1FXWA

Crystal structure of the recombinant alpha1/alpha2 catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase ib.
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
211
structure length
211
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preparation and crystal structure of the recombinant alpha(1)/alpha(2) catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase Ib.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB GAMMA SUBUNIT
total genus 73
structure length 211
sequence length 211
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2000-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1fxwA00
4K7JA 1JRLA 3PT5A 4DEVA 1WABA 3DT6A 2APJA 4HF7A 3SLRA 4K9SA 3DCIA 4XVHA 3DT9A 4K40A 1ESDA 4OAPA 4OAOA 3DC7A 1DEOA 3KVNA 4JJ4A 1PP4A 3U37A 5BN1A 3DT8A 5JD3A 4NRDA 1BWPA 3W7VA 5CD9A 1DEXA 4I8IA 3BZWA 4JGGA 3SKVA 1FXWF 5B5SA 1ESEA 2WAOA 2Q0QA 5A4AA 1K7CA 1V2GA 4TX1A 1BWQA 1YZFA 4JJ6A 3MILA 1IVNA 4K3UA 3C1UA 4JKOA 4HYQA 2VPTA 2W9XA 4RW0A 4Q7QA 4Q9AA 2HSJA 2O14A 2Q0SA 1ESCA 3RJTA 2WAAA 4H08A 1J00A 4RSHA 5HOEA 4LHSA 4S1PA 1ES9A 3P94A 4JHLA 1FXWA 1Z8HA 4PPYA 1VJGA 1BWRA 3HP4A 1ZMBA 1VYHA 1U8UA 2WABA 4IYJA 4M8KA
chains in the Genus database with same CATH superfamily
1CS4C 1HPLA 1XEWY 2P4QA 1RM4A 2E1RA 2W6CX 3TL2A 4ARBA 1U6KA 3AEYA 4DJEC 4AMZA 4XZ3A 5FLYA 4YREA 4MCIA 1M6VA 2XZLA 1RJEA 4LF7B 3H1TA 3RJ9A 5IUJC 1DPGA 4NBRA 2Z8YA 1BJKA 3RFVA 2VHCA 2NUPA 3ANLA 3DMGA 1ADGA 5KQRA 2QV0A 3L5OA 3G9ZA 1Y8ZA 1R37A 3PUJA 3KXPA 3RROA 4FHCA 1Q83A 1X7ZA 3A3OA 4MA4A 4G9EA 2V5AA 4X8LA 4L74A 2BKXA 1QYDA 1YVDA 2XMDA 3VU0A 2Y2UA 2JZNA 2WWTA 4JDUA 4QWMA 3WFZA 1NTRA 1N9GA 3AERB 1Q77A 5CHEA 4UMVA 4QBFA 2R6CA 3R1IA 4M8SA 3ORSA 1VYVA 3JAKA 4EA7A 2CVQA 3HA5A 3NH9A 2GBCA 1EWKA 3AV3A 1BMQA 3HWWA 3K0AA 5ETJA 4MVWA 1MIOA 1Z0AA 4MJ7A 4X1KB 1AB5A 3Q72A 2GK7A 2VJOA 4FE4A 2F1OA 4UCQA 1SIBE 3BTUA 3BWXA 3OLCX 1E1MA 2DP4E 1W34A 1RRFA 4DCVA 4YDHB 5HIKA 1E7RA 5TXGA 2O8NA 4S04A 4N8EA 1E98A 4I14A 4U39A 1MABB 3RQSA 2ZRDA 3ASUA 3USZA 3ABRB 1CRQA 4FJ0A 5B7NA 1SA0B 2FUEA 1WP9A 2VRBA 4Z3DA 3N74A 2NW6A 3GDOA 3K6JA 2B92A 4LJYA 4OOFA 5BSUA 1KIFA 1WMBA 4ZCIA 1LDGA 5KOIA 3TW8B 3QXSA 1GVHA 2KS6A 3LNTA 1Q0RA 5K0ZA 1NBMA 2IPXA 3BN3A 3DTVB 3EF0A 1ID8A 1DJOA 5DBHX 3ER6A 3CV3A 4N47A 4EGJA 3LCCA 1G8GA 1DAOA 4WECA 3WBKA 1PIWA 2NIPA 2QY9A 3P9IA 4CETA 3VNRA 4WDRA 1JPNA 3MSXA 2C9OA 3RKRA 5KNDA 3WIVA 3EH2A 3OIGA 3NP9A 4JX9A 1GFIA 2IVFA 1GARA 5LZ9A 1G21E 2VDNB 1R0WA 4ENUA 3DEZA 2JGNA 3GL9A 3LUGA 3I9KA 3NETA 4Y8VA 1E9SA 4W99A 5F7ZA 5K8JB 3CISA 1FA9A 2BMWA 2RCYA 3EBOA 1ZR4A 1KH1A 2A0KA 2REBA 1XZBA 3G7SA 1IY1A 4KQCA 2IU3A 3HB9A 5FOQA 5KYYB 3HEBA 4UVDA 3H2BA 2I3BA 2A4MA 2O2JA 4W1PA 4HPXB 2H4HA 3NNSA 4GUAA 4F9TA 3IULA 2Q3FA 3U60B 1W30A 2BEUA 3CRRA 4Z0NA 1Z2OX 1DG1G 1MO5A 3DR5A 1P91A 1V3VA 1TUIA 2ZVJA 3AQIA 3MJSA 1GPYA 2O9JA 3PNSA 2JGRA 3HO8A 1TRHA 4FS3A 4FDUA 1FZTA 1NV8A 1YCFA 4M0MA 4C0LA 1C50A 4H6WA 1ES9A 2QLJA 3D8UA 4ZAFA 3SSAA 2ESRA 2ZP1A 1PUJA 1NI4A 2Q3JA 4Y9UA 3ZHQA 4F3RA 2XCSB 1N3IA 4GNKA 4V3BA 4JLOA 2DEUA 1SZPA 1XZJA 1EP1B 4M8NE 3BMCB 1XB2A 1YDGA 1U8UA 4TQGA 1CYEA 3CONA 1GL3A 2D7JA 2Q0XA 3FOBA 1JEEA 3FUWA 5AHKA 4XGNA 4D8YA 5BNTA 2KW5A 3GJ5A 4G5HA 5B3LA 5KSOA 4HR7A 3LS2A 2VDJA 1K0UA 2B99A 2O7QA 4AO8A 4CFZA 4EHIA 1MV8A 3FPJA 4GC5A 4TRNA 1DU4A 2OYCA 2WWIA 4K2HA 2I1QA 4YRRA 1ZMTA 5JPCA 1CZKA 1YFZA 3DDOA 4AC9A 2PANA 4RTOA 3BJRA 4ZTUB 3EQ2A 4MITA 1S8NA 3R5HA 1B8PA 1COZA 5JRZA 2BFAA 1TM3E 3S8EA 2BZSA 2EF1A 1R9MA 2QI9F 2FZEA 4DJAA 4PYLA 2PUTA 4JLSA 2H4XA 1ETUA 3ENZA 5M34A 3G2OA 1OU4A 1ZGJA 5DTMA 2PQ0A 4DDVA 1ZBDA 4RLFA 3JD0A 4MWCA 4QFMA 3M4JA 4OYLA 3K0HA 1NE2A 1NMYA 3IAS1 4LBWA 3STHA 2ZM6B 1U3WA 1M1XB 5EIXA 5ER9A 4GU5A 5ALRA 3DTTA 1Y82A 1I7QB 3DGEC 1F20A 1RE1A 4W1RA 4BBZA 5C1PA 2VZ8A 3AOEA 4TT3A 3UICA 1G5HA 4DCSA 1KRWA 