 1XSEA 1WUJS 3ZE8A 2H4ZA 4X6LA 3IFSA 4LJ6A 1T5IA 4YRJA 4JI5B 1FTGA 2IW1A 2OYRA 1T4DA 2MSEB 2QR3A 1ZQ9A 4W8OA 1IEWA 4PPFA 1Z83A 1E7MA 4LA4A 4DG9A 4P2BA 1UJMA 3AV0B 2HNKA 1BEZA 3OCVA 1QH1B 4OLFA 3FX2A 3V4ZA 5AM3A 6PFKA 2FGJA 3V7FA 1CX9B 1UZMA 4Y7CA 3K32A 4RZSA 3ZV7A 1AA9A 1G6OA 1C4KA 1Z0DA 3WRWA 4FHDA 2B5WA 4NS1A 4MARA 1CNMA 1QQTA 2LKDA 4GI3A 2Z5GA 2QLLA 1NWCA 4HD8A 3QENA 3B82A 3B38A 4UE2A 4LE2A 1L5QA 2G7MC 2GAFA 1ATZA 4BLPA 1LK0A 1YF3A 3D7RA 1C3OA 1A77A 3VC1A 4KQ6A 1N2IA 1PR1A 4ZCPA 2W58A 4IOKA 5KHAA 2GRJA 3RM3A 5DHTA 1XLWA 3FDJA 3NTRA 5K8TA 2AG8A 3UHJA 1S1CA 2JPDA 4EI9A 1E1QA 1U6KA 1NC1A 4C0WA 1MXFA 2ORIA 3AEUA 4Y1EA 4Q3BA 3ZQ6A 3OZAA 2AMFA 4URHA 4YIHA 1NW7A 1EB9A 5ILGA 1V9SA 3MELA 1T3LA 2JDID 3DE0X 4NEGA 3GNLA 2HRQA 2VJAA 3PXBA 1V39A 4L5YA 4ZQHA 4PZZA 1C8BA 2BMWA 2KHZA 3D6FA 1O08A 2ISCA 1SC4A 1A8PA 1HYQA 3V1MA 1K0FA 2DHQA 2PV7A 4MQEB 2X4GA 2FSIA 1LLQA 2RC6A 3A1EA 4OQXA 4TKVB 1W7AA 1W581 2MJLA 1TQHA 2QP4A 4ZEMA 1YOVB 2BGGA 2GTPA 1QYWA 1UK6A 2AI3A 2JBAB 2GK4A 3K0FB 5AW1A 1KYVA 2R68A 2VK1A 2CD9A 3F7MA 1A76A 1I5EA 1Y37A 3BQMB 3RU7A 4RJTA 1N32B 1G21B 1VB3A 1KEWA 2DQ4A 2QU8A 4HTFA 4JXKA 4REMA 3LX8A 1C7IA 3L92A 4BNMA 4F8EA 3KSAC 3L06A 3D7LA 2A1UA 4I99A 2GX6A 1IRIA 4XWYA 5J1TB 3ICWA 2OL4A 2E6KA 3BFXA 3FLBA 1YRLA 3QW4B 4PAMA 2Z5VA 4ZYVA 3CNLA 1HRKA 2E37A 2HBYA 2IHJA 2NUBA 3KUXA 4MS3B 2VDUE 3NGMA 3PG5A 4WHMA 4RZQA 3CURA 5LYJA 4YR7A 3A9TA 3DW3X 3PGXA 1WUKS 3PEVA 1I3OA 2KM1A 5G1PA 4PFKA 1NDQA 2IXGA 4BJ1A 3BICA 3QLEA 3U1TA 2FMKA 3EXIB 2LDBA 3ZHTA 5GIPE 1V7QA 2E4AA 2PGIA 2PZJA 3JALB 5BSFA 4RTMA 2XVAA 5BQ5A 1QPZA 3EXHA 3BMQB 5CEJA 1CDZA 3S1LA 1ADBA 1NDUA 2FXVA 3FB4A 4Y6GB 2QT9A 5K6AA 