1FXUA

Purine nucleoside phosphorylase from calf spleen in complex with n(7)-acycloguanosine inhibitor and a phosphate ion
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
278
Chain Sequence
b'GYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGQNPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase: structure of its ternary complex with an N(7)-acycloguanosine inhibitor and a phosphate anion.
pubmed doi rcsb
molecule tags Transferase
total genus 86
structure length 278
sequence length 281
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fxuA00
2AI2A 4MARA 1OU4A 2QTGA 1RR6A 3MB8A 1YRYE 5IU6A 5IFKA 3D1VA 1V2HE 1ODJA 4LZWA 1Z33A 4DAOA 2AI1A 3O4VA 5F78A 1XE3A 3U40A 3KHSA 4L5CA 1ULBA 2AC7A 3LA8A 1PR5A 1TCUA 1RCTE 1YQQA 4BMYA 3BGSA 1Z37A 4K6OA 1OV6A 3O6VA 3E9ZA 1JPVA 4DARA 1JP7A 3UAYA 4DA6A 4OJTA 2B94A 1G2OA 1K3FA 5EPUA 1ODLA 4LNHA 5B7GA 1JDVA 4D8YA 4G89A 4L5YA 5C80A 4L5AA 4TS3A 4TXJA 1Y1TA 2QPLA 3BSFA 3GB9A 1RXCA 4F2WA 1PR4A 1Z5OA 4EB8A 4TTAA 4KN5A 5DK6A 4D8VA 1Q1GA 4WKNA 4TTJA 4H1TA 1ZOSA 1JDSA 1U1FA 3BJEA 4L6IA 1K27A 2OC9A 4QATA 1QE5A 3OPVA 3ONVA 3T94A 5CCDA 1K9SA 1YQUA 2A0YA 4OEHA 2QSUA 4D98A 2P4SA 4TXLA 4I2VA 4WKOA 4MCIA 1RXYA 1NW4A 3FB1A 5ETJA 4NY1A 1JDUA 1PK9A 1ZL2A 3P0EA 4PNPA 4UC0A 3KU4A 2H8GA 1VMKA 1PR0A 1RSZA 1JDTA 3FUCA 4M1EA 4YNBA 1Y1QA 3EUEA 3IOMA 3DF9A 2OXFA 4NSNA 4YJKA 1V4NA 2I8AA 2A0WA 5F7OA 1Y6RA 2QDKA 3OF3A 1RYZA 2A8YA 4OGKA 4F3KA 3FWPA 3NM4A 3UAWA 3EUFA 1TCVA 4F2PA 4TXHA 1A9QA 1A9TA 3OZBA 1I80A 3LBAA 1TGVA 3PNPA 1Z39A 3ODGA 4OY3A 2OC4A 4TXMA 3UT6A 5F7XA 4JOSA 3FOWA 4TTIA 3EEIA 3DJFA 1TD1A 2ON6A 1T8WA 5FAKA 1LV8A 3UAXA 1A9PA 4OF4A 4U2KA 2XRFA 1A9RA 1T8SA 3BL6A 1OUMA 5EFOA 5F77A 1PR6A 3OZCA 4QEZA 4RJ2A 1CG6A 4OGLA 4M3NA 1WTAA 1ECPA 1VHWA 4ECEA 5F73A 3UAZA 1T8YA 2HN9A 4M7WA 3E9RA 3OZDA 4TS9A 4F1WA 1M73E 1OTYA 1U1GA 3C74A 1YBFA 5F7ZA 4D8XA 1RFGE 2I4TA 1B8NA 1T8RA 2BSXA 4WKPA 4FFSA 4JWTA 3DP9A 2QTTA 1ODKA 1OTXA 4TYMA 3K8OE 1Z5PA 4LDNA 3IEXA 1PWYE 1NC1A 4BMXA 5CCEA 3OZEA 1PF7E 5JPCA 1N3IA 4DA8A 4X24A 4LNAA 3TL6A 4MCHA 5F76A 5B7PA 1U1CA 4GLFA 3GGSA 4PR3A 1TGYA 3K8QA 4YO8A 1PR2A 3NM5A 2HSWA 1SD1A 1V3QE 1LVUA 2ISCA 4DANA 5CXSA 1Z35A 4WKCA 3KVRA 5K1ZA 1JDZA 4DAEA 3ENZA 4YMLA 4R2XA 1Y1SA 3OOHA 1U1DA 1C3XA 3FAZA 4WKBA 3UAVA 2GUWA 4BN0A 4QARA 4E1VA 1FXUA 3PHBE 2Q7OE 5B7QA 3OOEA 3MMSA 1CB0A 4GKAA 1PR1A 1V41E 4IP0A 1U1EA 3SCZA 1PBNA 2AI3A 2HRDA 4LKRA 4G8JA 2A0XA 4R31A 4QFBA 1Z38A 3PHCA 4QASA 3OCCA 3E0QA 4JP5A 2RJ3A 3QPBA 1VHJA 4DABA 1Y1RA 3INYA 4D9HA 1PW7A 1Z5NA 3FNQA 3NBQA 1LX7A 4P54A 2OECA 3PNSA 1A69A 1Y6QA 5F7JA 4F3CA 1OVGA 4L0MA 1Z34A 2PGAA 5I3CA 1RXSA 3F8WA 1T0UA 3KVYA 5CYGA 3DDOA 1SQ6A 1A9SA 1JE1A 5KB3A 2HWUA 1RXUA 1NC3A 3KVVA 4DA7A 3KUKA 1V48A 1JE0A 4QAQA 4NS1A 4DA0A 1ODIA 1YR3A 4G41A 4TXNA 1B8OA 4R2WA 5CXQA 1RT9A 4EARA 4GMHA 1SD2A 1SJ9A 3P0FA 1V45E 3EMVA 1PKEA 1ULAA 5EUBA 4BMZA 1VFNA 5B7NA 3LGSA 3NM6B 5CYFA 3DPSA 2IQ5A 1A9OA 4GLJA 1PK7A 1Z36A 1JYSA
chains in the Genus database with same CATH superfamily
2DBYA 1R9GA 4HZUB 1TJPB 1C0PA 4I3GA 2WAYA 3S27A 4BFSA 2WG1A 1X0VA 1AQIA 2FQYA 3AK4A 1GUBA 1QU2A 4PFJA 1DUIA 1JG2A 5BWMA 2ZR0A 5AXAA 4N3AA 5EIWA 1DNPA 2GPTA 1Y5IA 1M1ZA 5FA5A 4Y6SA 3UATA 1A96A 4DJ5X 4N76A 1T9GS 1ZK3A 3TSYA 5AVUA 5CB4F 3PHLA 5ITZA 1GL7A 1Z33A 4YJGA 3L93A 1TMOA 3BD8A 5AOCA 4DAOA 5JAPA 5KNDH 4MVJE 3HCBA 4X3PA 1QGDA 1H66A 2QLFA 3QX3A 4XRGA 4GI5A 3G2IA 1VLJA 1FBNA 4QXQA 4BVAA 2AEMA 3ROZA 2GT1A 3ORFA 3R7AA 1GPUA 4HGNA 4A0GA 3B36A 2X14A 2VZLA 3ND8A 4LHXA 1X7WB 1U8FO 1E1LA 2AUMA 3LY7A 1CY2A 1IG3A 1HE3A 1UZLA 2BBTA 3Q2OA 3U44B 4BNIA 5IVKA 3G1UA 1DHTA 1A5TA 2OBXA 3A10A 1MC8A 5SYAA 4FBLA 5U1PA 1J99A 2ZTHA 3K53A 2B4QA 3AF4A 3C6ZA 3CF4A 5FBQB 4BGUA 1LPOA 4E13A 5FWXA 5CFOA 3A06A 4LI3X 3DULA 3BVPA 1Y3HA 2JASA 4BMSA 1G2OA 1YCFA 3Q4GA 2V4UA 4GC9A 1U6KA 2WFLA 4JZKA 2CDRA 3T9AA 1VL1A 2ZWIA 3DEAA 3QWFA 2F90A 4FFRA 4G0NA 3AKYA 4KDCA 4PXAA 5MGBA 4PFQA 1CJMA 4PPQA 4TLDA 5ESXA 4GIBA 4ARUA 4ZQGA 1KMCA 5DRTA 2J9GA 2YRXA 4E2XA 1RVDA 3HNRA 4R7GA 2PZJA 3FE2A 4H08A 2IUEA 3O31A 3DSRA 4PO3X 2O05A 2QD4A 1WMDA 3KNZA 4KIWA 3AG5A 5EMMA 3EEYA 5AHXA 2HA4A 4N5DA 1M8GA 2P9BA 5HKKA 2BFEA 1AB5A 4J0FA 5AI0A 3U4MA 1R6DA 1PV4A 3O92A 4DF3A 4BBAA 2E6KA 2K5UA 3NIBA 1N34B 1BDHA 4MJLA 1MRNA 3DMYA 1IN1A 3OP4A 2BP7A 2WHYA 3PQ8A 2OGSA 4Q9KA 1UJ6A 4BNDB 4G1VA 4LQLA 1CB7A 1LQUA 1SUPA 3BCRA 4JJZA 3P9ZA 4LOHA 2I3BA 3M33A 1R18A 1AMNA 1NATA 3DAYA 3KV1A 5IWCA 1JX6A 2F55A 5IBCA 3UK6A 1DEKA 1QS0A 2VJBA 4CCWA 2G7MC 1EKXA 2HA2A 5JJKA 2W2PA 3OLQA 2Z9CA 4Q1AA 1ECCA 3C5EA 3WHPA 2XNHA 1UJ4A 1YB2A 3P94A 1OHHD 1PD0A 1T6NA 1FE8A 1CERA 1K9SA 1VIMA 1D0SA 2Q49A 2ZRJA 1NOKA 2CB9A 1U8EA 3GDWA 3GXOA 3JQFC 3TZBA 5LLTA 2OD9A 1PNRA 2IS1A 2NZJA 1BD4A 5LFAA 4P7KA 2ZZNA 3NDJA 5L7YA 4BVFA 4ZQCB 2UXDB 1GTL1 3H9UA 5AXDA 4ZO6A 4IIEA 3TQTA 1ZIOA 3RT7A 2HC9A 2ZBFA 3VPBA 5GIOE 3UMGA 2PEYA 2JFZA 5F1PA 1NM5A 7REQB 1ZIPA 4IH4A 2RHDA 2R11A 4OHFA 1ZJ5A 4K9QA 3EPRA 5KIAA 3ZWYA 3IKTA 3G9UA 4LYFA 5L3ZA 5KYYA 3ILHA 5C7IO 1L7VC 3KP1A 2R96A 1ZGCA 2FW0A 1V11B 2PGIA 1TTPB 2G9RA 1RKBA 3OCVA 5CRIA 