5LR6A 4NCJA 1DTWA 1E32A 4YIHA 2OQ2A 5KWJA 3FRIA 2C3PA 5CXSA 1SC4A 3MQFA 2SCUA 1ZCAA 2BM8A 4D6YA 3OU2A 1R0BA 1HSOA 2MTBA 4NE2A 1Z0IA 1UM9B 1XZNA 3OKPA 1IIRA 3IKVA 1QYVA 3OCYA 3I1YA 1N6IA 2ZPAA 3KYDA 4IIHA 2FMTA 2WTMA 5B5SA 3H3JA 3RYFA 1R0YA 4UU7A 2CHGA 3G82C 3BJZA 2IEZA 1ORIA 4GD3Q 3E6AA 2UXCB 1VMKA 1DFIA 4ZXFA 3F71A 3CXRA 3FKSD 4NBTA 4B31A 5EHXA 3A04A 3GCDA 4Q1VA 1RVDA 1P2SA 1EFLA 5FFMA 5DX0A 4AZ0A 4B6EA 3K8OE 2YYZA 4A5OA 1F06A 2OHXA 4UUBA 3GT0A 2XCTB 1MX9A 3ENKA 1B2RA 4HDOB 5KX5A 4G85A 5LNK6 1FMTA 4ABYA 5JXHA 1P44A 4CR8A 5H3LA 1FFWA 4BLWA 4LY3A 2C03A 3CH6A 3L7LA 2GBPA 2C4UA 4L51A 5CPBA 3TI7A 1DUIA 1GGVA 1GPUA 1HYGA 1NXQA 2CCKA 2YV1A 2YTZA 3R3YA 5G53C 4B44A 3SVTA 1CJVC 3H1PA 1VP3A 2GNOA 3D9QX 4WK2B 4M9RA 4EQ6A 3PTLA 4J0IA 1TF2A 2ZZMA 3NC4A 1Z6QA 4QXPA 1US8A 2HCTA 2GPNA 2ZKLA 3MOIA 4LG1A 1DO0A 2I22A 3VYWA 1R74A 2WA1A 4R4JA 5LQUA 4CM8B 4DQKA 1X1CA 4X7BA 1HLGA 1PWXA 1W5TA 3VR5D 2Q5EA 2B9VA 3TQFA 2Q6KA 3A2NA 2ZT6A 4O3FA 3MGBA 3MTEA 3AEKB 2JLRA 4N12A 5FO1A 3SZLA 1KH3A 5BSEA 2RKWA 1NUQA 4HTAA 1QF7A 3O73A 2JHGA 3V4ZA 1K6EA 1RRGA 4H0NA 4Y1GA 13PKA 3CRZA 4BASA 1V35A 3TB4A 3MBIA 1RQGA 1OIVA 5C80A 4ISBA 2OWEA 1GZ6A 1N5OX 4EP1A 4KIJA 2V7EA 3BG5A 2RK4A 4G3XA 2E9SA 3BORA 1HLPA 1TIBA 2HU8A 4DEVA 4HX9A 3G5TA 4DIDA 1ZEMA 2J5RA 3MJVA 4F5ZA 4NFYA 1XZMA 3TNDA 2Q2WA 5FI0B 1SJ9A 2WIBA 5B2FA 2CJFA 2P6UA 3AW9A 1E3QA 3IMGA 4OXIA 2XMGA 3B3JA 1ZA1A 5DNAA 4OMDA 2ODAA 3JASA 1TU0A 3GAAA 4MPTA 3STVA 1NA5A 3GEPA 3I09A 2AXEA 3ASVA 3PQ6A 4ZYZA 1ZXLA 4AUMA 3ESRA 4OIMA 3UKJA 2EJTA 4IV5A 3ZH9B 3DDWA 3U44A 3RIXA 3UWDA 3BM5A 1RJ9A 1A8PA 3TDNA 4IHQA 1NBHA 3JCZA 4JBIA 1JMKC 3U0BA 4DMRA 1LI4A 1CFZA 1B15A 2ZJ1A 5AVZA 4YECA 4AMBA 2EZ9A 4CT4B 1G19A 2WLSA 1U7XA 3C48A 1HE5A 4EAAA 3LOUA 3TZHA 1YGYA 3A3NA 4GDMA 1RT9A 2FPIB 3ZH2A 4BRSA 1DE0A 1I4WA 4YCNA 4LRYA 1O9BA 4UUPA 2PL5A 2ZIXB 1ST2A 2O05A 3TAXA 1EFPB 1JU3A 1FTSA 4IV8A 3V4LA 3IOCA 3IE2A 4BFYA 4HWTA 3P0HA 3AT1A 4IRMA 4LWOA 4F4HA 4F2WA 2W6ZA 4X1IB 4I81A 5E4TA 1EFRD 3CUWA 3SICE 3GH3A 4N01A 3BXZA 3ZY3A 1GAXA 4YA6A 2W00A 3ROXA 4IG9A 1EG7A 1EVEA 1ISRA 3ZQ4A 4CCYA 3VO9A 4YDRA 5IF3A 5C3UA 1IU9A 4E2WA 4JQYA 1L5GB 4YMGA 3BT7A 1XWWA 2CY0A 3QYPA 2C5FA 4LRWA 1K2VN 2YYYA 2ZSIA 3EZXA 1Z06A 4MLPA 3GCGA 2XRFA 4RK4A 5JLJA 2CJXA 3AB7A 3BULA 1US8B 2WJWA 1OIXA 2YRFA 4QYWA 4E15A 5K0GA 4JLKA 1D8TA 1CZUA 4UASA 1ILWA 2EKBA 2ON6A 2WTBA 3DFUA 1L3CA 4RKYA 4CKBA 3E22B 2W6JA 3TOCA 3Q5EA 1T4DA 3KYDB 5EKDA 1Q5PA 4ZT2A 1I10A 4RSMA 4C2TA 4P83A 3V9AA 4EGFA 3LGSA 3WWPA 2OZKA 1D7AA 1R4MA 2GVZC 2NN3C 3RUFA 4NOKA 3RLIA 3EQ8A 2PZAA 3QUQA 4Z4FA 1JHQA 2XGJA 2MSCB 2C07A 3SVZA 3H84A 2QP4A 1CJSA 4HPJB 5DHSA 5HF6A 1JFFA 3HGTA 2LP4Y 3DE6X 3WMFA 1C8VB 2FQYA 2F1KA 3G9TA 1EBBA 3M3HA 1HL7A 4Y6GB 1E63A 5IH3A 5U9CA 2WF6A 3QXHA 4J6FA 4PM4A 3H2KA 3DPUA 4HLUA 3MJHA 4PIPA 3HO6A 3G9UA 2RGRA 3HFJA 2HIHA 3KKQA 3ZTWA 4DEYA 1TM1E 3CCBA 1AM4D 3ZZ0A 4M53A 2X8AA 1N6RA 3H4IA 3CE9A 5CDUA 2FGJA 5A5GA 1XEFA 4ENTA 4RK7A 1LBTA 3K7EA 1TK3A 3DXZA 4JT8A 4KHZA 2LCIA 1C9JA 1PQWA 3I9NA 4ED9A 1A2BA 2VWGA 3SR3A 5CFQA 3JVEA 4NOJA 3BXXA 3MINA 2CLHB 4CQMD 4BNKA 1ZN8A 5JXGA 1E1DA 1KNQA 1T0UA 1YL6A 2H1SA 2OV3A 3CUSA 4Y2SA 3WWCA 4C14A 1Z0DA 1GLVA 4N9QA 5DNDA 5FORA 2RK3A 3VFDA 2AUMA 3FGPA 3PICA 5CA0A 3I2IA 1E1QD 4TLEA 5AK3A 5K03A 3RV4A 5EXEA 2CFOA 3VR6A 4DV3B 4O4JA 5JHGB 2REQB 4JJEA 3TZCA 3MUFA 5FWXA 1C3EA 5CH8A 1Z17A 4L8FA 1JXAA 3T7DA 5JBNA 3UCEA 3MXTA 3VAZA 2QZ4A 3J80A 1F9EA 2JFUA 5EFOA 1XHLA 4BFLA 3NH6A 4KTVE 4UU8A 4Z1MD 5JDCA 3TL3A 2DULA 4MYSA 1ZC3A 2G0TA 3AU9A 1S8OA 1L5HB 1SVKA 1JQLB 3IP7A 1B43A 4Q3KA 3RJ5A 4KSBA 3A9WA 1JDBC 3N59A 2Q2OA 5CD9A 2ZI7A 4UEKA 3DE7X 4MZDA 4M9SA 3QLUA 3HADA 2PSSA 5LYJB 5HF5A 1M2HA 3STXA 4Y1FA 4EI9A 1SUFA 3OFNA 1I3NA 1SVMA 2HCJB 1PL0A 2Y8EA 2PAFA 2J09A 2WHQA 3JR3A 4FEEA 4CBVA 4E6PA 4PYJA 3SNKA 1NHWA 3NHAA 1E92A 