4HNUA 1PQUA 2NXNA 2HA3A 2P6MA 4F8JA 3I4FA 3ZY5A 4D43A 4ZN6A 4Q7QA 2ZANA 3DZIA 2OAP1 3S27A 2P4UA 2GNPA 5CVJA 3GHYA 2IVZA 3SKYA 2ZRKA 2XOEA 4UDXX 4WN9B 1E0AA 1C1DB 2JI7A 2OEPA 1G5HA 4L85A 2R5WA 3V80A 3K9QO 1FYFA 2I3DA 3FMGA 3OX4A 2ZJZA 4JI3B 3IH5A 1N2ZA 5H82A 1II8B 2C58A 1WBJB 1EXMA 1GNVA 5DNVA 5K0GA 3IDAA 1I13A 5CJ2A 3D43A 3PICA 2QJOA 2VRCD 4QPCA 1GKKA 4JQSA 1MXHA 3ZW7A 4XWWA 4LXQA 2QVGA 1DAGA 4WERA 3LFTA 4YCAA 2E87A 4XPIB 2CDAA 4DM3A 1QQAA 1NR1A 4LRYA 4F3YA 4KBGA 2Y8EA 4NE9A 1IRXA 1IONA 4MCAA 5A5EA 1N2OA 4Q39A 1NVAA 2VJOA 3OPNA 4NE7A 2NV0A 5A3SA 1TK9A 1E4YA 1T5BA 2E6UX 3KWMA 4ZVVA 3VJKA 1GUZA 1Z7EA 4MTLA 4BFXA 3C97A 1DLIA 3RU9A 1T8YA 2W37A 3IE1A 1DWOA 2AFHE 2HGZA 1T1GA 4D9KA 5SZKB 1YR2A 1QFMA 1YZLA 4JHLA 3RC1A 3VHXB 1JDUA 3THYB 2B8WA 1T9HA 5D6NA 4AZVA 5ICMA 1NXXA 5BUQA 1YS4A 1YRBA 3ZH2A 1UBJS 4P4LA 4HT3B 4D5EA 4B8YA 2NVBA 1XF1A 2GN4A 2VP9A 2VRCA 2KS6A 3CZPA 4G0MA 3T1NA 2XWPA 2Y3IA 1J90A 3K9CA 4TSKA 3SSOA 2ERXA 1JDVA 4R01A 3TMYA 3UT6A 1YJXA 2YL2A 1M76A 2G1UA 2P9HA 4KO3S 3RNOA 4BTVA 1GQYA 1Y3DE 2Q5JA 4U2GA 1LNQA 5CNJA 1UBGA 3E53A 5LP6C 3AHCA 3QTTA 4DEYA 1JXOA 1W35A 4HBZA 3ES9A 3ZNNA 5AM4A 4YT8A 3KIPA 4DB2A 3ONEA 3IODA 1OFTA 1FP1D 2JH3A 3T9FA 2QLJA 3BF7A 3FW1A 4UVGA 1CUUA 4MIYA 2ZJ0A 3KB2A 5A4IS 1GT91 5SY4A 3RYIB 1I14A 2C2ZA 4LJKA 4MRVA 1E7WA 2PH3A 4TTVA 3VPSA 3VH3A 5B30A 3ZY4A 2P6OA 3SC4A 1GUDA 1FFXB 3NXSA 4REOA 2DFPA 3QMWA 3IP6A 2HU5A 4KMSA 1HYEA 1XTIA 5ITSA 3ANLA 4P0QB 2I80A 1U3VA 4Z9YA 5KPJA 3V9AA 3RF6A 1CR2A 5AXAA 4A1FA 3DFIA 4BRZA 1I2ZA 4ZALA 1PG2A 2FR1A 4IYRA 1MB0A 2B3DA 4F12A 4Y6QA 4GXQA 2CLLB 4IQGA 5IUKC 5TPWB 2R6R1 3N58A 3V00A 1QRUA 4JR2A 4EZBA 4CEIA 1XMJA 3FZQA 