5IMSA 1J0EA 1Q0PA 4DDHA 3I9LA 1L4HA 4AQDA 4G9GA 4MULA 2YW9A 4J4TA 3IESA 1SVUA 3IPYA 5CNMA 5KYVA 4H1HA 1MV5A 1Z8NA 4Y2GA 5A06A 4WMLA 5F4ZA 3IVAA 2WFAA 1FZQA 2XMPA 3P0EA 5DI9A 3PR3A 1GKLA 1N6OA 1YDGA 3L92A 2I2AA 2QUKA 5KMGA 2GCIA 3HBFA 5LD2C 4UD6A 5BMOA 5JADA 2J41A 2JL1A 2H17A 2PX5A 2PRKA 1O54A 3PX3A 3KCNA 1E2LA 3MS7A 5FFMA 1GTZA 2VT6A 5AKJA 1WE2A 4AG3A 1BG6A 1MLDA 4WT7A 1BW9A 4KI0A 4WZAE 4ZVSA 3HXMA 3OFJA 2Q0SA 4AG6A 2RB4A 3H5AA 3FF1A 1QKKA 1T1SA 3GHYA 1RU3A 1V4NA 2YNMC 4IHJF 3HFGA 5AHOA 2XNJA 1DUSA 2GX6A 3EVDA 3PIDA 1CE8B 1T0JB 4LN1A 3K70C 1MU0A 4X85A 3A1WA 1NAIA 4IDOA 1OASA 1FUUA 1KYVA 1XSEA 2JAUA 3TB6A 2XQGA 5L45A 8MHTA 2B4TO 1SQ0A 2C7BA 5A5FA 1KI7A 2PU7A 1JFTA 2NVOA 5LP6C 1SPXA 5FPQA 1NRXA 1JQAA 4RD1A 1GM5A 4IJWA 4QECA 1KHTA 5ALRA 3TMKA 2JIRA 1ND6A 5ADWA 3VZRA 1CU1A 2YMMA 1WMEA 5JSYA 4CM3A 2PT6A 1OX4A 1M74A 2Q5QA 4BX8A 4KR7A 4DMCA 1E6UA 3TBKA 4EKGA 1Y7HA 5CHEA 2AG5A 2WTXA 3QUSA 4BYGA 3PNPA 3A9TA 2G5CA 1F0PA 1RQ2A 4ARZB 3EQZA 4C08A 3KZXA 3FHCB 3KL2A 4KPYA 2CJYA 3NBZC 1VCIA 3AEQA 4FW9A 1KARA 3GN1A 2B8JA 4KN6A 4EEXA 1GD1O 1R0KA 1KFCB 4GT1A 1RJFA 3EG9A 2HCJB 3KTFA 3RU3A 4WFJA 4EYEA 1N78A 2GQ0A 2ROQA 5TY0A 2MU1A 2LD4A 4GO1A 3VGPA 1SXHA 3DQPA 2WWWA 3BA6A 3G8BA 3V48A 3KYBA 4EBBA 3FBWA 2YMLA 13PKA 3O84A 1NV8A 4J0IA 4B6SA 2X4IA 1HUQA 1UEJA 3U7QA 3HA7A 1E2GA 4KXVA 1E1CB 1KS2A 3OT1A 2L18A 3G0BA 1NQOA 2ORYA 2ZRMA 4MB6A 1TO2E 4GYWA 3WKCA 1OX5A 2I91A 1NXSA 4HUTA 3AR3A 2GYWA 4A0FA 2P9GA 1JVBA 3ADPA 2E4VA 3A6LA 1RI1A 3DL7A 1VHTA 4R3NA 2XWPA 2YXBA 4EF6A 4JAVC 4BPBA 4DSTA 3HN7A 1CR6A 3KQKA 1JFVA 3AX6A 1XKQA 1JECA 1T43A 3VI4B 4XWYA 1E0JA 1EP9A 2VDQB 1Z8HA 2BJWA 4O5OA 3C6KA 4QEZA 4B4KA 4BE4A 1SQSA 2G8NA 2HA3A 3N76A 2Q1YA 2OV2A 3LC1O 4LBVA 1DMSA 4GNRA 3C8DA 1J2JA 4F97A 5CVDA 1GPLA 4BFLA 3I1YA 1TVCA 3TQFA 3OZIA 4ZYVA 3QV2A 2XCOA 1YR1A 4P6VF 4XASA 3G5AA 1YMUA 5GADl 2BFCA 3DE0X 4KYVA 4YCNA 1CCWA 1EDEA 2BMWA 3UPDA 5I45A 4QG7A 1Z4KA 3LCJA 1I4WA 3PX7A 4TT8A 2WSIA 3WGNA 4BRSA 2QMEA 2FEWB 2PKQP 1N2JA 2YNMA 1QF7A 1WEKA 3PUYA 3BHIA 4KAAA 3WIUA 2BEVA 1NSYA 3I6IA 3LUAA 2GM5A 1FIUA 2C95A 1XDSA 3DBLB 1AKRA 3VR6H 5L95A 1VLVA 2XRZA 3A1NA 2PYZA 3EOBI 1Y80A 4MQLA 2ONYA 2E87A 3TW8A 3W2GA 1TCBA 1JFSA 5B58T 4JU9A 4B6JA 1U2TA 1SZJG 3U39A 4MW4A 2HHCA 2FE4A 2YJ4A 4D4KA 3A3NA 2AX3A 1BKSB 2BYTA 2FFHA 3Q7TA 2P1ZA 1GTG1 2JHCA 2Y6UA 2W00A 1U8AA 3DKVA 3NUQA 4OL0A 3SQMA 2ZE7A 3ZDFA 3ZWAA 4ZJPA 4I4CA 1U0RA 2C2HA 2GBFA 3Q0EA 4DCUA 1BH2A 1CY1A 2M9MA 3C7TA 3GV0A 1Z6ZA 4QIHA 5DNWA 5G1OA 4GKKB 3SDZA 3VKHA 5A3QA 4YJ3F 5FA8A 4AP6A 3B82A 1JAYA 2VFAA 1GYQA 3PQ6A 1J1UA 1D5WA 3B60A 1MX5A 1PEYA 4J0DA 1Z6PA 1KTIA 3IE1A 3D5TA 3E7FA 5GTDA 2CC2A 2VHEA 4KO8A 1YR9A 3K9NA 3K3PA 3HZOA 3ZJ4A 4B6RA 3C8HA 2YJ5A 3OEHD 2WB2A 2Q2OA 3TRDA 3VR6A 3Q8KA 3FPCA 2Y0DA 1Y3CE 2ZBEA 1XMPA 2DPYA 2NYRA 3KHKA 1CS4C 2HA7A 4G0UA 2VDMB 2A92A 1C80A 4AO6A 1I7NA 2WUEA 1SZDA 3AZPA 3QHQA 4KR0A 1WXEA 4MRAA 2XAUA 4XM1A 3RC8A 2TS1A 1JSZA 2NXWA 5B7PA 1HLGA 2QN9A 4A6XA 3AXSA 5JNSA 4QVIA 2PL5A 4B3BA 2Q4TA 4NBTA 7ADHA 2QD1A 5LN1A 2AE1A 1BGVA 4LFBB 2JJYA 2JJ2A 5AUQA 3CUSA 3QPCA 3G0CA 1L5WA 1Y3IA 2RH4A 3O7MA 4BE7B 3RYFA 1N8KA 3MJVA 3QG1A 4OP1A 2EP5A 2XTMA 4CIBA 1EFDN 1TC1A 1QHEA 3A4NA 1DC8A 2W37A 4V2IA 3WLAA 3ZY3A 2ID4A 1P18A 2ID7A 5EHIA 3I62A 4R0NA 4ZDJA 3AFHA 4HDNB 4QJIA 4CJXA 4HAYA 4WKCA 4AZ0B 1IOZA 1MVOA 5AK3A 2VWHA 4REQA 3PJRA 1HTTA 5U4QA 3PKZA 5IBPA 4ZHSA 4KX3A 2CMKA 3CNHA 2XD9A 4KQ6A 1B0PA 4W7SA 1Y7LA 1EVIA 3R8XA 4E30A 4FYIA 1DX9A 1P0QA 1RXIA 3CG4A 1GADO 3PUKA 4XGQA 5NULA 3ZDXB 5JCPA 3LE8A 3ENZA 3QUBA 2G77B 1G6KA 2OE2A 4TMWA 1ILWA 4BNNA 4CE6A 3HFRA 1C3XA 3RSHA 3SOPA 4MVJP 4OI1A 5KHOC 2V0GA 1N92A 4CMJA 2WRZA 2B98A 1T8PA 2DETA 4KTTE 4PTLA 5BWCA 3GLRA 5JWOA 1BHO1 2BELA 2C94A 4MINA 1AOXA 1BGXT 2H9YA 1Y1KE 3E2IA 6GPBA 2AVNA 3OOWA 4QOHA 2A14A 3VZQA 4AJOA 4IIYA 4IDEA 3OQIB 1V9SA 4BMOB 3ZIUA 3D8HA 2JLCA 4HDCA 4ZOAA 2MR6A 5FPYA 4AKGA 4JLUA 4CM7A 4J7XA 1QIJA 3GJSA 4AS1A 3E0QA 1W2HA 2GWRA 3GXBA 3U4CA 3WMGA 5HXAA 1ZM7A 2ZXEA 3VAAA 3PDIA 1PKXA 4NOLA 1TW2A 5CVUA 3SR3A 4PGHA 3ZZ1A 2Q6LA 1CF2O 2JGIA 3EHDA 2YC2C 3MT9A 2NM0A 1VC2A 3ZE7A 4P54A 1LX7A 3AI1A 1NJ8A 4HK4A 3C8MA 1XOIA 3HB9A 2OUKA 1QVAA 3DTYA 4D2IA 5L8VA 3SEFA 4XYLA 3AV3A 5HMMA 3NX4A 4UM5A 1EDZA 4Q05A 3KTAA 4BQPA 4RE6A 4Q1EA 3PUVA 2I55A 2WF7A 1PO7A 1Z34A 3LIPA 5AKHA 4IY1A 2Q29A 4DIMA 1YE3A 1X1AA 4UNRA 5BW8A 1XRSB 4X1OA 3TR5A 5COAA 1U2QA 4EVRA 3CEJA 3GA0A 3N6XA 3ICOA 4YV2A 1ZOPA 2A1UA 2V9ZA 1BMQA 3KQPA 3KVYA 2UYCA 1SFRA 1NWHA 3QQPA 4OGWA 6CHYA 1Z63A 1T5OA 5I9SA 1U04A 2PX3A 3T1YB 3LWDA 1OB2A 5KCMA 1BNCA 3ASZA 4URVR 3WBBA 5HM6A 1BMTA 1SKUA 2ZDQA 4R2IA 2NUPA 4ON9A 4X00A 4B3GA 2YDXA 2GPNA 3CB4A 1E32A 4I55F 3EA4A 2BM8A 1F7UA 3SU8A 2IYUA 4JXJA 4ND5A 4L9AA 5IJAA 2XUPA 4EK9A 1LBSA 2RHRA 4FUTA 2WWGA 4LV5B 1BVUA 4IVRA 1YHNA 2X15A 5B1SA 1IJKA 4P4SB 5JQWA 2COKA 5BRNA 1C50A 4E1BA 1H4SA 2ZI7A 5HK9A 2XT6A 2DR2A 3DE4X 2RONA 2G7ZA 1TXGA 1AS2A 3AESA 1OWNA 1A97A 1PS0A 3M6XA 3FDFA 1OE0A 3F3SA 3BL5A 1S8NA 3FI0A 4OBXA 4C5BA 4UFPA 1NLFA 3TKYA 2FMHA 2G9QA 4AX8A 1SKQA 4YCMA 1R3DA 2ZJBA 2PS3A 5LUBA 1TVMA 2QJWA 1D4OA 