1JILA 4ZAVA 2CKMA 3QG5A 3KTAA 5KMGB 4CL3A 4CPDA 1P4JA 4LK2A 4PR0A 2X8JA 3DE4X 2PH7A 2Q29A 1E2FA 2ATCA 5DNWA 3VZCA 3TGLA 1QF9A 3MTGA 5D51S 2IE0A 4KXQA 1IUNA 1JHVA 1N0HA 1WDKA 5CT5A 3ELDA 4FKMA 2IPLA 2ZRKA 3L7DA 3OUTA 2IXDA 1OLOA 3CVJA 2B5OA 3L7OA 1M2GA 2O57A 3FFXA 3U40A 2EXXA 4JI3B 2QSYA 4QJ4A 1OC2A 1FQWA 3CW2A 1QPGA 4PC2A 2JFPA 5T57A 4B8WA 5GZ1A 1RWMA 1CS0A 3C3CA 3CF2A 3MJCA 5G4LA 2QJOA 2DSNA 1V6AA 3O9MA 4KRFA 4OK6A 4FDMA 1K7XB 3EC1A 1LFAA 1NQVA 2EW8A 4YJGB 1SKYB 4KU4A 2DR2A 2VP9A 1VTKA 4RD0A 1CY2A 1CPYA 3GLFB 5H7XA 1N2IA 1UWVA 4C0JA 3T34A 4CEJA 4K9QA 4XASA 2I4IA 1KFKB 1FLVA 3A9TA 1CUAA 3RYIA 5K20A 1TEZA 1HLDA 4PO8A 2JCSA 1ISIA 4DSAA 2XB8A 4TM7A 2O23A 4N0EA 2AMVA 1Q11A 5JT1A 2O6LA 3L1UA 2OUKA 3EHEA 1N57A 2I4OA 3O75A 3FBWA 3IYLW 4PGFA 4RK6A 1J6UA 2X22A 5TPWA 4CG3A 3AHIA 4O2RA 3FIUA 5F3DA 3UOAB 1NMZA 3QUSA 2XQGA 1QDUA 2BIFA 2B2CA 2CNDA 1T25A 3HYRA 4MR7A 3PXXA 4TVOA 5G4KA 1UT5A 3QX9A 1S2NA 3FMOB 4MR9A 3NKVA 4BRWA 2WI8A 4RKQA 4P7GA 2YJ6A 1GRRA 2I55A 3ELBA 3W78A 2BUBA 3HTXA 2ZRJA 2MSDB 1LLFA 3L7MA 5ENVA 2PSEA 2VJNA 1W46A 1XLTC 3L46A 5B6JA 2BR5A 1UPTA 1KHTA 5B53A 2YXBA 4D43A 1L4NA 4MWTA 6GPBA 5JAOA 2B1IA 1GCIA 2WQ7A 5HIAA 1BDJA 4D81A 2PL1A 3FCYA 1TZKA 2HBYA 1KDPA 4EI7A 4NZYA 1W6RA 1CLEA 4B7XA 2Q7DA 2P41A 1KIAA 2OCXA 4X1KA 5BWNA 4ZCRA 2XUDA 4DG5A 1K88A 3RYCA 3WSVA 1PJTA 3SYKA 4EVQA 3H5NA 3MG9A 4FK8A 3OZAA 4J4TA 1S6YA 2XXAB 2JGJA 2XB6A 5B7QA 3IAM6 2FJUA 2QT1A 1AC5A 3KKLA 5C35A 3HRIA 3OVMA 4K6HA 4BB5A 1UOEA 3WGTA 2NYAA 4Q48A 4MS1A 5BVGA 2AVNA 2AG8A 1FDUA 2BDEA 4J90A 5CCBA 3F78A 1XDUA 1Q57A 1QPBA 2IYLD 5AESA 4OA8A 2PBFA 2DCUA 4R2JA 4EPTA 2VQEB 3OQHA 2AI3A 2CD9A 2PFKA 1CZHA 1U8YA 1THGA 2BBWA 3B9PA 3KQSA 4RHFA 4BN0A 3UMYA 4PZDA 3CVWA 1RKVA 3T0GA 4EW1A 4GIBA 3M4XA 3MRTA 2IPAB 4V1CA 5I6DA 2Z4SA 3IBYA 5ALSA 5JC1A 1LK5A 4A8HA 1NXXA 1UBSB 3QOFA 2RAUA 3BC1A 4IIXA 4TMFA 3W2GA 3CBQA 4HNRA 4ZEXA 2RKBA 3KJEA 2OFWA 4K0RA 2UZIR 4JJGA 4BEJA 1U28A 1MJGM 2XMQA 3RK1A 1OX6A 1WCIB 3GAMA 2YVUA 3VNQA 4DDMA 1EWVA 3O47A 3UV7A 3WGLA 4CR7A 3DMYA 4ZKDA 3K96A 2BFPA 3V2IA 5BV0A 1C1YA 1N6KA 1ZOIA 1YWGO 4H7KA 3WLMA 1XMQB 4RVUA 3N6VA 3NHSA 2C1ZA 2ZE8A 1P45A 1EE9A 2Q3LA 4LW8A 3UWMA 2Z6VA 4DT1A 1W76A 3ZXUB 4MV9A 2FMKA 1H1TA 1ZCJA 2CUTA 2BGWA 1JTEA 4ZJPA 2VRCD 5KTMA 3GCXA 4MI6A 4LE2A 1DBQA 1XALA 2JI4A 1A1VA 1R64A 3U1BA 1Z6PA 1K7EB 3TQTA 3WL8A 5ALQA 3O7MA 4XJTA 2EZTA 4RESA 3IIEA 4CKCB 1FTNA 3S1SA 2QN9A 2VI5A 3A6FA 3F5DA 2X2EA 4MGYR 5JMPA 2I7XA 4N5DA 4PZUA 5DN6A 1G6Q1 2NUTB 4KQ1A 3V1NA 3OLYA 1VE6A 3PQCA 2WAAA 4TV9B 3QW4B 2JFNA 5ALJA 4D99A 5TQ0A 1GU1A 2UV8A 5AKGA 5EG5A 3WOHA 4FFSA 1HEIA 4LSMA 3T1HB 4PNEA 4MVJP 3W5UA 1A77A 5DYWA 4HPWA 4JITA 1AU9A 4RPIA 5ECDA 3SC2A 2WJYA 3LI2A 1E4EA 1SPBS 1X2BA 3EAGA 4NU6A 1E2NA 4UE2A 3QEBZ 1BKYA 3KLNA 2PGNA 3TTTA 3VHQA 4E3WA 1NG1A 1JR3A 1M1UA 3RUEA 2A5FA 2BLLA 4PAQA 2OVFA 3KK0A 1IPEA 2CDBA 4QASA 3E61A 4RJLA 1YR6A 5DM2A 3U1TA 3GJSA 4UUOA 1Q1QA 5HEKA 4FI3C 4FNAA 3F67A 2C4VA 3L0YA 4IIUA 3KCNA 4LMRA 2W7TA 4P82A 4NENB 5ECWA 1MEOA 3KBBA 2O1EA 4MSUA 5FPQA 1PCXA 5JH7A 3DAOA 5DI3A 1FJHA 2ZB7A 4AP6A 2ZPTX 4UULA 2C3UA 2K7FA 4BEBA 3EPJA 1K6XA 4AO7A 4MR7B 2WU1A 5E8JA 4LC0A 3H6HA 3GPLA 1O95D 1QVZA 3MAAC 5BW5A 1UBJS 4TSFD 2N1BA 1K5DA 2H1HA 4KB5A 3AFHA 4JC0A 2ZWOA 4O3MA 1X42A 3BK7A 4OBEA 1DI0A 4QUDA 2QTZA 2WFLB 4EMBA 1ZHFA 2I7VA 1SULA 4TS4A 3AFGA 2YOFA 3GJRA 5AUNB 3A4MA 3L79A 4PCAA 4RWEA 1HXHA 3WO1A 4KGZA 5AJUA 5HYVA 1S0UA 3LRXA 1R3UA 3PGKA 1DTSA 3PS9A 4INJA 4PC7A 5AUOB 2RHOA 4J16C 5GOTA 2VHQA 3LHDA 3R5SA 3OSUA 2I6QA 2YJ3A 4N3NA 1E64A 4AL4A 2PKYX 4NABA 2QVYX 1QG0A 2B4QA 3JD1A 1NULA 1X86B 3JZIA 2XYRA 3KT3A 3THOA 1QIIA 1IQ0A 1P1JA 4KQXA 5F5XA 1YZ3A 1KOFA 2YCBA 1R7RA 3GZTB 1E6MA 2BUAA 3EISA 3O91A 5DHUA 3HSYA 4UTPA 3RR2A 3BXPA 1F2TB 1OR8A 2XT0A 3KAKA 3ZY6A 3GEHA 4OQEA 4C1BA 3KUXA 4ZOBA 1WMAA 4BO4A 1P1IA 