1AZTA 2J5QA 1KVUA 1T3TA 2YWXA 1Y1RA 3ADCA 3PC8A 1RS0A 4HQNA 4RL6A 3RRMA 1V0JA 1TNDA 1U3FA 1SVIA 1VFPA 2QTTA 3R40A 4EG6A 1ZBDA 2Y0BA 3M49A 4PZAA 5DM4A 1NUAA 2E18A 3OIYA 5K4AA 3ZGZA 3TW4A 4TVOA 3D4IA 4D6YA 3BGWA 2F62A 2X3YA 1U2TA 4B3XA 1NMXA 2RGCA 5ETJA 3UB4A 3PFNA 3A70A 4WZAB 3W4KA 1GRQA 3N53A 3FHOA 3T9DA 2YINC 1UOPA 3OLZA 2HSEA 2PUJA 3DEJA 5CH5A 3COWA 4CLDA 2A1TR 1X14A 2AFIB 5CDUA 1XVUA 4NHOA 2HZ7A 5AICA 2IZ0A 2Q3BA 1M66A 3GN2A 5E7IA 4HMOA 5AP9A 2NO6A 5CA1B 1OVMA 5IN4A 1IBCA 2JFWA 1UANA 3RFUA 3RTBA 3SEFA 1WHTB 1SUCA 2XE7A 4AG5A 3HKDA 5IBPA 1VLVA 2QTAA 3QFCA 1R8QA 2DERA 5A1JA 2OBBA 3D6NB 2PS0A 4UEKA 1FQOA 2OFPA 1V8PA 1W87A 4QGAA 4DV2B 1TQ2A 3I0MA 4AWBA 3G7NA 4HLCA 3WTBA 4EY4A 5HVNA 4J1NA 4XJSA 1R88A 1DIRA 2YVLA 3I9V1 5DW0A 4RA6B 1XD2B 2QJWA 3IP8A 3NTVA 3W8EA 1DAOA 4C4PA 4A15A 1Z2EA 1ZD5A 4UUNA 4WKBA 2RFLA 3QI2A 2OHJA 2JAPA 1GGFA 1JFLA 3PI6A 4BIIA 3AJ9A 4PVDA 3PC6A 4WXHA 4B7AA 1U0SY 2HKIA 3Q8LA 1GY8A 2QMHA 4EO7A 1ILEA 4PIPA 1DRKA 1CJSA 1FU8A 1RMTA 4F7DA 1IDOA 4JLMA 3OQIA 13PKA 2O05A 1Y3BE 4XIFA 3W8DA 3HKCB 1E3DA 1N9GB 4H6PA 4R83A 4UAJA 1I9GA 3CR8A 1H8EA 1VE1A 3RYCA 2CXNA 1CE8A 5CVUA 3U3MA 3EGCA 3E8MA 3HVUA 1MIOB 2FZ5A 4WCVA 1FYDA 1QFSA 4PO3X 3QLJA 2QSJA 1BA3A 1A95A 2HA4A 1XXHB 1O97D 1V7CA 2W2KA 3C74A 4JLBA 1YIAA 3KZKA 3ILHA 3SEQA 1M2JA 3O8LA 1RHJA 1KPIA 1HQKA 3FNHA 4OHUA 2X0FA 1R0WA 3ND5A 5FLYA 1G9XA 5E6UB 1N6PA 1Z16A 2YVKA 4N7BA 3ZY6A 4CM5A 1FFDA 1Z0FA 4G4GA 1MKYA 2QTHA 4E21A 1DEHA 3JQ8A 1WBDA 1U0NA 4NDZA 3DHYA 2PIAA 4KP7A 3NOXA 5ECGC 2ZYUX 1CUCA 3KUCA 3LE8A 3CS3A 3CE6A 4MYCA 4P83A 4H7DA 3CNBA 3SNHA 5CDYA 3MQFA 3E2IA 4RSRA 1EX6A 3G5MA 4CM4A 3GLUA 5FPPA 5HR5A 5JSFA 2G1KA 