3U9TA 3HO8A 2VN8A 1VJTA 1KBQA 5L6MB 3CN9A 2W43A 3E03A 3MWKA 3RO7A 1V45E 3EC2A 1E1KA 3K05A 4ESOA 4OQZA 3ZY2A 1NULA 3RYIA 2DQYA 3WGQA 4EGJA 1FP4A 1QO9A 2HL6A 2XWQA 3C6QA 2H8KA 2ZETA 2BMDA 1SH7A 3GUYA 3L04A 1VFNA 1CQPA 2FUG6 3UIEA 1SVWA 3AP1A 4LRUA 2G76A 4EJ0A 1LF5A 4ZEMA 2QJTA 1D2RA 2EFCB 2JC3A 3GEIA 1KXZA 3F2VA 4UTVA 5HS4A 1CIVA 1E1MA 1QVZA 4CT4B 1KZGB 1ZQ1A 2LKCA 3R3SA 1XCMA 2NTYC 3HL0A 2DQZA 1G0OA 4PLGA 2X7XA 2GN1A 3UZUA 3ZE9A 2FUG1 3GZNB 1HBJA 4I1UA 3DV0B 4OSOA 5CA1A 1U3DA 3QI2A 2JJ8A 4W1RA 4PZ0A 3FOFC 1XP5A 3CINA 3NKFA 1YL6A 2AI2A 1C8VB 4MARA 4L3WA 2ZT7A 4RCZA 3X43A 1RPZA 3G2HA 4D82A 3WB1A 4IYJA 3PD7A 4M8LA 2AFIB 1N7JA 3LP8A 1HQYE 4R2LA 1J9GA 3ANYB 4RS4A 1AKQA 2VNAA 3H5NA 4ZANA 3SI7A 5AM4A 3VO9A 3VNQA 1E8DA 4S1NA 3BKXA 3DOUA 1ZL0A 4X61A 1BOOA 3MHPA 1P45A 4MV8A 4AJ4A 4QJ5A 1XRLA 1JVNA 1GSAA 2D4HA 7MDHA 2BRUC 3FCYA 3KHTA 4YS6A 2OFFA 1KYQA 1FYFA 5AVJA 2AI1A 3WLFA 2EFJA 3O4VA 2Q4RA 3AY7A 1KBOA 4KXWA 4NBVA 4N40A 2WUDA 3V1MA 2C1XA 2RHTA 2JI9A 1EMDA 3AERB 2GTPA 5D3QA 4BNKA 2H4WA 2B69A 5L7TA 3VJLA 1PJTA 4G65A 5AJYA 1REQB 3EXFB 3AF6A 2BJVA 1QYXA 2AGVA 5J4HA 3CLTD 1I0IA 1A8UA 1UODA 3L07A 3BGSA 4KLCA 2DFVA 3M1YA 4DUPA 1UWVA 3CEHA 3DMFA 3TIVA 4BASA 2B4KA 5IJ0B 3QEBZ 1RZRA 3LZ6A 3R74A 3EGVA 4KOEC 3AKCA 5DN6D 4FXPA 5D84A 3ZLTA 2XNSA 5H7XA 4ILKA 4OREX 4DMKA 4LOAA 3DCJA 2GD1O 2V8OA 4TV9A 4JVSB 4JEUA 1E99A 2R85A 5CDFA 2HRZA 2HT6A 4X3CA 4A8TA 4CMHA 5JCJD 3OHSX 1V9LA 1QGZA 3HVKA 1TPZA 4O2AA 4WGGA 1FVOA 1MJHA 3OJEA 3U3DA 3DLHA 1E6MA 2K7FA 3SFZA 4HH0A 3FCOA 3QM1A 4YROA 5F9MA 5FPHA 4J4BA 2LCQA 4YRKA 4LF6B 1F17A 4GWGA 3ZWBA 3NIWA 4HYEA 5ED0A 3D6TB 5HP4A 5CH5A 3B6JA 3ZVLA 2ZG6A 1HORA 3BB1A 4RZIA 2WA1A 3DCNA 3MYYA 3WLQA 2PWBA 3MPUA 3BSWA 1G8MA 1EVZA 5HX7A 4H1WA 2QP4A 5BN3A 2LZ0A 1JQ3A 1I4LD 2OAEA 3AGPA 2QTHA 4MI9A 3S1AB 4DOMA 2ZBUA 2GN8A 1VB5A 2J1LA 3WRYA 2H5LA 1JLKA 1WJGA 4FN5A 3RUHA 3TD9A 4HVCA 4OQNA 3L43A 4KN5A 4DDVA 1SKYE 2E18A 4M54A 5JE8A 2VA9A 3Q7PA 2ZPAA 1Z5ZA 1PS8A 3C8UA 2HNKA 2K2QB 3LJKA 3UT5B 2OM6A 2JFGA 2X1HA 4ITVA 2AT1A 2IGTA 1L2TA 1DTEA 1BO6A 3MOGA 2C2GA 1TFUA 1JLMA 3F9CA 2RBKA 1JDSA 5C1PA 2FPMA 3NEPX 4DREA 3FMFA 3E3MA 3IHTA 4ZKDA 3CLUD 5KTTA 5F2KA 3P32A 2CYCA 1C3OB 1ZUNB 5M3BA 1BXZA 4NDNE 3LUJA 4F46A 2RGBA 5DWQA 5E4YA 4DLYA 3D3QA 3H0EA 4BWFB 1C1DB 4XUGB 5EI5A 1EUQA 3WLKX 2ABWA 2FRDA 1HT0A 3KFLA 5IC6A 3MTBA 4EJSC 3ELWA 2WD8A 3CVXA 5A0VA 3MERA 3P71T 1DL5A 1NVWQ 2KHZA 1GSHA 4J0CA 1ACLA 4HGZA 4RD6A 1B93A 3OUZA 4ZDWA 3I3OA 3R7FA 1MC4A 2QROA 5EKSA 1Z4JA 4JP2A 4XM0A 1F2DA 2AOUA 1P29A 2GFHA 2YQ5A 5A5EA 5SZJA 3EGDB 3WHIA 4KR9A 1T5IA 5GVSA 1NE7A 3WQRA 1TVEA 3T95A 2FDRA 4N7MA 4F2WA 4BLQA 5E7IA 4B5LA 2GPJA 3DZIA 1QGOA 2G1KA 2GNAA 1U6IA 4F8YA 4NJEB 4FMCB 4PYQA 2IHKA 3AU9A 1HX7A 1CUIA 1EFRA 1E61A 2JFYA 5BSUA 3RV4A 2R87A 4Y7CA 2PZGA 2X40A 3B3FA 5EA2A 2J3JA 2ZU6A 1KS9A 1WIWA 2WWTA 2XUKA 1PNOA 2BCEA 2ZYGA 3FOCA 4I4NA 4ASUA 4CCYA 6NULA 1FUYB 2IKQA 4UC0A 3KU4A 4L75A 1OREA 3MWYW 4L16A 4XEHA 1U3FA 2H8GA 2OFOA 3ICVA 5E2AA 1E6WA 2JGAA 4MUEA 1DDIA 2C4VA 2BWJA 2LGJA 1HDRA 1JDTA 4CUZA 1QNFA 5T41A 1EG2A 5HR5A 1ZD8A 1PFGA 3F7MA 1Y7PA 5IM5A 5KYTA 2BFFB 2I33A 5JDIC 1VE5A 1RXWA 2Q62A 1GV0A 3K2EA 2IVZA 2R79A 4OOEA 4P8RA 1MAVA 1UWLA 4QG3A 2UVDA 2XB2A 2L0XA 5JNVA 3PQFA 3W05A 1G9XA 3NEYA 3LBIA 5DPMA 3QFTA 3DEHA 3ETLA 5EINA 4Q3DA 2A9QA 4NPHA 1XMOB 1Y42X 4FOOA 5HA5A 5D51S 3H0CA 3VSCA 1Z2CA 3BGOS 3EGIA 2B92A 4MQ6A 2Q3HA 1UAAA 1U81A 3PITA 2BGJA 2REBA 4NEGA 1MENA 5K3BA 1VLMA 3CZ4A 2MR5A 4ODIA 4R2JA 3UJBA 4UE3S 4D41A 3QENA 3QXXA 1XRRA 1CY0A 2HRQA 3FVWA 4KSBA 4MYTA 1DOAA 4U8HA 3WWZA 3AJ9A 3PEUA 1A8QA 1XYVA 4IDGA 1O97C 3PE6A 3ZJYA 4KMSA 4N3CA 4TXMA 4KQWA 4GECA 1P4SA 4LBZA 1G6HA 4NH4A 4JIMA 4YJFA 2R47A 1RYDA 2WICA 4LQCA 1OFUA 4D9NA 1PL7A 1RYHA 1C8KA 1XPUA 2Q4EA 1AY0A 2AFHE 4ZVTA 4D4GA 2OT3B 1I3KA 1TD1A 3PJDA 3CWCA 2A9JA 1T8WA 1PGNA 2FH5B 1R0SA 1SC9A 3UAXA 2C82A 4FNOA 1AF4A 1DC7A 2BMEA 1U0JA 2HBYA 3BC1A 1DVRA 1OBFO 3GFFA 4BO4A 3MUOA 3HH8A 2XRFA 3H3JA 4NENB 3ONNA 2CXQA 4MS4B 4IRMA 2GZ1A 3QVKA 5FLKA 3NTOA 4ZI7A 3PUWA 2VJNA 3HYSA 2F3QA 3TLGA 3PJEA 3AVWA 3DBRA 1ZOIA 1X7ZA 3ETEA 3WNCA 3OIFA 4HNTA 1E96A 1CG6A 4WRRA 3EVAA 2RK4A 3LFHA 3LAWA 2NXNA 5BSFA 3FIUA 1ECPA 3EA0A 4JJKA 5G0VA 4EVQA 4XTRA 2BGIA 1T8YA 1N8TA 2P9JA 3KKZA 5DX8A 2QUAA 2Y9PB 3TYXA 3K9FC 3NG1A 1X39A 5TVGA 1XZMA 2D7CA 2JI8A 1FPMA 1SUEA 1ZD5A 1SG0A 3H9BA 3HYLA 3GLGE 1L9KA 3EDCA 4N5IX 5AKYA 3NBUA 4HDAA 2FXVA 5JDIA 2VTBA 5A4KA 4FFLA 1SOAA 1AHIA 1BD3A 2VUTA 4F2DA 3D6AA 3WJ7A 4QWMA 1N4AA 1XR3A 1YBFA 1VXRA 4KMOA 3HJAA 3UA4A 4ESVA 1E9BA 2FSUA 3BBPA 4HADA 2OESA 3PHHA 2F4NA 3IFSA 5BMVB 2QN6A 3E22B 3BIWA 1CF9A 4UZEA 4GWLA 1QWOA 1W93A 4OXNA 4W8OA 4X5OA 2P5SA 2ZI9A 2ZR7A 3S55A 4YCCA 2ZJAA 1MEOA 3DP9A 5HCUA 2QTTA 3PIRA 1Z6QA 5CTAA 5TEVA 3T35A 3GQBB 1Z5PA 2XZPA 1QPGA 3JQ8B 2BD0A 1PL6A 2X58A 2WYIA 3B9PA 2R6GA 4IGEA 2AN1A 3JVUA 4CFSA 1IM5A 1KO5A 4LJ7A 2XKJE 4G63A 2KBFA 5KTOA 4KH1A 1UXJA 1QFSA 3A9CA 3QNWA 5EMLA 1EVQA 3HA5A 4C0WA 1CEYA 3H2JA 5AVTA 1UH5A 2AD5A 3QVWA 3LX8A 1S5PA 3R09A 4BFUA 1H2YA 3EQ6A 4LZLA 5AUOB 1KSJA 4OXXA 1JNXX 1N5MA 2O2SA 3VAYA 