4FNGA 4Y2RA 1YZFA 2CL7X 3QFRA 5DTRA 1HTTA 2FR1A 3N28A 4QO8A 1BDMA 4UZEA 2ZS9A 3OKCA 1GL6A 2O8BA 3AR2A 5L4LA 3DHWC 3OM0A 5IJ0B 2IV7A 2Z8ZA 1T36A 5K2OA 2HGZA 2JHCA 2D1QA 4MVJF 1O0CA 3BEOA 3H4VA 2VNKA 5K9ZA 5KKAA 5ITVA 3VX3A 4XWKA 4N0MA 2C0QA 2NZXA 2HA6A 3FR8A 3OIUA 4S24A 4DLRA 4ZK2A 1M5RA 3OAAA 1JDTA 4QDKA 4GT1A 1QYRA 2FG7C 5FR2A 3QW2A 1Z4PX 4O5AA 4WFIA 1Z38A 3NXKA 3WGNA 1J5PA 4KQ2A 4QT0A 4WKCA 4ENRA 1OI4A 3C8ZA 4FMDB 1W48A 2Q5FA 5FD8A 5CG2A 2O8FA 5K3EA 5L4SA 3JWGA 1AN9A 1EFHA 3H11A 1UMKA 3F2IA 2Q0SA 3LX8A 1MU0A 2YDXA 4R2HA 5FFNA 1ENOA 2OENG 3DM9B 4FP9A 4FKZA 3ZHBA 4EO9A 4H6VA 1SIUA 1EWQA 2H5IA 4CT0A 1YK1A 3BIJA 4HXFB 4DY4A 4E5KA 4YCDA 3AEQB 1NBOA 4FUQA 2QL9A 4PN7A 3EEBA 1B8UA 1QHNA 1F7VA 4PLCA 2Z3WA 1XLVA 1PR6A 4Z8XA 2DQSA 2JFYA 3JRNA 1OUMA 2GCPA 3U7HB 3COYA 4TYPA 2XCRB 4FWTA 4Q3NA 3K70B 3KELA 2L0XA 1PUXA 3ACBA 2V7GA 1G2QA 5BUSA 5IXSA 5KJEA 3WIBA 3WP1B 3QVVA 4HLNA 3QFSA 4JP2A 5A5DA 4G67A 1WM1A 1OH5A 1GDDA 4YRLA 4BYGA 1DIRA 1H4SA 4IV0A 1CG6A 4PZCA 2GHQA 4TWBA 4YLYA 3EQ9A 3D6MA 2D2EA 5B37A 1L1QA 4NJEB 2VBIA 1NXVA 2OVBA 3EGCA 1QBKC 3TIVA 4QDJA 4BB0A 3OQNA 2F59A 2WDZA 2FN9A 1CJBA 4HWKA 5HQJA 5CFLA 1JS1X 2MJLA 1E2PA 1X8LA 3KEGA 4PZ0A 3TL6A 1YZVA 4V02A 3U4IA 4HF7A 3VU8A 4Z7JA 3EHDA 2NUPB 3LOQA 4HGPA 1E1KA 4X1YA 3LIPA 1C7QA 3B5JA 2FMIA 1B0PA 3B3QA 3F3MA 2EV9A 1N5KA 3HDJA 4G36A 3V55A 5I7UA 2ZI4A 5DHRA 1WZCA 2Y99A 2VTVA 4R9NA 3RHZA 3RRYA 5HP4A 3IDZA 2LUOA 3AIIA 2KBFA 3N7UA 3GELA 4B2YA 3INGA 2ODTX 3DR3A 4Y2PA 1A5ZA 4HAZA 2WZCA 4E5SA 3W0LB 3EVBA 2X7XA 3OZUA 4EG4A 4ETNA 2Z1NA 2Q3MA 4G0WA 3SOPA 4C4SA 2L19A 4C88A 1OV6A 4XWAA 2CLDX 1Q7CA 1ZSVA 3OQIA 5IC6A 5C5DA 1TK2A 1KORA 1SXHA 2O0HA 4N7RA 5CB4A 7REQB 5KTRA 3ZVLA 2DKFA 1FQOA 5DEIA 3OMWA 4MRSA 1KVSA 3QV2A 4GO1A 3P2MA 5EWJA 3Q7SA 4YFYA 3GGOA 1E2EA 1M74A 3PC2A 2AH5A 1CDEA 1JG4A 3L1KA 4I4IA 4WXYB 1EHCA 1W5EA 4INPA 1EM8A 3ZCXA 3H0KA 2GETA 3QVTA 2Q0QA 4UXIA 4ZVUA 1NKTA 2H7XA 2FX3A 1KQPA 2ZCUA 1IE3A 2B6NA 2ZAGA 3D8BA 5D8DA 4R1TA 3SHFA 3FTFA 1QCZA 4R5MA 5ED0A 2DFKB 1YRLA 4CEHA 4QG3A 3GUUA 3LUDA 4RZ3A 4QNRA 4KWIA 4GLLA 1P3JA 4XEHA 3L7YA 4RFSB 1HDGO 3A7DA 4BNDA 5IFLA 3RWMB 3TM4A 1II8A 4TQAA 2VDUE 1JFRA 2IOQA 2O3UA 2YIDA 4AJNA 4ARZA 3F96A 1QO0D 3UKOA 1KAEA 1BJTA 1V4NA 1F14A 1X0XA 1H69A 2IELA 2GBFA 2PKCA 2QP3A 3K5IA 4FX2A 4TLLB 3GDWA 3KTDA 2G3YA 4HLUC 3BYZA 8ATCA 5J2TB 1CVRA 4YQZA 2HK9A 3O2SB 1CHDA 4N7BA 1KDOA 3THRA 1GTMA 3C43A 3B3GA 2BSXA 5ALEA 5JFGA 1T43A 3DFZA 4CJXA 5CXXA 2AI2A 3MT0A 4A8PA 4AY3A 1EX9A 1NNSA 3LA6A 2HHCA 2A35A 2D06A 3JQ8B 4H7EA 2PUDA 1K8XB 1PEYA 1C7EA 1LB1B 1V11B 2NTVA 2A67A 3ZI4A 5KJCA 1UR5A 5JJCA 4RZIA 3KWFA 3U7JA 5LXTB 1TYAE 1QFSA 1KI8A 3DZFA 4U2FA 1LNQA 5JLAA 2ZE7A 1QIKA 5E7IA 5IP5A 3ZWCA 5KBYA 5AVTA 2CHVA 5ALIA 5G4KB 3JQAD 3MCWA 3U48A 1DBSA 4DV6B 1NQUA 1V1RA 2ZSKA 3JQBA 3RTAA 3SS9X 2FGKA 2HSDA 5DRTA 4PGHA 2VJCA 4JI4B 4CU5A 1AS3A 4IOMA 1J56A 3PHLA 5M2QA 1WHTA 2HNAA 3OZFA 4OQYA 2IZ0A 5JSZA 3THWA 4ARAA 2VF7A 3V4FA 3VC3A 5H68A 3IMCA 4BMDA 1N3LA 1COWD 3C1AA 4N82A 5JNSA 4ALIA 4MGZR 4P58A 4ZZ1A 4C7BA 4HXYA 4R0MA 3CLHA 2YC4C 1YVRA 3VSDA 1X92A 1X94A 3CNBA 4L6AA 2K5UA 1E2LA 3IKMB 3D5QA 4PZLA 4YNBA 1YQQA 2D4AA 3NAMA 3HG7A 4KWTA 4WNAB 4OI0A 3I4LA 1FU7A 1Y1TA 1CUGA 2Q4OA 3E5NA 2P69A 3O95A 4FT2A 1L5QA 3UJ6A 1FVXA 4CL8A 1X1TA 3NWPA 3K2BA 4XXHA 3NGMA 1CE8B 3RKSA 2IIPA 3UJBA 1TB4A 1ZBQA 3Q3CA 1Q7RA 2AJ8A 2J31A 2UUOA 2JNWA 3AHHA 4QDZA 4MIOA 1MNAA 3BEDA 3GFGA 3UH1A 4CUKA 1SD2A 3S55A 5JNTA 1E0JA 1GZDA 2W2LA 1UOPA 3MAGA 2H1LA 2W6JD 3IR7A 4WKNA 1Z2PX 5F3RA 1H05A 3B1YA 1V5IA 4MIYA 1D2AA 3TMAA 4XVRA 1QFMA 4RHXA 3AI1A 3NKLA 5IXJA 4YRIA 2Q3HA 3VISA 1X7GA 4RTMA 2IW1A 1KDZA 4AJJA 1OPXA 2DC1A 1V6CA 2XA9A 4DMHA 1QE3A 3P71T 4WDQA 3S28A 1Y5LA 3UAWA 4Z0PA 3T7AA 1Z83A 3UAYA 1JEAA 2DB3A 3CVXA 2PRSA 4L4SA 4P7KA 4XLTA 4NARA 1MC5A 2F3UA 1KEZA 4ZO4A 4TLCA 