1RKBA 3O26A 1QH1A 2BJWA 3A9VA 1Z4PX 2QENA 4FK8A 4BX2A 4A6PA 3Q1LA 4NP6A 4Q3AA 1FEZA 2ISSD 3Q1KA 1RPJA 3QOWA 4RS4A 2PRYA 5KAPA 4RNDB 4ZP1A 3ND9A 2FMFA 2RCYA 5EWLB 1D09A 1FBNA 4OHVA 2RHHA 3AI7A 3BSYA 2CUKA 3NFYA 1UXHA 3NPMA 1MOSA 4P7JA 4NI5A 1C30B 3RAFC 2H2AA 1G7RA 3V8PA 4EQZA 1NAIA 4X0EA 4AJ1A 5CHEA 4CR8A 2GJKA 1WDMA 4OX9B 1VXOA 4JIMA 4HLDA 1JWAB 2QK4A 1M2FA 2CDRA 4M54A 1HETA 1Z2CA 2MYPA 4DILA 3PTLA 3VO8A 1U2GC 4TXMA 1JQLB 2VCYA 2V9ZA 5JIBA 5LOVA 2D3TA 4C89A 1GPYA 2XA9A 4B0OA 1Y7PA 4BV9A 3VKHA 2QE7D 3GK3A 5FA6A 1LJ8A 2C03A 3D54D 1TD1A 3SS7X 5JBQA 3SFTA 5H8WA 1SCJA 2SKDA 2J32A 1Z5GA 3L93A 3LNCA 5F2KA 5AXBA 2UZ1B 3P2KA 1EFVA 4ABTA 4OMFG 2QYOA 1VECA 1TUBB 4LY6A 2B4KA 1D2EA 4P54A 4BQFA 2GNOA 4RK1A 4ONEA 3TZKA 4CLRA 4IJUA 2OM2A 5HE9A 1K5PA 2HBZA 3RSGA 4Q9LA 2G0TA 1TJ5A 1YB7A 3CSDA 1ZVJA 2HXSA 3BMNA 4XFJA 5ESXA 3WI7A 2C7QA 2G0AA 3O8BA 2P9YA 1NF8A 2BEVA 4D8YA 5MN6A 5J1SB 2BY4A 5FHRA 4G0VA 1IBRA 1F0KA 3KUKA 1Q7RA 1SZJG 5KREA 1TM7E 1NJ5A 4HS9A 3DP7A 4I1PA 3SQDA 4W5WA 4OHKA 4Z4EA 3EQ9A 5BR4A 1NBME 3B5JA 1Z0AA 3SLGA 3GLIB 5HYVA 1O87A 4RK6A 2DG2A 5LSAA 5JPIA 2PBRA 4D9IA 1UKBA 3OQOA 5EIXA 1FXUA 1DV1A 3HN2A 4BS9A 3OESA 4TV8F 5DM0A 4OKNA 2OFWA 1KFCB 2VHEA 2XUIA 3DKKA 4ENUA 4DCTA 1Z2DA 2A4KA 3EXHB 4L27A 1EPUA 1T2NA 1TCUA 4V1CA 2E89A 3G2MA 4KN5A 1XC7A 5HWSA 3AR2A 5ALUA 5K8UA 3V2GA 2J4CA 1LDYA 2IK8A 4HTAA 1EFTA 1GR0A 3D8TA 1ID8A 2HW8A 3MWLA 3BXEA 4D6XA 2C3UA 5BUSA 1PSWA 2QYSA 4YIKA 1QG0A 3VTZA 1LLFA 2JGFA 3EEFA 2WFLB 3BCHA 1JPNA 3TW8B 1G20A 2HMTA 1E6LA 4LIPD 1USUA 3S5JA 3LI2A 4D79A 1RZRD 4OKSA 4UUMA 1YHZA 1EXWA 1U2QA 1V7PC 4IGFA 2YHIB 4QD3A 4DMUB 3H5LA 4U5QA 5EA2A 1ZXXA 1G5IA 1GPKA 4RD4A