2H1CA 4DBVO 3ES9A 1TYDE 5F76A 3A4TA 1UJ5A 3A7EA 1RRMA 5CXXA 2AG8A 1NI4A 2VJPA 2D06A 3ZKWB 3FPLA 5JQGB 2FMTA 1SB9A 1M2KA 1YZFA 2K2WA 2CCJA 3UGTA 4I4LA 2J8ZA 3VZBA 2AQIA 2GEUA 2DT8A 4N39A 4W7HA 1X92A 3MMXA 3WGHA 1JBEA 1SD1A 6LDHA 1KEVA 1ZS9A 1IB0A 3RRZA 2P9ZA 3NIGB 2C42A 4LKOA 1JA9A 4NCKA 3M5DA 5ARBA 4NR0A 2ZIWB 4BECA 1TUBA 1LI5A 3EZ6A 3G82C 3OQ6A 3SKYA 4C7JA 5A05A 1FTGA 4ZVMA 3PEFA 3P97A 2ZUUA 2IHYA 3L6UA 1E66A 1K2VN 1G7TA 3HUUA 4EZBA 4F4IA 5A9RA 2IXEA 3HKDA 1ABBA 1V26A 1XMSA 4A3SA 2PQ2A 4EPYA 5HDBB 3OLYA 4BGDA 5F23A 1ZVVA 2Z8XA 1EHCA 2YZGA 4KSYA 4M1WA 3GPCA 1UMCB 3BD6A 1PZNA 2P0EA 4TZKA 3GNTA 1WNTA 1EFPA 2YFHA 4J6FA 3GLHB 5SZKB 4PYRA 4I50A 3CLHA 1GO2A 4V2UA 2FSSA 2J4FA 3ECSA 5JSZA 5KSOA 2XUOA 1N57A 4WZ6A 5CDGA 2HLDD 1ESZA 1WCIA 4BO1A 2CNNA 1L7QA 1TM4E 1JXOA 3B1WA 3RKSA 2JNWA 1XZQA 1Y89A 3ONFA 4N5MA 4C5AA 3RTAA 4G4SO 1IIRA 3TZCA 2VPIA 2ZATA 3B1XA 2FHPA 4QXMA 3UKJA 4IF6A 4A10A 2FMUA 3TD6A 4Z7QB 1EEHA 1N2CE 1XZLA 2GEBA 2QVZX 3DT8A 4YIKA 4YRSA 3KVNA 1EFVB 1C4WA 1J8FA 3KJZA 4GSLA 4JHLA 4MKFA 4RWEA 3WWDA 1R1DA 2R7NA 4UHFA 4DIKA 1VKZA 3K0CC 3U48A 3JQAD 2XQIA 3K09C 1T13A 4KQGA 4TN1A 1TKAA 1MW8X 3AO0B 3OM8A 2ZUCA 2CVOA 1ADGA 1RQNA 2B82A 3DOFA 3N2GB 3OSZA 1SKBA 1ZICA 1DQYA 2MYUA 3R0VA 1VHJA 2A1TS 5EKDA 1G7SA 1AKEA 2V0CA 4R1TA 4HMOA 1G3IA 4MWTA 3U44A 3AT1A 5KI6A 2WG0A 4CIYA 5EQTA 3PFHA 5F3RA 1VYVA 3OWHA 4ITUA 2W4IA 3ZKAA 2A9PA 2H3HA 5F2NA 3DB1A 2FJUA 2ZRAA 3SDBA 3Q9UA 3C6XA 3QIAA 1YVRA 3PNSA 1GV1A 2O48X 4JHXA 1VRVA 1P1JA 2FZVA 3N0TA 1R4MB 4GPIB 1TQ2A 5AHWA 2J87A 1EYZA 3W0LB 5KCZA 3LDUA 5LA6F 4BO7A 4F4JA 5JH7B 1J56A 2EG5A 3WADA 3PLNA 5D87A 2NTNA 1ADFA 2V4ZA 3BWYA 3OJCA 1YDHA 4HR7A 4JNCA 5IM4F 1QB8A 1H6DA 3C3BA 1ADYA 4IZHA 3A8TA 1NBMD 3BIJA 1DQNA 3JR7A 2ZKLA 4R1QA 2HXYA 3RVRA 3BA1A 4NKRA 4DYDA 3EBPA 4ZDIA 4BUZA 4DPMA 8LDHA 2WE8A 3CF2A 3CURA 2APJA 2EHJA 2OR3A 2QTMA 1NX6A 3BMOB 4MV3A 1QGAA 5B37A 3FZGA 2F3PA 3FCUB 1DO2A 3ZBPA 5ERXA 1O9BA 4I14A 3T5DA 3VMMA 4MQFB 4MROA 4BB6A 2I65A 4YMUA 4RTJA 3PRHA 4D7AA 4ME6A 2OO5C 5ULLA 4L08A 4JV5B 1IM2A 2RG7A 3KUKA 2J07A 3CBQA 3RVBA 1PLLA 5K51A 3RCBA 2F43A 2GPAA 5BW4A 4E51A 2IS6A 4NNJA 1PNVA 3IBTA 4TL6A 4A9AA 2IZZA 1C4KA 2LE0A 2WF8A 4ZEOA 5D5PA 5EY5B 3S5UA 2XQVA 4U7FA 1JKXA 1IEWA 4ZO7A 3T7RA 2O8EB 3NAQA 2EL7A 3TK1A 5ICEA 4PCVA 2GFQA 4XH9B 4R2MA 1G9SA 1SD2A 3LBFA 4X1KA 1JHAA 1XXHB 3SR0A 3V7NA 4AG5A 4GKJB 4EW6A 4S0XA 3KJFA 4LX8A 2VNSA 3BREA 4KB5A 2FGKA 3K0CA 3PXCX 3K09A 3LW8A 1PQPA 4IKEA 1XC7A 1PFQA 4IFTA 1HF3A 1BWSA 2JA1A 5E3HA 3B3AA 5BQ5A 2H31A 1GGVA 4V0RA 4AY4A 1PNQA 2JVIA 2DBVO 1PJRA 2G1JA 1ONPA 3M9LA 3ILXA 4FOTA 4GDMA 1THZA 2OHVA 3DPSA 4MKZA 1V11A 3S1SA 2FJ0A 1PDWA 4OXQA 2V6JA 3LQ4A 3LNTA 4YIHA 1QIEA 2F7SA 1E9DA 4BFTA 1QYVA 4Z54A 3AHDA 4TQ9A 3DUWA 4P82A 4ZOEA 5LVAA 3T5PA 2DZDA 1EZ1A 3RR2A 3SLRA 2MSDB 2WB4A 5GV7A 3T7DA 5I7SA 1D4ZA 2V6BA 4LRXA 2O14A 4BP9A 4Q9IA 2RHHA 1BHQ1 2GAOA 4ZT3A 4TLMB 3MB8A 2C9CA 3SMVA 4ZOCA 4WVFA 1DCTA 4TUYB 1VRWA 4DG5A 4WGFA 3H2BA 4P5DA 4ESHA 4KACA 2PXHA 2YXLA 2JLVA 1G4AE 5KTKA 4FHCA 1WXGA 5ER6A 4DSUA 4BATA 1VYTA 5J9FA 3WLHA 4FB5A 1Q84A 1XZIA 3FWHA 3LV8A 1GZ3A 3LZCA 5LJIA 2C4HA 2QXUA 1EGHA 1FFCA 1RQLA 3P2OA 2XOKA 4BQQA 4FFBB 4L07A 4ZMSA 2EX1A 2DUMA 5ELXA 2I2CA 1FLDA 2XRYA 3EWIA 1YI1A 2XZLA 2OLKA 3EAGA 4Y8VA 1Q77A 1QH9A 2A1IA 2OO5A 2RBGA 3SZGA 4E6PA 4E5KA 5ES4B 2X6RA 1XJ0A 1O89A 2P3QA 2XTZA 3FXAA 4EHHA 2ERCA 2H63A 3R3VA 3NHLA 1JSXA 3ZW7A 1C1XB 2FSPA 2H5JA 3IALA 3QU7A 4O0LA 5ENZA 5ERGB 2WMNB 4D26A 1S2DA 4LZOA 4ZCSA 1II0A 3WL3A 2Y1FA 3IRVA 3Q0IA 3GP5A 4BMCA 1IJFA 4CQNA 2W8ZA 5T6MA 2Z5FA 5U9CA 3I6BA 1CFZA 5CTJA 3GFRA 2FG5A 2FPIB 1NUAA 4L6AA 5AVZA 1E3EA 2Q9BA 1HOTA 4A8PA 1X42A 1P31A 3OZWA 1OLSB 2QWXA 1DIHA 3K0KA 2JHGA 4I9HA 2XCQA 4X7MA 3Q98A 3UWMA 2WFMA 4D02A 2QM0A 1E1YA 3R20A 3X1WA 1J9ZA 4B2PA 1V7CA 1WX1A 2C84A 1UMKA 4LJKA 4LWZA 3KSBC 2ADMA 3KR0A 3VKFA 1PIWA 2QN2A 3KWLA 4IHAA 1JGTA 2VSNA 3LLUA 3C4JA 4RVSA 1OIVA 2EW8A 4KGZA 5BQOA 1BROA 4EATA 1Q0SA 1R16A 5BWOA 3FZYA 1EM8B 2RHWA 5A3SA 1J22A 2FWIA 1Q16A 2XUFA 4FILA 3A70A 1VG0B 4C7BA 4X6XA 1TQ8A 2P6NA 1KVUA 2Q9AA 3RC3A 3SYLA 4EUNA 4M0MA 4RXUA 3B3GA 3QFFA 1D8AA 4RENA 3WYNA 4LOLA 1PG2A 1Q0QA 2I78A 4F38A 3OKAA 4OHMA 5H9VA 5ALKA 4AP9A 5DYIA 1Z6YA 2CLCX 3JCZA 3VRHA 1WY7A 4Z4FA 2Z3ZA 4QSHA 1DRWA 3UB4A 2DSNA 3EEFA 1R0ZA 4M60A 4V3BA 3TN7A 1ESCA 2ALJA 2IPLA 4MQMA 4IG9A 1GRVA 3PRYA 5EUMA 5BW5A 1JH9A 3OCUA 1MXFA 1QLWA 2AOTB 3KZOA 4FHEA 1FXWA 1J0AA 1J25A 3FKSA 2ZRDA 4J1NA 4O1MA 1U0GA 2C07A 3EW7A 4WKOA 1EDBA 1P1HA 2O1EA 3BAFA 2DPLA 3F8TA 4OMUA 1SCBA 4EJMA 3G2MA 3OC0A 5EXPA 4A4DA 4QFMA 3UFXB 3NTLA 2EIXA 5IARA 2YMQA 1TM2A 2HH9A 3AFIA 3ANLA 4S24A 1BVHA 3EDRA 3PBKA 2PL9A 4M36A 3NVAA 2AEJA 3OFVA 5C3UA 3KEFA 1VM6A 1TEVA 2FLVA 2V4MA 1ZR4A 1H9BA 1NBME 2XE7A 1ZVQA 4RFVA 4TSFD 4UCFA 1NLYA 1KO7A 1UDBA 2GCNA 2REOA 2WR8A 3SZOA 2WKSA 2EW2A 4DDMA 3ACCA 3ZE1B 3GLIB 2CMHA 2FPGB 4DXAA 2QSJA 2Y1EA 3T9DA 2FWRA 3HR8A 4JBIA 1S3SA 1XLTC 1D7OA 4XWGA 4MQUA 1SHTX 4DQLA 3FUCA 3WV5A 1HT1E 3EUEA 3RSOA 4DXDA 3KE8A 2C0CA 3DF9A 1XIVA 1IQRA 2PDAA 4BRUA 1U2EA 3GFBA 4M37A 5DM60 1I24A 3CQ9A 