1M8JA 5IVIA 3FR7A 4L5CA 2A33A 3RT7A 3IXMA 1WMSA 1YACA 1P7VA 3KB2A 4HATA 5LMUB 2OCGA 3CEHA 2YHSA 1N6LA 3GFQA 5A4AA 3AXSA 3GT3A 2WNSA 3BGIA 4IOLA 4BX8A 2QR2A 3GPDG 3F4KA 1JW9B 1MFPA 5J59A 1JHDA 1RYEA 2GILA 2ENWA 2VP2A 4QYMA 4B3IA 4UE6A 4WSOA 4NYIQ 4NKRA 1QKIA 3D7NA 3QWAA 3DDZX 3GFRA 1UKVY 4JI0B 2UXDB 4BQOA 3V8MA 4KVFA 4QXAA 3QPUA 5HF8A 2Y6VA 3KTFA 4JQSA 4X3PA 1J5EB 1ZK3A 2AVDA 3EIEA 3VDXA 3WO0A 2ECOA 5EQTA 1Z8DA 3VUEA 3I64A 4HYYA 2R6GA 2ONJA 1K3TA 3FAZA 3SNHA 1P9LA 1XLWA 3NTVA 3GHYA 3T1TA 5ALTA 3UHOA 3VR3D 4EYKA 4ZZ3A 1DC3A 4XVUA 1JG7A 3M6IA 2ZSUA 3TFQA 3SVLA 4V0SA 2RMKA 4JROA 2E4WA 3RW9A 4Q47A 1J24A 3S2EA 4BLPA 1W9HA 4DMMA 3FMPB 2R65A 3OJLA 1IULA 1QP0A 1MTZA 1AJEA 1N8KA 3ZE7A 1E0AA 1DRWA 3CRMA 2HUNA 4D0RA 4YV1A 3L7CA 1M1NA 4B80A 2AOXA 4JOQA 3TZBA 2X40A 4KGXA 2ID9A 5I9MA 4BVHA 4DMKA 1JZTA 4GX2A 1V7PC 4S1PA 3EC7A 1GQ2A 4DCUA 3K9NA 1JQBA 1J07A 1N5RA 4CU2A 4DBVO 4S0ZA 2X1HA 3HN2A 4I66A 5DWVA 3KOMA 3ZTTA 1JEQB 2OA0A 4OUDB 3RI3A 2PUEA 3IJPA 3QJYA 1A96A 5KU7A 1LBHA 1B14A 5ADHA 1TX4B 1JLLB 3BUSA 5D5QA 1N9KA 2I3ZA 2DWQA 3PQ5A 2R8RA 3ZBUA 3H0EA 4J0EA 5AW1A 3OPNA 2AR9A 2F4NA 1M54A 1G1MA 1LBIA 2Z5LA 3D31A 1UBNA 3H2ZA 3FF1A 4ND7A 1KC1A 4RFVA 2XD4A 3Q3GE 3PNBA 4KFUA 4BP3A 4P84A 3HUDA 1G8MA 3TR0A 2XKJE 3HYLA 4NNJA 3LCJA 2F2TA 1MV5A 3NOQA 2YWCA 4BATA 5MGBA 4OX9B 3I2GA 4DUPA 4MQ4A 3GB9A 3ZI0A 1DOAA 3WX0A 4BWGA 4W5NA 5GVRA 4JLPA 3U3DA 4YRSA 1TJNA 2I1LA 3S3TA 5CNKA 3R7WA 4FE7A 4Y0NA 2XUAA 3K4QA 5AI5A 3MYYA 5D1HA 4L8GA 3UMGA 4PPNA 4CKBB 4KMMA 1J22A 4L73A 1E3MA 5I5GA 1I1NA 1P1BA 2IZ1A 1SBYA 3P9RA 1K6MA 4C0AC 2G8NA 3WVNA 1K3UB 2OD7A 3ZCUA 1PYGA 1W581 2H7VA 2VLIA 5J5VA 4BQEA 2PX3A 3K09A 2HDWA 4O4JB 1I36A 5JHHB 2Z6UA 4YCAA 1LSJA 2XVAA 4BQFA 4KWCA 4JELA 1ZXBA 3GYBA 2WG2A 2YWGA 1ZD8A 1Z5UA 5GTDA 4RMGA 1EVIA 1ZUD1 3KPUA 3KT6A 4G65A 2V58A 1JSCA 3C6MA 3FHLA 4XA8A 3T7JA 5ICSA 4MW7A 5LIPA 2IUFA 1PE0A 3HJBA 3DVAB 1CEQA 1LPAB 4K46A 3PVCA 2LDBA 2W93A 2Q28A 2P30A 4PAGA 4ARUA 1ADFA 3F7TA 3F1KA 2R6FA 3G68A 1H2EA 3BPSA 4OATA 4MQ6A 2J0SA 5EQFA 1GJRA 3PNYA 3TW8A 1I3LA 3HB5X 4K2AA 3RVKA 3ND5A 4BQQA 3UJ7A 3BREA 3B3AA 1CW2B 4QPCA 1SNYA 1U1IA 1CZLA 2NNLD 2I65A 2XR1A 4RY8A 1Q2UA 4UMFA 1PFKA 4RPKA 2A9RA 1GGFA 5T6MA 3ZWYA 4X63A 1EXNA 3HGQA 4RKWA 4ZOEA 4X7RA 3VPAA 2HIMA 3I58A 5DXFA 5FYDA 1CDDA 4EY8A 5PGMA 1A1SA 1RPTA 4H1HA 3V1YA 2IHKA 2QB5A 3JTEA 4AWBA 3DVLA 3NDRA 4BHTA 3ZWOA 1E2IA 2PZEA 3MS2A 2ZI5A 4RPCA 3T7KA 3ETCA 4OAQA 3EEOA 4IH9A 1KYYA 4EHAA 4MVJI 1QMPA 4AKTA 3ED1A 1HX7A 1EBUA 1ZESA 3FMIA 3SLGA 2GJ9A 2BFBB 4RHTA 3S29A 4HJRA 3AILA 4HAXA 4HI0E 2G04A 2BFBA 3ESZA 4PFKA 1IIBA 2BP7A 4NCIA 5JNRA 4QEKA 1VG0B 2IW3A 3FG9A 2RHDA 3G88A 3L7AA 5DLYA 3QEAZ 3K2EA 3KS9A 5EYPB 3UCFA 3RC8A 1NVUQ 4FD2A 2FSGA 2G9RA 1G5PA 2AEJA 3C6KA 4LY6A 1IOLA 2J5QA 1P0QA 1LLUA 1X1EA 2P79A 3CLRD 1GSIA 1GNPA 4AD8A 5IDWA 1ECGA 1Z8HA 4QUAA 3O1LA 4ID3A 2DUMA 3ZE2B 1IDOA 2OGSA 4EPWA 1C3LA 1VECA 1LC0A 2ODBA 3CUKA 3NGLA 5IULC 4MS4B 1OA0A 4R8RA 4LKOA 1UFQA 1XMIA 1ZA2A 2JD2A 3KWMA 1NC3A 4RZSA 3TPFA 1THZA 3PRKE 4DRZA 3T12A 4YUYA 4B09A 4ALLA 3QFCA 2GUGA 4I50F 4PWYA 3QY9A 2QAIA 1R6DA 4ND2A 2C3YA 2YWDA 4CQLA 1J39A 1HH4A 3TEMA 1RLIA 1UJ6A 3LT4A 4MI9A 2BR4A 1AKWA 4RL6A 3UV6A 3MGCA 3WAKA 3HXQA 1Z18A 1Y4AE 2YXDA 4H18A 1B3BA 1PGNA 2YIJA 4GMFA 1G291 1ZGHA 1KYZA 4NDAA 4LBYA 5DM70 4AY6A 2M2IA 1MX1A 2ZIFA 3D8HA 3OPMA 1K5GA 2ZS7A 3BGDA 3Q40A 1NSFA 1AB6A 1OMOA 2O07A 4UBMA 4YUZA 2XIJA 4MKRA 3ZDDA 5AOVA 1PQUA 3RCBA 1DIHA 4AQ7A 4MQEB 2OTCA 3BGOS 4RA6A 4TTSA 3KSBC 2FMHA 2L69A 2VN8A 3B1JA 1FP7A 3ICCA 1SUSA 3KT8A 1DEOA 1PK9A 3TZQA 3M6XA 3O8RA 1SEPA 1G0NA 2IA5A 1BCRB 3GMIA 1QOZA 2PXAA 4Y6SA 4YWJA 3RRJA 3O6VA 2VXCA 3TH5A 1LTHR 3ANSA 4YP7A 1Y0BA 4UM5A 1P33A 1SKYE 4DLVA 5JZVA 3KQTA 4ND8A 3RWOA 2X86A 4JMPA 4DUGD 5FTMA 3E53A 1R0CA 1DADA 1DEXA 4NG4A 1DDIA 1AA9A 4KPEC 3OKFA 4P5DA 1XKTA 2FZWA 5KYGA 3REOA 1SM4A 3TW4A 3UJCA 1IBKB 1ML4A 1FW6A 3DKRA 5EQDA 1L4EA 2GSWA 5KTNA 1D1PA 3CURA 1P4SA 3PYXA 2AQKA 3ZXSA 5JS1A 1O97D 3DEJA 4RLHA 3TR6A 2OQVA 2EVWX 1XZQA 1G3MA 4M0KA 5IN4A 3DO8A 3ZKWA 2J6CA 1T26A 2BT4A 1SD1A 1L5SA 2BFEB 2G7MC 3RKUA 3SYMA 4BZWA 3R8FA 3QE3A 4RDCA 3ETHA 4EA6A 4IO0A 2IHUA 2VJYA 4DIKA 4EPYA 5HFAA 1P9NA 3BZUA 1KQOA 4I3FA 2Q4EA 1F5NA 1FNNA 4ONEA 2B25A 1U8FO 1VRVA 4B8ZA 4W9MC 1Z5GA 4Z2YA 3O8NA 1P1KA 3S68A 1R6XA 1I6MA 3D4LA 1THTA 4EPXA 1BXRA 5CB4F 2WMNB 5BQOA 4PQFA 4BX3A 1DG3A 2PBRA 3L4SO 3ORFA 4NV3A 3FPEA 1PGOA 2G83A 3AM5A 3QNUA 5JD5A 2OESA 3SZGA 2CUKA 3ZW8A 2I99A 1VBMA 3BICA 3GBPA 1NGSA 1QPZA 3PL1A 4UNNA 1EX7A 5ALFA 1RWPA 4JQOA 4MA5A 3AQ4A 4JSTA 1XKXA 1YZGA 3FOWA 5J1SB 2QLLA 2E4ZA 2BFCA 2C1EA 3A4IA 3OQ6A 3VKVA 3EX7C 4X90A 4BGDA 2I5PO 2C7RA 1GG9A 4JC5A 3UUEA 3GGDA 5JDIC 4F1JA 3UHAA 3ZDXB 1FSFA 4XAQA 4MUEA 1VA5A 2EU8A 2JFGA 1S2OA 2CN1A 5LUAA 1I7DA 4O4HF 5C7OO 1JDJA 4H9GA 1XK7A 4MMYB 2Y4OA 1Y7IA 4BTEA 3KOYA 3K5WA 3HWRA 3W34A 4QUKA 3WHKA 2AR0A 4FMDF 1A4IA 1AXGA 1G7SA 1W0CA 2WDPA 4INOA 4DCMA 3NDJA 2HA7A 4R16A 4D42A 2W6ID 4FYHA 2OO7A 3VPHA 1L6IA 1NI4B 3FN4A 5CVCA 2JG3A 3CNLA 4IDEA 2QV7A 2I8AA 2FF7A 2NU7B 1GUDA 3R7NA 1AKNA 3CKKA 1C7RA 4DF3A 1D1SA 4PSKA 4CLOB 1DAFA 1Z3IX 2NU7A 1T4GA 3TX2A 3HKCA 4CLOA 3F7MA 1RWKA 2XVZA 1Z2AA 1ZDMA 4R9RA 1AQYA 4FFPA 4LVNA 4V0ME 3HLYA 1YB7A 2NUBA 1UPCA 2WPNA 4HRYA 4ROTA 3B2QA 2Y1KA 1CIVA 3FNIA 2HEIA 4JUFA 5AJWA 3NLLA 2CNBA 2Q2VA 5C81A 4FGLA 1V8BA 1XF9A 5IX8A 2RKOA 5HUJA 4DKJA 3X0DA 1OLUA 3DAHA 1M5TA 3PLRA 2G80A 5B1IA 3W5AA 3L5KA 1B6RA 3WGQA 2F3TA 1A8QA 4UVEA 2K2QB 1AT1A 2VNSA 4BRUA 1E62A 2PU5A 5SZIA 2MSNA 3MTAA 4NBSA 2HYIC 4ZOCA 3TS1A 3F74A 2R7KA 2YW2A 1A5BB 3HYSA 1PAUA 3TTSA 4DDWA 1E94E 1RMQA 3VHLB 1OHHD 1SIOA 2C5EA 2J5KA 2QX4A 2QVXX 2QYOA 4N54A 4BE4A 3RB8A 1NVMB 3UK7A 1DWUA 1F1JA 4WZAE 2X1MA 3JQQA 4V38A 1EHIA 3REFA 2EZ4A 4I2VA 4YPVA 1WBBA 3I8OA 1SG0A 3GZNA 3JWJA 3WYCA 4DMUB 1Z4KA 2ZB3A 3L8ZA 3LTNC 3AR5A 2AXQA 2A7XA 1P0FA 3RFCA 2IPMA 1PI3A 3KIPA 1JQ5A 1WXFA 3CU5A 4XLLA 4D9EA 2JAUA 3ZX5A 1Q50A 4BQPA 3T6KA 2EX0A 1H3FA 3VR4D 2FSIA 4A2CA 4FBGA 4IVRA 5JALA 1UXKA 3V8EA 2BM9A 1C7JA 1FDWA 4DREA 5TS3A 4B17A 3BK1A 2QXUA 4L1KA 2ZUVA 2ACWA 1NF8A 2QPAA 4B3MB 2GNAA 1SG9A 4HVAA 4JB0A 5AKHA 1MFZA 2J45A 2V9ZA 2QW8A 4ADSG 4D92A 3T5GA 5F1KA 1D07A 2G0AA 2Q6TA 4BX9A 5IK2D 4AIIA 3TUZC 1P7PA 1ZRSA 2JGLA 4EG8A 2JPDA 4M1TA 4RK5A 2R1TB 3WL5A 4C4RA 3V80A 3HXTA 1RXSA 5FHRA 1EZ4A 2PMEA 2KI5A 5I8ZA 3WIUA 4B4DA 1YTUA 1N1GA 1YUMA 2CMKA 1YQTA 1M6WA 2QN3A 2VXYA 3U3KA 2WFZA 4B71A 2EFJA 3B6MA 3TI9A 4P4SB 1MO6A 5MFPA 1J8YF 3K4HA 1YQUA 4ZOLB 5HILA 4BLUA 3EXEA 4R01A 3HHEA 4H08A 3FNGA 3MPUA 3JQFC 4EUHA 4QM6A 3GFFA 1AD2A 1KP3A 2XAUA 5GM2A 4MUFA 3EJ6A 3Q88A 4AJIA 3C1TA 1PEDA 1I5RA 2WA2A 3PHCA 4Y1EA 1BQ3A 4YALA 4BLTA 4EY5A 4IZIA 4XUDA 1XDSA 3VHRA 2JHPA 5FA6A 5GADl 1WVGA 1BW9B 1S8FA 5G0TA 3AUFA 3G2IA 3WMGA 4Y9SA 1OLSA 2K87A 2IDZA 3HDHA 4BVFA 5JCXA 5C1DA 4BMZA 4ER5A 5DHQA 3HRKA 3PUZA 1CF2O 1ZITA 5ED4A 4HOYA 2WWXA 3OY7A 1W2HA 1G63A 4PX3A 1J09A 4WOKA 1FDRA 1ZYUA 4WKPA 2R6AA 1BEZA 2D5AA 2V1XA 5BNZA 2BBSA 4P0QB 3G2MA 2MSEB 2WE8A 4LZPA 4RCZA 2FPPB 2AZ4A 3ICOA 3OOYA 1T4BA 4EZEA 1XSEA 1K8QA 4M4SA 3N0RA 5IC5A 5HQ3B 2FPPA 2FXVA 2AOTA 1NXTA 3R77A 3LXUX 5IT9A 1V5EA 2Q4TA 3GHHA 1NTOA 3HHPA 4MYDA 2FETA 1JYFA 3NB0A 4L4ZA 1FYEA 3W9BA 2YMPA 5EJ8A 1KJ9A 4BNIA 1RLUA 4NI5A 1KBZA 2HL6A 2W71A 5FTNA 3W7BA 2N0SA 4RMHA 3CUTA 2O2XA 3RYHA 1DJLA 3ILXA 3IP5A 1IQUA 3PXEA 5DK4A 2Y1DA 4Y30A 5DX8A 2QOEA 3ADBA 2PEYA 1Z2NX 2OP1A 2ROQA 3M7IA 4LDPA 4TLAA 1X7DA 2C84A 2O1XA 2E18A 1OQAA 5DSZA 1Y9DA 5HMLA 1GA6A 4BMCA 3WB1A 2PD3A 4DE5A 1XXHA 2EERA 3PD7A 2X0IA 3GVXA 2H2IA 1SR8A 2WJZB 5BV8A 5JISA 1U2ZA 1BE1A 1LF5A 4OIFA 4ZCQA 1MG5A 1ZIOA 4ECEA 1QYCA 3COJA 5A0VA 2C5SA 1LI7A 3DDUA 3LTEA 4RNDB 4TTPA 