4G37A 4XCVA 2HAEA 3JD3A 1RYBA 4HX5A 1AZLA 3FYTA 4D46A 3L4JA 2JLYA 4P33A 5DYGA 4YRCA 1MHTA 3GJ4A 2Q2NA 2JAPA 4OUDB 2WLSA 4QD3A 4IWYA 2WV7A 2ZQ5A 3RS9A 3HVHA 1NFQA 1B6SA 1VCHA 3NWEA 1DWOA 1G42A 1JF8A 2ZYUX 2H1SA 4JT8A 5EN4A 3ZWVA 2R68A 3PHIA 1X0XA 4EUFA 3NORA 5E1DA 1VSTA 4OGKA 5DHAA 1U0OC 2ET6A 4I8XA 1H4VB 4Z9AA 4DKJA 5J59A 2H2DA 3BS4A 1YONA 4JR2A 4KQCA 5DEIA 2GZ3A 4J29A 3NCTA 3IUSA 5JJ5A 4G8DA 3K0FB 1VE9A 1UKVY 4KDRA 1Y9EA 4RZUA 1MAHA 2GDZA 1HLPA 3DD5A 4KI7A 5FPPA 4AJ1A 1U8TA 1A9TA 3IRUA 3H6HA 3ADBA 4KV7A 1J70A 3F4LA 4FR2A 2VC2B 1LVHA 1XQWA 2TECE 2YVAA 4HDNA 1SVLA 1GRRA 4CKWA 3PNBA 2Z4SA 1MIOB 4HFNA 2YYZA 2BSAA 1Q17A 3IUQA 1YIAA 4PSUA 1TMKA 4DWOA 2E6UX 2ECQA 4B0OA 5CFQA 1KEPA 1U4SA 2QXTA 3DYVA 2OQVA 5LUAA 4EQZA 3QFHA 1IRXA 1KSHA 1Y7TA 2H4JA 3N86A 4QDUA 1W5FA 2DWUA 5FV7A 1OGJA 3EIQA 5TJ9A 3UQZA 2CLIB 1NX9A 4XDHA 3WZLA 3ZXXA 5JDCA 5G0WA 1LV8A 2H1RA 3ZS9A 2CYAA 4Q9JA 2IOFA 3RANA 2P8JA 3GWZA 3MM4A 2FWNA 1T3HA 2BFWA 3Q10A 4B32A 4CM4A 4EQ6A 3GJ5A 4XIIA 4E22A 5D1HA 1B1AA 2XADA 3E5MA 2EFHB 2R3SA 4DVJA 3RUIA 2D6FA 4OIFA 1XTIA 3TOZA 4JMLA 4BC1A 1ST2A 3OQIA 3IIKA 3E4CA 4A16A 4BLPA 3VU9B 1JLSA 3EIUA 4OIMA 2BC9A 3BK7A 1Y98A 3OHMA 3UWPA 4CM1A 3L8DA 2QZPA 5FRDA 1ENYA 4AJJA 4ECEA 5I7EA 5K0SA 5JNUA 3CGGA 3QVLA 5L9AA 1J2TA 3I5UA 1MAAA 5DCLA 1AD2A 1OLUB 1OCEA 3JX9A 3D3EA 1XLTA 4GG1A 4M55A 5YASA 2ISQA 1IATA 1E2HA 1FDRA 3V00A 4B3SB 4QHYA 2V7GA 1QIKA 2NPOA 5JBNA 4UU1A 5U4XA 4LCJA 5CR9A 3KLPX 2QMOA 3QX9A 2CV1A 4TVBA 1UBHS 3CF4G 4F56A 5BYBA 5A6SB 3QWAA 1C9NA 4B46A 4B8WA 3EPJA 1MVLA 3AVXA 3N7UA 5TX7A 1TJ4A 2YJNA 1Z2AA 2ZVPX 2Q46A 2YX1A 1FRQA 4CDMA 4QUDA 4CPDA 2V1UA 3DNFA 4DC9A 5B5SA 5FNVB 3PICA 1YC5A 2PT9A 1OW3B 5C32A 3WLRA 2ZRBA 2NMVA 1XD2A 4R9RA 4XIGS 2FZ5A 3IHKA 4FQ7A 4C3UA 1ND5A 2HUPA 5DBEX 1QDUA 3X3HA 4Q9AA 4N6OA 1I2AA 4YUXA 1NN5A 2PLAA 4ZTZB 1ZI8A 1Y8QB 2QLBA 5IXSA 1CUVA 2AEFA 3A1VA 3C3DA 3BN3A 4KO1S 9LDBA 5B55A 4O8ZA 5K05A 3CZAA 2XSZA 1QG6A 2Q4BA 3VMFA 5ESRA 1P2FA 2UZ4A 3D5EA 3A6PC 1Q0LA 1ZMTA 2HGSA 4HJRA 3ORSA 3JRWA 2I0FA 2FAXA 1Y3BE 1WZEA 2OB2A 4UBLA 3BXHA 3URKA 4C6TB 5AT1A 1K8YB 3EZXA 4JH0A 4IJ5A 2ZP1A 5BNIA 4GYKA 5BWLA 4JXKA 1FFAA 1XZEA 1QMGA 2WTNA 2X1LA 4NNOA 4Z7JA 2CZQA 1HK7A 4HFMA 3WKBA 3OIGA 1FP2A 5CXUA 5EE3A 4KN9S 1L8QA 3FWKA 1JNYA 3ODPA 4ZAFA 3ZNOA 4DA8A 3ASYA 1I9GA 4NV1A 1E5TA 4LNAA 1GAXA 1FTYA 1XTKA 3MUFA 1JQEA 5KDDA 3QRWA 3VJMA 1EJ6A 4DN6A 2BL4A 1VL5A 8OHMA 4Z53A 3IOBA 3H4VA 4B79A 4EGAA 1U2SA 3QNUA 5KNBA 3SC2A 3R5HA 1HDGO 1D6JA 3KYJB 2YXEA 3E05A 4A6DA 1G5IA 1Z06A 1P3Y1 1DV2A 1GUYA 4D0RA 2B8NA 3CZRA 4GXRA 5HIMA 1OWOA 1VA5A 2XIQA 4M0UA 1ZNZA 5IAOA 3THWB 1RDFA 3DQQA 2X5XA 1KBZA 1ZY2A 2H0RA 2VT3A 1Q2UA 4Q39A 3HJHA 4ZU6X 3DEZA 3TOCA 2RI0A 4MTCA 1I4OA 2CL0X 3GF4A 4QLBA 1BZYA 2J3IA 5AJTA 4E88A 3DMNA 3MJ4A 4KMMA 1NW7A 3DMDA 4LFCB 3M89A 2ZVQX 4EUKA 2PJRA 2F8LA 1K7EB 4HAZA 1GGKA 5AKEA 3LQ2A 3TIXB 3MT0A 1X7YB 4IMPA 3EGOA 3PYMA 1CQXA 1EFCA 1Y33E 1A4IA 3DV0A 3FKQA 4NCXA 2QP9X 4NOJA 4RHYA 1I7SB 5D8DA 1TAGA 3ESRA 1RIFA 3O8LA 2X2OA 4CM9A 3A26A 5ILGA 4GE3A 2VUHB 1U1DA 2D5AA 1XKXA 3AHIA 3HCEA 5KTYA 3D4LA 3UHFA 4EG8A 3HI4A 2EKQA 3ZZUA 4F4HA 4BQNA 2GVNA 2IPOA 1I2ZA 3R0IA 4XX0B 3EDMA 3PHBE 5L3VA 5IT9A 4B7ZA 1NQUA 4ISCA 2N3ZA 1N36B 1CX9B 2D1QA 2RCNA 3FVRA 4JFRA 3JAKA 4BBPA 3MCVA 1TEZA 2ATCA 4RM3A 3OCYA 1NQWA 2QZZA 1CNEA 4OVKA 4R1LA 1MO3A 2ACVA 4TL7A 2FLKA 4Y2HA 4CQMB 3LUHA 4D0GA 3ZZTA 1IUPA 3AERA 4Q4JB 1R74A 5KQGA 2GBIA 1SEVA 3AUYA 1V6CA 3PQ4A 5JJBA 1NRWA 4Q3NA 4RAQA 3EXFA 4AWXA 1YS2X 3IBYA 3H8WA 3GFVA 2FMKA 1W48A 3JTMA 3OMXA 3S2UA 2QTAA 1S02A 4EH1A 5AW4A 4K9LA 2C61A 4N0EA 2JEOA 4P86A 3ADDA 1X9IA 2WPDA 4BU1A 1ZX1A 1EUYA 1QTQA 2C4TA 1HQDA 1GQYA 4CIVA 5A1TA 4D4HA 5IJ0A 1HDXA 2QAGB 3CMMA 3N5KA 3F1KA 5ELMA 3D8NA 3KYDB 5ANRB 5GINE 1HXHA 5FR2A 1BS2A 1SBHA 1ST3A 1WULS 3RE1A 2XBLA 1D2HA 1ZFNA 3QTLA 4JGIA 3FI9A 3QKRA 4F3CA 3I53A 4WJZA 5IZCC 4MR7B 4TLLB 1FA9A 4D92A 1QQ7A 2PH7A 1AQ6A 3GEMA 1Q95A 4UZFA 2O2GA 2C3OA 4IKOA 2KWIA 1E1RA 3VR1A 4BE9A 1L7DA 1JLHA 1H1DA 2EAUA 5DF1A 1HKUA 2EEPA 4JMPA 1IY2A 5F2EA 4RD0A 4ZT4A 1KMHB 3AR4A 5FOSA 4BNUA 2PSHA 4K6KA 4N3NA 3WBKA 2HBRA 2CXNA 3DS8A 4RMNA 5TE9A 3RIGA 3C1UA 1V7QA 1XT6A 4MI1A 2NZ2A 4CM6A 2NQTA 3OHPA 4ID9A 3ECCA 4LVCA 1ZCJA 1Q2XA 4FMCF 2R4TA 2FE1A 4YRPA 3TKAA 2PT5A 4EECA 4F2PA 4EY8A 4MDFA 2P5TB 1N2XA 1RI3A 2G06A 2Q0QA 2GAFA 2DHCA 3EIOA 4XUCA 1O94D 1XHLA 2AUNA 1O87A 3HGMA 3HJNA 2GMWA 2FV8A 1GVNB 2FYTA 2PZEA 2ZDGA 1SXJC 1FDWA 3E27A 3ITEA 4JX9A 3UN1A 3OC6A 4K05A 4C43A 3J80A 3ZKWA 1ID8A 3PYXA 4CLXA 1IVNA 2NSYA 3V3KA 4PQGA 2ZIVB 4AY2A 5J23A 3OPQA 1FP6A 2EHDA 3JQ6A 1AMOA 4F4FA 4PLTA 2UVQA 4JL6A 1NJGA 2EIHA 4Y2YA 1DAFA 4AN1A 3C1TA 4OB7A 1JN0A 1JZQA 3GEHA 2WA2A 1WXDA 1C3OA 1ZUNA 1G2IA 1ZISA 3ZHRA 1PL0A 1BRMA 1QC5B 4E11A 5LXTB 3F4KA 2WQZA 2HADA 2XUGA 3KBBA 2Q1TA 1C1DA 3PP8A 4P4UA 2GF2A 3LBHA 4ZOLF 2Q5EA 4I0WB 1SJ9A 1E7RA 3GBVA 4QPNA 2Y77A 1WM1A 2QUJA 3KJHA 4W1QA 1WLSA 5G1PA 3S8MA 1GN8A 1VDMA 1V7ZA 3HKEB 4PHGA 2B6NA 3VO2A 3RS5A 4Z9XA 4TZ0A 2BHRA 2G08A 2XMCA 4KG7A 1M7GA 3EGDA 1FSZA 1EVLA 1XCPA 3LKDA 2NIPA 3QMMA 4QVGA 1QVWA 1W1WA 1EK6A 5CDTA 2ZJFA 4BQRA 3W1WA 1ZJZA 1QPZA 2Y4OA 4NJEA 4ZCPA 3UV7A 4IQ0A 5KEIA 3KETA 2BFAA 3DFUA 4O25A 1THMA 4Z1MA 1H8EA 4URUR 3NFYA 3Q1KA 4QFCA 1U0NA 1DQSA 1GP2A 3ZY4A 4MV9A 4G1UC 5KDLA 1I3CA 1VI5A 3L6BA 1YH3A 1OU4A 3TI9A 4CLDA 5IZCA 3ZK7A 1NR7A 1EGQA 4P80A 4ZHQF 2PX4A 1SXQA 1ZBDA 5DI3B 3TQQA 5C5EA 4NC9A 2YHAA 5CIYA 1K7YA 1NR5A 4RGYA 1GQOA 2EJBA 5ERYA 4EHBA 4OSEA 3TUJC 4I4IA 1PEKE 3KT0A 2HMWA 2XMBA 4DA9A 4PVDA 5KQLA 2AQHA 1BDBA 1L5VA 1NP3A 2P9YA 1PEAA 3AEKA 3LUDA 3GJRA 5G02A 4L78A 4AWAA 4YRBA 1E3QA 1NIJA 2V5VA 5FB3A 1E6EA 5T57A 2DLCX 3MJHA 3OJWA 5DT2A 1UBFA 2QN1A 2QAJA 2G0NA 1DUVG 2HF2A 3CRW1 3ONDA 5CAEA 1KJQA 3ZJ5A 4AVYA 5F98A 5JXHA 4E5SA 1DFHA 2UVPA 2W2LA 5C1OA 5F3WB 3BMCB 2G70A 1A7AA 2AC7A 4WCFB 2YS7A 4JFAA 1NU6A 1PX2A 2F9FA 2XVXA 3AQIA 3LA8A 2CVPA 4LW8A 4DLVA 2FXIA 2BZ0A 5E4JA 3KJEA 1B2RA 1YQQA 4TZTA 2I54A 3AU8A 2JKVA 4R05A 4EAQA 5FV4A 2HDWA 3HK2A 2X41A 5C81A 1GZSA 3VR3D 4DA6A 3PC2A 4G5XA 3ZR4B 2UUPA 1J8VA 1BMFA 2F6RA 3VZPA 5LU8A 1U8UA 2AWNA 2ZB7A 3LFTA 4RTSA 2PSJA 1U5AA 2VQ6A 1CJTC 1H2RS 3KAKA 4E6EA 1R5BA 4EW2A 1X1SA 1BKDR 4B2YA 4QT4A 1XJWA 3OE4A 3THXA 2BFDB 2MYPA 2PV0A 1W59A 1KDYA 3T54A 4C29A 4PLVA 4LGVA 2F1KA 2QS9A 3RVLA 3FYUB 1ODLA 2EZUA 1W9HA 1A2BA 3VC3A 1J20A 3CX3A 4R81A 2W6IA 5DM70 2OZPA 4YCDA 1BJKA 3AB8A 1OI3A 4FEEA 4LWQA 4OI4A 4W5RA 2F9MA 3WGYA 4NQZA 3AL0C 2R4UA 3Q9SA 5TEWA 3TTTA 3PI6A 4E2FA 1AUPA 3EGEA 5KQMA 2Z5GA 3B7WA 2ZKIA 1LQTA 3ZK8A 4ZC8A 3MJDA 3VX3A 2CFSA 4CMIA 3BJMA 5CVEA 3G2NA 3I37X 5C4MA 2J6BA 1S4QA 3MTQA 4G09A 3OLCX 1WAMA 4B85A 4DM7A 3R4CA 5B30A 5IULC 1XAHA 4WLUA 5BT8A 1TT7A 4R40A 1A2QA 1M1NB 1XRMA 1KGDA 1TQHA 4LVUA 4LWOA 1G20E 3UK7A 4B7CA 1Z7GA 4NENA 3BMNB 5D6NA 4D74A 1JG6A 3C45A 5ITSA 3CVUA 4GPZA 3TXXA 3DZKA 4YRRA 4RDIA 3JQGB 1JV2B 2HXSA 4OYYA 4ETIA 2PRYA 1N0IA 2I4NA 3AETB 3I2GA 1YULA 2P68A 1MV8A 4N65A 5T7BA 1R66A 4IF4A 1DJLA 2QU8A 4XVHA 3P52A 1C7EA 2XVZA 3L8ZA 2AOVA 3STUA 4BWYA 2PUBA 1VPEA 1U0EA 3VKVA 3R8FA 4I9NA 5AESA 5TIIA 2RIRA 2Z8YA 2ZIUB 2GN4A 3ZEIA 2ORWA 4ZCIA 3L6CA 3VHQA 5H68A 2OV1A 4UXHA 2EBWA 2QJFA 4S1VA 5EIBC 4U7HA 5JQGF 5DBFA 3SDSA 1UBNA 5C0OE 1L4NA 1VL0A 2IKSA 5A5GA 1N2EA 2ES4A 1ZNXA 1RXYA 3NRJA 2E4WA 1IONA 4NBLA 2ZYHA 8GPBA 4JJ6A 2AX4A 2AE2A 2YYYA 1AA6A 1F5NA 3RADC 4LXGA 1EHIA 2NXEA 1N7GA 1OXXK 2HDOA 1Z6XA 1DG1G 4HGPA 4QUHA 1JR2A 5TGTA 1ZUHA 3H87A 3ORRA 4RL4A 5DU2A 1BS9A 4TKUB 4F8EA 5B3JC 3ZD6A 1OIWA 2VJMB 3LCVB 1FDVA 3NS7A 4KXMA 2ZSUA 3ETJA 4AMUA 3GRZA 1FJ2A 1TM5E 3CUUA 1BXRA 1FLAA 3RRFA 4X62B 1XNHA 3BE8A 4BZPA 4KYTA 4XIYA 4J3NA 2UUAB 1DIAA 3GQBA 5EJ8A 1T0IA 2WKWA 3A27A 1L7AA 3GMDA 3B1JA 4DLKA 2IX3A 1J8YF 3QVGB 5TXGA 3U17A 1PUIA 2HO5A 1G64A 4UAVA 1FTNA 4BEJA 5BUQA 1J0XO 1IEXA 4RK1A 5HWSA 1JDBB 1PR0A 2VBCA 4KQJA 3GL9A 4LC0A 2Z1MA 4DSNA 1HE2A 4DW8A 5LNK1 5HRUA 4X9XA 4UOQA 4XQCA 4URHA 4A2WA 2B1RA 4KQXA 4L0QA 1TVKA 5JTTA 3KL4A 4NS4A 4F1KA 2I8AA 2ID8A 2QKYA 3IXLA 1U94A 2YVLA 3W7AA 4WBSA 5BSMA 4C03A 2P5UA 3MCUA 4LOIA 1G8YA 4A7PA 3G5TA 1TJNA 3EY9A 5J2TB 1EPUA 3C5VA 5K0TA 1FS6A 3QUQA 1RJWA 1NU8A 2Q8NA 4PGGA 3W9YA 1DOHA 2AYYA 3O5AA 3LYUA 3W06A 2PKYX 1T3ZA 1M5UA 5CFPA 3GLQA 3PVSA 1CNMA 1E3DA 2CD9A 1GU1A 3KWJA 3V8VA 1Y9AA 5HFNA 3R9KA 4EJ2A 3T1QA 4B4OA 2DY0A 3BJZA 1YZKA 2FN4A 1K4KA 4L5BA 5D2CA 1JJFA 4AMVA 3A36A 2ZRNA 3KEMA 2Y4NA 3MW8A 1NRJB 4TXHA 1E5XA 5IK2A 4FGUA 3OA2A 5TMBA 1RFLA 2PVPA 4OO3A 4YX9A 4MEJA 3T4EA 4K88A 2JFNA 1TEHA 2O23A 3PNMA 3OQBA 3NWJA 5DSZA 5ALPA 4YXWD 2CN1A 2B7CA 1H85A 2BKVA 2HJGA 1ZMOA 2WHPB 2TRSB 1VQ1A 3LQKA 1D9XA 2WVAA 2AXEA 4ND4A 1E4EB 4U7JA 3TEMA 5AVQA 5L3SA 4TS4A 1QZ3A 4XJVA 1HDCA 1KZ1A 1NFFA 2BGKA 2GM3A 2VDKB 2WF9A 3AR8A 2XMDA 1E20A 5EHGA 1ZQ9A 4AY3A 4C04A 1LLCA 1MA3A 2VNIA 2E48A 4JB8A 1C9MA 1DDGA 2DR3A 2XR1A 3GLHA 3L8FA 3M4XA 1JKJB 4RPGA 2ZM5A 2WF6A 3DM9B 2D2XA 2QZJA 4YCSA 1MZPA 4S2UA 2FCRA 4Z8YA 3ZYZA 5DDIP 3IV6A 2C2KA 1M2WA 4HB3A 3IPRA 1RC8A 1AXRA 2JFWA 4RA6B 1BH6A 1X1DA 4JYMA 3CX4A 4QNMA 1WP4A 1C0IA 2JBWA 3NNNA 1IM8A 1Y34E 1OKKD 3SX2A 3EB9A 2V7XA 1VBNA 3V4SA 5MDHA 4YFYA 3MLBA 4U2GA 1CP3A 4HWGA 3UMBA 3IUEA 4MHSA 1W36D 3BIXA 2QYSA 3DH0A 4FGSA 2V7QA 4HNQA 4XAQA 4R8VA 3DLIA 4XYEA 5HQ3A 1SOMA 1VL2A 3OY7A 1J8DA 1X74A 2YRFA 1RTKA 3IAM1 4LHEA 4OQMA 3IURA 4W1PA 1WF6A 3SN6A 3W5UA 1VJ1A 2AD1A 2PY6A 3N2GA 4C3ZA 5TS3A 3A1TA 4TRRA 1NUPA 5KYXA 1YF3A 3NHWA 2ZJYA 4KR3A 2CL6X 3E9RA 2KQUA 3L41A 4RD2A 2HK6A 3GMSA 4I5FA 1MXHA 4IZIA 3K1YA 1L7XA 3RFTA 4ES6A 1CR0A 3UC9A 1L8XA 3R5TA 3TJRA 5JXJA 1CJSA 5H70A 3FNRA 4C4TA 2IGBA 1FW6A 3AKEA 4L7VA 3M82A 1FLNA 4E5VA 1HI9A 4GMKA 2CB0A 5HKOA 1AGYA 5EIXA 2F8SA 1C14A 2ETVA 2NAFA 4V0MA 5AICA 2WAOA 2JD0A 1DELA 3C14C 2X5JO 3ESBA 3SBEA 3VKWA 3WB9A 1QOPB 3R3YA 2QAIA 3ZV3A 5H1YA 3EN0A 5JH7A 1FPQA 2AXPA 2O3QA 1P44A 2O07A 2RGEA 3BGVA 1QAOA 1X9GA 3L0CA 1LY1A 3IQEA 3P9YA 4OHPA 1J2YA 2L2QA 1D1SA 4XI9A 3UW1A 2NXCA 4S0ZA 2IYVA 2I7CA 4BLTA 1CRQA 5FOXA 5DLYA 2BLNA 3RU9A 5K45A 1V8FA 2WMDA 1DXYA 5KTRA 5CVCA 1XVTA 5FLXA 4NFHA 4MQFA 1COWA 4B0PA 2ODTX 2QG4A 3DWGA 3DXFA 3SJBA 3C16C 2I7DA 4J03A 3D54D 4C4RA 3HA3A 4ICIA 4NU6A 4KX5A 4J1QA 4YRLA 2IIQA 3OCJA 3PRKE 5TS2A 2WHRA 1M6VB 1N0WA 3PNKA 4D5GA 