1NXWA 1EP9A 2GLXA 3SSNA 4I4TF 1J2TA 2H8KA 1AKRA 3MTJA 4XQCA 2PNJA 2DT5A 1JSLA 1FW8A 5ALMA 5BRNA 3RC3A 4QQRA 3OJFA 1TADA 4ZPJA 1QP8A 4ZPXA 3ZNQA 2WZBA 4J3JA 4IH4A 4G0UA 3OKAA 2ZVPX 1EVLA 4Q9KA 4C5BA 2H9YA 3S2GA 3OU7A 1F48A 2XMSA 3C2QA 2XD9A 4JENA 4EKYA 5KVAA 1GSOA 1ZD5A 3OIYA 1EYZA 4A4DA 4L6CA 5CHYA 4ECAA 5A4FS 3R0XA 4PBSA 2OAGA 4B3JA 3JPWA 1R9JA 3CCCA 1BXGA 1B93A 2PUCA 5C7YA 1Y3IA 3LVBA 5EIFA 4YXWD 4EFLA 1QGAA 1K2WA 2I6TA 4M88A 1GNLA 1ZS9A 1GUZA 1P2VA 2IZZA 3A1NA 4CM7A 2GXSA 2A5JA 1TQ8A 1KKMA 2VT7A 2ZJ4A 3NNDA 3UTCA 3K6SB 1IXRC 4KVAA 3KKZA 3PGVA 1MD9A 3PFCA 3SJBA 3VRHA 3TW6A 1UC4B 4MW0A 1DBRA 2BISA 2ZIAA 3MGGA 2OBXA 3N8GA 5DOVA 5T3YA 3WHLA 4AZ3A 1R4NA 2QRNA 5JFTA 5THQA 3KUCA 4HSGA 2SKEA 2Y3IA 5IMBA 2AMYA 2FSVA 3TTYA 4C6TB 5IG2A 3ADPA 3HXMA 4TKVA 4N0DA 4FX5A 2I2BA 1UL1X 3U4MA 1CS0B 2W6PA 3TGPA 3GAZA 4JL8A 1PFWA 3FJYA 3I9LA 2Q8QA 2ECFA 1NLUA 1ULAA 3MPOA 1QHXA 1IUPA 4HB3A 1NI5A 2HEGA 5JYBA 1QSGA 1O54A 2OBLA 4MV0A 3ICQB 1XQXA 3J7TA 1XKQA 2PV7A 3AHDA 3A3YA 4FN5A 3W2IA 2XEXA 3EN0A 1W85B 1G55A 3S99A 3L3BA 2WAXA 3PKJA 4KLCA 1ESZA 1GT91 4L2IA 5AVKA 2A0UA 2WU3A 1WE2A 1Y1QA 1OX5A 2I4MA 2IYOA 3AF4A 2R8PA 1ZMXA 2H06A 2PS9A 4J2HA 4YRPA 2XT6A 4EZIA 3MB5A 3ID6C 2EW2A 4Q1DA 4ZYWA 3GP3A 4J91A 2EAUA 5GJCA 5J4LA 2OWDA 1K4KA 4M8LA 1CETA 1W5BA 4P3KA 5ELLA 3VJMA 3CSSA 4WUTA 5EUQB 1LRLA 1P5FA 3M49A 2R8OA 4WT7A 5FNVB 3SIRA 2Z43A 3STYA 4G37A 4G07A 2YMLA 1FFEA 3ICWA 3TUJC 2JAHA 1FDIA 4WCFA 3C5EA 1TE2A 2DE0X 3DTNA 2X5NA 2OLJA 3TBFA 5B2ZA 4DLTA 2GAJA 3HXLA 4IGEA 1KMNA 3EUAA 5JSHA 5JY6A 1C8LA 4R8MA 3U7IA 1UBOS 4JR0A 4LRXA 3SIWA 3GRZA 3TRHA 2NU8A 1H5NA 1N2SA 2Z98A 2GKGA 2RGNC 2YJNA 3MWEB 4H15A 1JHAA 4C89A 3HBNA 2Q5JA 4EAQA 1BU5A 3LXRA 5TE9A 1EDOA 2LDXA 4ON9A 2PM8A 1GILA 2I6GA 2OHFA 1FNCA 2QJFA 4JJ4A 4Q6WA 4RL4A 4C5AA 4K1XA 2CLFB 4FGKA 4G0PA 1SVWA 3X1YA 4WNAA 4R2MA 4YO7A 4X44A 4BNHA 1GAWA 2ZBRA 1SQ5A 1Y9ZA 4CV0A 3NT5A 4CCYB 2FZ4A 1XAJA 2C2OA 1L5WA 2REXB 4GWGA 1VZ3A 1T1JA 2HT6A 3VO2A 3OZEA 4F96A 3R6TA 1W8IA 2JGDB 1MO4A 2A1TR 2P3OA 2YZKA 1SH7A 2AEFA 1NDQA 2JIQA 2II6A 2O06A 4XX1A 1K7SN 1G41A 3IUSA 2BR3A 2V7BA 1PNVA 3NG1A 5CLGA 1UBKS 4DMLA 3QITA 4RY0A 1FVOA 1VGRA 1A8IA 4NMHA 5TX7A 2NNWB 5I7EA 2ZYVX 1PD1A 4NZNA 2QW0X 5KB3A 5JADA 2VF2A 4DADA 1CR6A 4JJZA 1CCWA 4U9HS 2O8FB 1VIVA 5JMOA 4REQB 8OHMA 2JANA 4N18A 2OFFA 1FTWA 2AG1A 1ZVVA 3OPVA 2H18A 4R71A 1VCHA 3LMKA 1UEJA 1VGVA 2I76A 4UDXX 3NEPX 1RYBA 2IUTA 4MWZA 3IOEA 1PTJC 2PMCA 1VHWA 3H9JA 4IF6A 4IQ4A 2NXJA 3RG8A 3ZR4B 3GQBB 2AYZA 3KJQA 3UGTA 4OJNA 2RGBA 1ABEA 2X42A 4QPJC 1LEHA 1KDYA 4DPKA 1UBFA 2QX8A 1Y1RA 3BMNA 3KJGA 4I8DA 3G3EA 2WY2D 5ESDA 1QE0A 2FFJA 1Z0ZA 2WU4A 2NSHA 1NUPA 3GVIA 4PGAA 4OXKA 1A2KC 2A0XA 2CL0X 3G0DA 3INRA 3LF1A 4QATA 4WACA 1BYIA 3D7KA 3OAAD 5F2KA 1W7AA 3HEAA 2VIIA 2Z5FA 3IUMA 3T7EA 4B4VA 3T3IA 1NKVA 4LOLA 5HZKA 1KY4A 4QQNA 1U3TA 2EEPA 3QUBA 4E4RA 5A3SA 1NIJA 2FLWA 2WD7B 3KWLA 4IIVA 4Q34A 5FI1B 1I32A 4M6WA 2AMLA 3HRHA 1JXOA 2ZWIA 3EMVA 2FKNA 3HVRA 5JARA 1R6AA 1AHHA 3SC4A 3SXUB 3GIWA 4ZRDA 1D2MA 1P5RA 3VMMA 4WZBA 3DP7A 2OLEA 4BGVA 2ENUA 3AEKA 3D3QA 4HSEA 4LRQA 1MQAA 4L57A 4AUNA 4DTIA 3JYOA 4AKSA 4CG2A 2G77B 1NRIA 4M1OA 5TMEA 3ZN2A 4DPMA 3LY9A 5BSKA 1Y6QA 2ICAA 4ALKA 5BSTA 3K9QO 3LK6A 5AM1A 4WZAB 1U0TA 4BTLA 4ZV4A 5BVHB 8ADHA 4HKTA 2DKNA 2GUWA 4UQPA 1W4ZA 2DQYA 3HI6A 1ACLA 3WSWA 1Z28A 4Q39A 1WOYA 3HVHA 4CMJA 4D0NA 3RVQA 1UC9A 2VCHA 4IEIA 2HB6A 4LOAA 2OCBA 4F7WA 1WCIA 3I34X 5D85A 2A5YB 5LL6P 2C3MA 3OE4A 5JNUA 4XJSA 4M9ZA 1TU3A 3B2EA 3ME5A 3SLRA 2FI1A 4ZHQA 1ZJWA 1HEYA 2WYHA 3AB3A 1XVIA 4IMIB 1H9BA 5C3MA 4NMMA 4ZO9A 4K9DA 2FHPA 3WV4A 3P26A 4A6XA 1UAAA 3EGEA 1GCOA 4U7WA 3TG2A 1X0VA 1ODSA 2JLCA 4K88A 1JHYA 1OAKA 4NATA 4QLAA 3IGFA 3L8EA 3EEQA 1QX4A 3BL6A 2C2YA 4KDFA 1MAWA 1U0NA 3AZQA 5F3WB 3RBVA 1HA3A 4NTZA 1X7YB 1BOFA 2P5YA 4ZVMA 2FZCA 4OSOA 