5I7WA 3ZV6A 1BYIA 2R86A 3L49A 4TUYF 3DZCA 5JPCA 5L53A 3GARA 4BNJA 5MFZA 3B70A 3HDGA 5D3ZA 3RUCA 2R7AA 4S2EA 3W2IA 2WM9B 1K0FA 4G0XA 3MRSA 4DC1A 1L7NA 2QY6A 2CDBA 1GPMA 1ZDMA 3ZU5A 2BM9A 2IHBA 4CV3A 2VJCA 1RWVA 5BYKA 1XXHA 4CHGA 1UPCA 1ORTA 3EULA 1THTA 4COOA 1NSFA 4Y30A 5I8ZA 2IYQA 5AWFC 1T9AA 3L40A 3Q5GA 4GI7A 2Z6UA 3WNDA 4CEIB 2R25B 1G4UR 1K7XB 2AMFA 3G2PA 3H7IA 3IQXA 3QPWA 3E9DA 4P4TA 3KELA 3HKCB 2DXIA 1T1GA 1V8OA 4JQSA 4Z0TA 2EU8A 1GARA 1DS6A 5FBLB 2SKDA 2ZTMA 4DANA 4DIEA 4FD2A 4GDFA 1UKCA 2EYQA 3KXIA 4TLCA 1Z25A 1CSEE 3UXHA 1A3CA 3NXSA 1LFAA 3OZRA 4AY5A 5SZIA 1NG9A 3D3KA 1JDZA 4UW9A 3SX0A 2H52A 4LF4B 5ENVA 2VK8A 2IEAA 1WSAA 3R9WA 4V0NA 5T64A 2A57A 4PN3A 4FWIB 1PUXA 3W5HA 1BFUA 4G0OA 5JFOA 3CPHA 1E7MA 3TPFA 4BNWA 1RCUA 4AURA 3QVTA 3TMYA 3FYCA 5FO1A 1EX7A 4FINA 3R0XA 1RNLA 2YHBA 3F6PA 4BCCA 4BV9A 1DKUA 3FYSA 2V1XA 1J21A 2ECKA 1FXUA 1W46A 2QMUA 4IJKA 4E1VA 5CBPA 4LNUA 4L02A 4RQTA 3HRHA 1FRFS 3EOZA 3FPHA 3TIIA 1CJBA 3FVQA 3ZH9B 1Z74A 4FE4A 4YMHA 3RM3A 2B3DA 1YJ5A 3CV3A 3TOXA 3EFOA 2ZSBA 2Z57A 2CNWD 1PK8A 2FEKA 3KM0A 3TLBA 1OWMA 4PX5A 1CIJA 3PHCA 2PV7A 3R5SA 2PXAA 3M49A 4OXIA 1MB9A 2VHWA 1Y1PA 1FU4A 4P3XA 1A95A 2QE6A 1JKIA 3KUXA 1BQ3A 4WOCA 3M4NA 3E61A 2PFGA 4YCAA 2A84A 4C6RA 5C8YF 3IO3A 4WLFA 3ND6A 4QQKA 2YJTD 3PF9A 4O4IF 2PSSA 4J0QA 4NMLA 2W6NA 4XB1A 2ISSD 4TQGA 3IV7A 4RPHA 2GETA 1YZNA 4FBMA 5EMKA 3MXTA 3T3PB 2P9HA 4K9RA 4PPYA 4BKQA 4TV8A 4ZCTA 2FTKE 3D9QX 3N2KB 3T61A 3Q7IA 4YV7A 4EP1A 4TZ6A 4EG5A 5GJBA 4DEVA 3RQIA 5LKAA 1BJTA 2VJLA 3OZXA 4ND7A 1OLSA 5A71A 1QKJA 1KIMA 3PQ5A 1L6IA 4Q66C 2VXYA 2DF8A 3B38A 3MWEB 4BMNA 1EJ2A 3PA6A 4HUQA 3MELA 4RABA 4BYMA 3GG2A 4XJTA 3CPSA 4NFLA 2A86A 1H94A 1ZH2A 4YN3A 1DKRA 4I6JA 5B1EA 3QELB 3V6LA 4AD8A 4CIXA 3GMIA 4QGBA 4ROTA 2HNAA 3S8YA 3FDXA 4ADSG 2XYVA 3COWA 1XA0A 3QWIA 4O4JA 3W7VA 1CDDA 1YZVA 3IVXA 3NOVA 3UA3A 4C7VA 4LZPA 3T99A 3HSSA 3VSBA 3DHNA 3GNLA 2MSNA 2ZANA 2NTJA 1FFBA 4J9VA 1ODIA 4UAUA 4DA0A 5LWQA 1Y3AA 2H1HA 3QPVA 3Q12A 1BOFA 2X42A 2G4CA 3MQ2A 3O21A 1GPWB 2AN3A 2IELA 5FUQA 1CC1S 3K1AB 2I9KA 5C2JB 2HW8A 5IZ4A 1LS1A 1SUFA 1F2UA 2QRGA 4IDNA 1YVPA 3SYRA 5K0LA 2IPMA 5ED4A 1CUXA 4GL4A 4C0JA 5IVPA 5D3MA 3U60B 3FIJA 3NYRA 1PJZA 4BNXA 3TLMA 2W6ZA 3A1CA 2W6JA 3H3XA 3ZIDA 4QXPA 1K86A 2OHHA 4RMHA 2CSXA 4H3HB 2QRKA 2AOTA 2WOOA 1VB3A 2YWBA 3W6ZA 5JWHA 3M1LA 1OXKB 1S7CA 3ORHA 3LL4A 1WMFA 3H05A 3ZI4A 2NO9A 2XQFA 3LBNA 4JL5A 1IPFA 3G68A 3K16A 4KE8A 5JSHA 4EYKA 3WGIA 3DHVA 4L4UA 4RGVA 3FSRA 1WVGA 3LRXA 4UMEA 1VJ0A 4LSWA 1SULA 4J7UA 3RS4A 3C3AA 5HKBA 3RYCB 4B4UA 5B4VA 3VNUA 1GQQA 3B8HA 4EENA 5K03A 1NOJA 2WUGA 3VHLB 3H1FA 3D6JA 3UY4A 1Z36A 4XA8A 4RADA 3KSZO 1ORHA 4U2DA 3IUBA 2CUNA 2VHXA 1V6AA 1B00A 1NTOA 1GFWA 1XRQA 1CT9A 1P5ZB 2JI6A 3A28A 3K5IA 3UKDA 4MYDA 3AONB 1M8JA 3TECE 1YRYE 1D7AA 3W5VA 1UPFA 1CZUA 2O50A 2Q3JA 1N9GB 4D9FA 2JJ1A 2ZB8A 4FJ1A 1OQAA 1UOEA 4LOJA 1JHMA 2I22A 1XFDA 5EJ9A 1SK9A 1G3RA 3I0NA 1IRIA 4HGRA 4D4IA 1VOTA 2GN9A 1BU8A 2NAPA 4HWOA 4XSGA 2B4YA 2C5EA 3B78A 4I4TF 1E2JA 4PHCA 2IA5A 4EJ6A 5JI3E 3THRA 1P9WA 1XK6A 4N82A 2VHYA 2AS0A 1C7FA 2E7ZA 4FZRA 4UMDA 2YZMA 1QQBA 4ZZ3A 3H11A 2VKTA 3HR4A 4HAXA 5L3QA 1RQ7A 3SIXA 3EVNA 3TOVA 2DHRA 1E79A 2AC4A 3NRBA 4KIGA 4PX9A 4R1MA 2Y8EA 2I4RA 3H19A 3I04M 1OAOC 5DM2A 1KK1A 4B34A 3DKPA 1FDTA 1YNOA 4KO2S 4LY9A 4D99A 1Z6GA 1T1IA 1N75A 4L3OA 5FQOA 3O8OB 2FEMA 5AK6A 4ALLA 2UYHA 4IOMA 3UAYA 4BVKA 4DUYB 1NF9A 2HTEA 2K87A 3GJ0A 1UBEA 2IYNA 2PO5A 4Z9BA 3TBHA 1W30A 4B35A 5HW0A 5JW6A 4RIHA 4WK4B 3NHFA 1OBOA 2WQ7A 1P62B 1HWYA 4N3BA 1TYZA 3PGLA 2AXQA 3HADA 1URPA 3IVCA 4QRDA 2W5UA 4Q6WA 5LR6A 1QYWA 3K1TA 4LGCA 4ZYWA 3QLTA 4BNHA 2VAMA 1O6BA 3ML1A 4H16A 4D9CA 4MV5A 2GBGA 4FUQA 5P21A 3NDPA 4AI6A 1XTPA 1DXHA 1H6AA 4GL2A 1C9EA 4DLBA 1MW9X 4PAMA 3CX7A 2OK7A 2BKXA 2ZJ4A 1SO8A 2IHNA 4ML3A 4YYEA 2WD7B 4PU0A 1CR4A 4C4OA 3D4IA 4NDZA 2A67A 5AJWA 2ZAMA 4NG4A 3VYSB 3H16A 1J0DA 4MW5A 1QFJA 1CS0A 4FI3C 2HI0A 5KYUA 1CYEA 1J39A 1CHNA 1P8JA 4JCOA 5JHGB 4YRQA 3IMEA 1SC3A 5HKKD 4WKNA 4DV2B 4NYJQ 1NPDA 3A9VA 4U2FA 4BTVA 1XNGA 3H2GA 4DLXA 4YAKA 4WA8A 1CD5A 4LF8B 2VAVA 3DLAA 2B35A 3CJQA 2VZ9A 1J2EA 3ONWA 2NPFA 1KY2A 5DM4A 3BYZA 1G1AA 3JASA 1UFQA 1MJNA 4OHWA 3GRUA 3QKTA 1XEXA 5EKUA 1DRKA 1W1IA 5AK0A 3VJKA 3X1MA 2HU5A 1C41A 3OPVA 4ALMA 3W2HA 1RJGA 1ADCA 3PGXA 4CKEA 1GZUA 2YMPA 2BHTA 1WNFA 2ZRIA 3AY3A 2WHXA 4DCMA 1BQEA 3N7TA 3FZEA 3QA9A 1ZHFA 3N3BC 1W96A 4C21A 3HUFA 1I1QB 3HEBA 5KWIA 4BLVA 4M8IA 4KDEA 1FTSA 3A3OA 3I1FA 5DTQA 1PWXA 2I6UA 1MTZA 1E3IA 2X8BA 5F5LA 4CM8A 5ESDA 2JGDB 4ZVKA 2FDCA 1UANA 4DLPA 2IH4A 4ARVA 1PZXA 4LRWA 1G21E 4MQEB 2IBTA 2XLCA 3USES 3R5FA 4EI8A 1HO3A 3SYNA 1XZJA 3EDQA 3NGXA 1OAOA 1Y4SA 1IN8A 1JFFB 2GAJA 4L9RA 4BO0A 3KYIB 3PT9A 5F2OA 1KI6A 1Y8QA 4NY1A 1ZJWA 3FCSB 3D6UA 3W5CA 1JW9B 1EUCB 3QU9A 1XDWA 2DBRA 4G1EB 5LDGA 1FF9A 1LDBA 2CMGA 2GN6A 4WZBE 1CRPA 1ZL2A 1XUOA 5CEJA 3VAZA 4E3WA 5CDYA 3JSXA 1ULTA 2X0NA 4PHFA 1W7AA 3DG9A 5BR7A 5JLJA 1UM8A 3T1TA 2H5EA 1PRYA 2WU0A 4H7DA 4RHEA 3G9TA 4YJ2B 5AOBA 1SKYB 5A9SB 2VNKA 4Q4DA 1W5EA 3ZHVA 4BNGA 5E6UB 5M04A 2PX6A 1X8LA 4PONA 4CKCA 2GDJA 1BJRE 3LPNA 2XMSA 3A6JA 4GZ5A 2BLLA 1BWRA 1VMEA 3DLTA 4IDPA 1LJ8A 1Q15A 2DVMA 2ZK7A 3K94A 3L8MA 4CKXA 1XP8A 1LLDA 1H2ZA 4P92A 4ZQHA 5BVGA 1ZNYA 1VPWA 1LEHA 4A1FA 2UZAA 3LCRA 3WISA 2IUYA 2DOKA 4JI0B 3B51X 3EXG2 5CBKA 1HA3A 3L84A 1JQDA 1O2DA 1UM9A 4CI9A 2GAIA 3D43A 3OVMA 1NP6A 3IXMA 4F04A 5BOSB 4GLOA 5GOZA 4AUKA 5CGZA 1XZ8A 4HTFA 1I2CA 4L8GA 4DCVA 4O2BA 4LJ9A 1QO0A 3PLAE 2HEIA 2XA9A 3O4HA 2JFHA 4IIJB 4MJ7A 4P3PA 1WD5A 2HPHA 2VEDA 3GK3A 3LXMA 4ZO8A 3THWA 4G9EA 4DLNA 1HFEL 2G71A 4WXYB 5LQNA 1IC6A 4KLZA 3EVEA 1A0OA 1YJQA 4HPXB 1KZYC 1AC5A 3CT6A 3TNJA 4CWAA 4HLDA 4A36A 3PQCA 3GGPA 4DWWA 3C3MA 1EZZA 1KTVA 1NLMA 2GA8A 1CK4A 1F12A 4NLLA 4C0AC 1TYEB 1T9CA 3CIOA 3TRJA 2CZCA 3DE3X 4WEQA 2IOQA 1X7YA 1CUAA 1F3LA 2IUFA 1VTKA 5AW1A 5JCJA 4R8SA 1OV4A 2DUNA 4TTIA 3NOOA 3Q7QA 1MJGA 5CLGA 4BGIA 2UZ0A 2ZREA 1E5QA 2OL4A 4QELA 4I08A 3TCKA 2NZXA 4KYIB 1U02A 3CWZA 2Q2VA 4IIDA 3ZXIA 4QREA 1L0BA 4OM7A 4R84A 3SQOA 4BJHB 3BICA 2XGJA 4TLAA 1MB0A 3H9GA 1YNSA 3H13A 3PQ2A 3RBZA 3ZGZA 1KIAA 2QZ9A 3LHDA 4Z0NA 1GFZA 5TVKA 3RK0A 4AF7A 2PZKA 2NU6B 3NNSA 3O90A 4KK3A 3ZGVA 3OPNA 2EJVA 2X0KA 3CKMA 3M70A 4M83A 1SBNE 5JU6A 3IMFA 1Z0JA 2PMCA 4LZAA 2WM3A 3N0VA 1QAMA 2REXB 2W8BA 4RJ2A 1MG5A 4FC6A 3QEKA 5FUYA 2ZGVA 2WIJA 3CH6A 5GQSA 3WK7A 5J4KA 4MPDA 1VHWA 3TTYA 2OP1A 3GUUA 1U2GC 4C4YA 3L0IB 2YJGA 1KGSA 4J3FA 3SOZA 1KJWA 3UAZA 4M7WA 4BQOA 3QU5A 3DKKA 4EI7A 1ZJ6A 3COVA 4RS3A 4MW7A 1JXAA 4ZHQB 4W5WA 1V16B 2BKUA 3OSUA 4DSAA 2GCEA 1NYTA 4RSGA 4ZC1A 5GP1A 3AUAA 2CXPA 1S2GA 1ZIDA 2JDIA 2Z8YM 4Y6RA 2WZCA 1WCXA 2QAGA 4BAUA 2ZRHA 1S01A 1KZ6A 2R5WA 1NASA 2O1WA 3AY0A 3TQCA 3LS2A 4F86A 2GXSA 3KD3A 2D00A 1W8IA 3DNMA 2Z2YA 3OM0A 4MUFA 3WRVA 2ZJ1A 4TYWA 5AO9A 4FCCA 3KS9A 4Y0NA 3WGLA 4RX1A 2YY5A 2CHQA 4L2IB 1R9NA 2VBGA 3I83A 1J09A 3JS5A 3GUVA 1U99A 2B5VA 3PVCA 3VSDA 5HZHA 4RDXA 1M83A 1MABA 3LQYA 4CKBA 3HXKA 3UJHA 3RSGA 3B7PA 1PS9A 1Q0HA 1QYCA 3N6VA 3FD8A 1K97A 4ZJUA 3INRA 4TYMA 1TU4A 4HGQA 2IZ6A 4RY9A 3LUKA 4KQ1A 3V2HA 1IZ8A 1R50A 1V1JA 1E64A 1B74A 4MUBA 2CV0A 3FGOA 2H1IA 2VTKA 1EI9A 1EQUA 2VHZA 3WJ1A 4OQXA 3U1BA 3OF2A 4LF5B 3TRHA 4KFCA 1TOAA 2YHSA 3PHGA 3SVLA 4WXPA 1TJ3A 3QVJA 3R23A 4DMUB 1JEEA 4ENUA 3IR6A 4ZTBA 1N1DA 1K5PA 2DQSA 2J0VA 1VCNA 1W5TA 5ENDA 1B4DA 3TGPA 2G5PA 2WJAA 5DTEA 5EYPB 3TVDA 2CLSA 1E58A 1O58A 2FSGA 1CUCA 5KINB 4CGZA 3NR2A 3E0XA 4MGYR 4BX0A 3ZE6A 4MCHA 3L7KA 3GRAA 1M34E 1HE1C 1FNDA 1MFPA 3PFBA 5C5IA 4BIMA 3FTFA 3I2HA 4LZJA 2OG1A 3Q5EA 2G6BA 3AEUA 2O8DB 2ZXFA 4ZYXA 1UFRA 4RIGA 1DRJA 3FYUC 4KAXA 1TMYA 3PJGA 1UK8A 1ECBA 2XJ9A 4PZEA 4YDSA 2FW7A 3AJ8A 3HKEA 4QGHA 4FGZA 3HG7A 4XYGA 1Z8DA 2OHFA 4BGEA 5LMZA 1U2GA 1HL3A 1XRPA 2JJ2D 3OQOA 2J09A 1DFIA 4MRPA 5JYDA 1YA8A 4M7OA 3BDVA 2VPQA 4QLAA 1RHUA 4RETA 3UICA 3ED5A 3VM6A 4WJKB 3OD1A 1QCZA 3P7MA 3DW1X 5LXTA 4E03A 1WBBA 1F9EA 2DUUA 4CBVA 1QAQA 3DBVO 4MO2A 4U5XA 1ARZA 1P7VA 3TRFA 2G67A 5K8LA 4AKIA 4OHZA 1JFLA 3CJRA 1N2HA 3NHSA 2PFSA 3QOYA 1C1HA 4M98A 1GCGA 4R2XA 2H9AA 3ZHTA 4BHTA 1P72A 2O8VA 5DI3A 1P73A 1RPAA 1Y8RB 1GGMA 4YLYA 3WYBA 3A2NA 4IAOA 4KXYA 1SXIA 1NE2A 4L8WB 2FP4B 2XYQA 2BI7A 1TM1E 2BMJA 3P0RA 3P96A 4DIFA 4TTPA 1K68A 4E7OA 1HMPA 2PGOA 3GMTA 2JBHA 3H97A 3Q7SA 3GPIA 2OORC 4XB2A 1VI6A 2NVUB 3NYWA 1OZ0A 3RF6A 3J7AC 2EOAA 2HD4A 3LPMA 2IIVA 5K4AA 1B1CA 1BX0A 5LMUB 1PYOA 2FZWA 5HILA 4YASA 1G16A 3SM9A 2LNDA 1AS0A 1RYYA 2RHJA 1JBKA 4Z99A 5EJEA 4R31A 1F2TB 4QASA 1B0ZA 2Z56A 1UCFA 2PD6A 1T26A 3CEMA 4G2NA 3L5KA 4N01A 4TX1A 1VPLA 5AKLA 821PA 3BK2A 3FMGA 1P2UA 1RYFA 2ZULA 3CG0A 4YAFA 4UHDA 5JVDB 1XQVA 4D9IA 2XXAA 3KB6A 1QP8A 2VF8A 2FLWA 3C39A 3QBVA 1YK0A 4XGIA 4BFYA 3PC4A 4BJ3A 1FYDA 2C4MA 3CLSC 3WIDA 2I76A 4J2OA 4BFXA 4BEBA 3VOTA 2P6OA 5IT4A 1UMBB 2SCUB 5TQ0A 1BAPA 2YDYA 4ZMRA 3IDQA 2GFIA 1WPQA 2ZWMA 1RWWA 3NC0C 4KSCA 4TT3D 1PT9A 1KEKA 4K9SA 4UATA 5FH9A 5KQSA 2YJZA 5JASA 2O54A 2PSEA 4RACA 4IG4A 5BQFA 4MVJH 1GCUA 2BFDA 4AWBA 3LK6A 2AYXA 4EABA 1GRQA 3K96A 4YUYA 4RF5A 3FYUA 3IV9A 3JYLA 1DJQA 2R1TA 4TM8A 3I64A 5IH7A 3GT4A 3U6KA 2VDLB 3FBTA 1XL0A 1NURA 4IGIA 3WGUA 1SBZA 5I48A 5EZYA 4YHBA 1L1QA 2PMWB 4O8CA 2XGMA 4N6NA 2QX4A 1G8GA 4LMPA 3WL5A 3SHQA 4JBLA 1VXOA 3ULKA 2UYYA 3E3AA 2HK9A 1P9NA 2J6HA 4FN4A 2ECPA 4JOQA 4DBZA 3ROMA 3X1JA 3P9XA 1YZLA 2JCBA 5TARA 2VI5A 3OM1A 1MPTA 4IMRA 4O02B 4CLRB 5HM8A 1LB1B 1ESDA 2EP8A 3CLKA 4IUYA 4AZ3B 3LT4A 3TLXA 1GGFA 4DDUA 2BF7A 5FPKA 4LYYA 1HZZC 4PC1A 2GPSA 1CF4A 1JEDA 1L4KA 2HWKA 2WVJA 2ZI4A 4MVJA 5EZSA 1TTHA 3AETA 4TWAA 1B26A 5E9AA 5J2UF 5KNCH 3KR1A 2BAGA 2BZGA 3X1ZA 1PJSA 1O77A 2IODA 2FZKA 1CRWG 3EIXA 4IOLA 4L74A 1OROA 4EUEA 1D9ZA 5B64A 4EARA 1E98A 5FDFA 1PT5A 3AVOA 4X41A 4YCBA 2CFIA 3MCZA 2C8JA 4QBHA 4ZODA 2OCXA 2A9OA 2OORA 3WDLA 4GOXA 3L1VA 5FYQA 3WK6A 2XV1A 5J2TF 5FF9A 3QBJA 4I5DA 1N5RA 2C5AA 3G02A 1H1LA 4KWIA 4B3CA 5CLJA 1RE1A 1F6BA 3NRCA 3EUWA 2JA2A 2BONA 4Y9UA 4YXFA 1BCSA 1GPH1 3T52A 3FF4A 1L5OA 1W35A 3NZEA 5KQPA 1UQUA 3F5FA 1IIBA 4YP1A 2CV2A 1TJ5A 2AUTA 2BDTA 5I7RA 1JVSA 2FOIA 2XNDD 2HIMA 4YAGA 4JELA 3GT0A 5FLEX 5A2QA 2IQ5A 3SXUA 1E3WA 2C88A 2WIGA 2IYSA 3ZTTA 4MIKA 2O2DA 3JWEA 2VJMA 5LQAA 1VA4A 5ILOA 3TVYA 2QI9<