5HUHA 4JLAA 5A9SB 2OHHA 4I4NA 5ELXA 1CBUA 2FJ0A 1TTTA 2ZUWA 3CO0S 3KQKA 4ZQGA 4DEXA 2J6HA 4GMHA 6NULA 1GEGA 3C87A 3BGWA 3CT4A 4XUGB 4YJ2A 2I6FA 3ET4A 3KXDA 2RGDA 5I7WA 3O93A 1V5WA 4LGCA 1LBQA 4J7CA 4O1HA 3Q3JB 2AZXA 1B4DA 5BMVB 4QJ3A 1B42A 4J0QA 1TECE 1L8XA 3I92A 1E2MA 2E6UX 5EJ9A 5ALKA 2GM3A 5AICA 5JBQA 3HXPA 4WVLA 1Q0QA 2HWUA 3ANMA 4GW3A 5BNFA 3QMWA 4V0OA 4ZMBA 4OQQA 3AR7A 1YB5A 1ULHA 3D4OA 3EWAA 2Y68A 3AJDA 2H0QA 3LUCA 2WKRA 4FUTA 4G5QA 2QG6A 4LUCA 4XH9B 5FL7A 1ZHHA 2HCBA 2P77A 1KI7A 1PJZA 1TVCA 2HJSA 3CZPA 2A1TS 1JH9A 4RVNA 3CR8A 5FOXA 2O8DB 3NAGA 3DMTC 4B6SA 4P4LA 3TE6A 2BSQA 2B3DA 2FN4A 1NLMA 2CVOA 2M6SA 5ITSA 3PX7A 4R31A 2O6HA 3T7RA 4G4IA 2QSZA 3F4BA 3DQPA 3P32A 1H2BA 3N2KB 3QENA 1B7GO 2EKZA 3BFPA 3NWOA 4MYCA 4XTRA 4YUXA 3GJXC 4NFLA 5AVQA 1GKIA 2PWYA 1Z4MA 1UBGA 2R44A 2YBDA 4LYHA 3SXJA 4M7WA 1K27A 1JLKA 3ESCA 4RLQA 4YP0A 3FWKA 4FDTA 4C87A 5KHOC 4C0QC 1F1BA 3VH4A 4Y1RB 3C3WA 4J0KA 4DA8A 3IP1A 3LW8A 1C9KA 5A7GA 1IVSA 4YQFA 2WIAA 1GR1A 2G25A 4Q93A 1R88A 2WVHA 2H2GA 1P2BA 2VO1A 4HDSA 4DRXB 1F3OA 3ISJA 4MUMA 1QQ6A 2WJVA 3UPTA 1QHIA 2PCJA 4O4JF 1P72A 4AY2A 1XPOA 1GPKA 5CNMA 5CIQA 1Y6JA 4BFSA 2FRDC 2G1AA 2FUG1 4UM8B 3TLZA 3AGQA 5T4FA 4F3TA 3QBVA 4BFWA 2HUPA 2WWFA 2OPBA 3SLKA 3M9LA 3LP8A 4EFNA 1XUOA 2UVPB 5CAEB 5BURA 3UPDA 3LPDA 2L82A 1FNBA 1LA2A 2WHXA 4GI3A 4MS1B 1XTUA 5FT9A 3A6GA 1HDCA 3TIIA 1JQDA 4TXJA 4HQRA 3AJEA 1JJIA 3AONB 4GXNA 2P0AA 4HNVA 5C51B 3K70D 1LU9A 1P60A 1RC0A 2GQ0A 4NMXB 1ZICA 2HDNB 1P5ZB 2ZI6A 3W4KA 4GI2A 4P7BA 3ZHRA 1E6EA 1MZVA 4QTUB 5EJMA 5LWHA 2VHEA 1XRJA 3S0JA 2V1UA 4QDOA 1FC0A 3IHLA 1DKPA 3A14A 2XNHA 1Q95A 2I4TA 5TC4A 2OHGA 3NCTA 3ZZNA 4WW0A 4D0GA 4YAGA 3I9OA 4A6DA 3RSGA 3P4UA 4BWVA 5EXTA 1XPRA 2NGRA 1T1GA 1U0RA 1GQOA 1R8YA 2YZGA 4MQUA 4MYRA 3W9SA 5IYZA 1RRMA 1SOMA 4XDZA 3WNBA 3WYFA 3RPEA 5ERXA 3IVXA 1HNWB 2UVQA 8GPBA 4KTTE 1GZVA 1MGOA 1WLYA 4XE5A 3VPXA 2FWAA 4OK5A 4ZHQB 3DL7A 1D9XA 3GOQA 2GAFA 3QJ5A 4MW4A 1MJ5A 3VKFA 1PWEA 4EUKA 1S3SA 1TPYA 4MO2A 4UCXA 1R3DA 5K3AA 3NC1C 3TQHA 1NWCA 4CIAA 4IDAA 1I2MA 3KSZO 4YMVA 5JJIA 3MM4A 5E1DA 3WSTA 1Y48E 3IO3A 4EY6A 4X6LA 5FLKA 4BLRA 3LP5A 4UNIA 1FFHA 4MA0A 4QL3A 3RC2A 4M99A 3L8FA 2XITA 1WUHS 3V2GA 5LU8A 4LF5B 1VPVA 4TS1A 2B2NA 5G1OA 1WSDA 1PL6A 3KU4A 1O87A 2G08A 3H4MA 3PHJA 2FFBA 3ZOKA 3HM2A 2UUPA 4NSNA 3BGSA 2V0GA 2IJGX 3DCJA 1RYYA 2NQTA 5EJFA 2SICE 5IRCD 3UJHA 4XYBA 2ASVA 4HWGA 1Y1KE 4KXUA 1GRQA 2CLCX 4DWJA 4LSGA 2VBGA 4UM9D 1EGMB 3EF3A 4D9IA 2J41A 1P61B 2ZIZA 1XNRB 4AW9A 4ZJYA 2MOKA 4B81A 2HNBA 1Z0KA 2IHJA 3NU1A 5KDDA 121PA 4FCTA 5I48A 3TCXB 4CMHA 4B45A 4D46A 1S5PA 2ISSD 3M9XA 1JZSA 4EJ0A 1OREA 3FTNA 4D9MA 4KBGA 2VH5R 2QHXA 4JBLA 2REQA 4ZU6X 1BA3A 1D7OA 4LOKA 4DGSA 5IKMA 3UT5A 1YJ5A 1RDFA 3IP9A 3R76A 1R4NB 1PN3A 3C6XA 5HS6A 4AT1A 3AVVA 3VPCA 4DA4A 1SCBA 2CLIB 2RAPA 2P9HA 1BVRA 2O4UX 4O59O 3AEQA 1BCSA 5AW2A 5KSYA 5KNCA 3IERA 5IBRA 1N92A 3AVPA 3UC5A 3OLZA 4RV5A 1RQ7A 3DLBA 2B8EA 4H2DA 5AHRA 1XCBA 2J3MA 3F3SA 2ACVA 1KU0A 3NFRA 4L5IA 3RUDA 3J81k 1HRDA 4RYLA 1P9OA 4UAUA 5FUQA 5EUMA 1M67A 4XJXA 3IALA 4KLAA 4EUNA 2Q9CA 1E2JA 2BPOA 3T5DA 4MGHA 2I8LA 5DW0A 4NXMB 3ZV3A 2YZ2A 4B3DA 1D09A 4G8BA 4DWOA 1IDN1 1YXMA 3V8NA 5BRAA 1JBEA 2O8VA 1OASA 4TS3A 2GAOA 2W8BA 4G1EB 1WUTA 3EXFA 4RKRA 5AJXA 4IVQA 3RADC 1A9QA 4MVJG 4RZUA 4BN4A 2GBGA 3SR0A 3X1JA 1XZ8A 2VHWA 3R09A 4D9JA 4X64B 2Y2VA 5DLQC 1XNJA 5JXWA 5AKLA 5KYXA 1VDZA 5TQVA 1WBJB 3L1VA 2YWRA 5CVUA 2VK1A 2QR5A 3PQ3A 3PIDA 4IIJF 3SBEA 4ND1A 3VX4A 1Z9BA 2ZZNA 3QVGB 1H3NA 1GPDG 1Z4LA 4KH1A 8MHTA 3K6RA 2QVZX 3BIOA 1E2UA 5H59A 2FK7A 2KWIA 3ILHA 2IP1A 4CLHA 4KFTA 4MUIA 2HADA 5BSHA 3QE2A 4BJ3A 3PLAE 4IX1A 1SHKA 1H1LB 1DT3A 3LVRE 1C14A 2P8SA 1I33A 1H9AA 2ALJA 2Q49A 2VPIA 3GK3A 3K32A 2FSUA 4NBWA 3EXAA 1T9HA 3RSQA 1FMLA 5AVVA 3CH4B 1U0OC 4PN3A 4UOZA 4QDTA 3KUUA 3QF4A 5HKLA 5D6OA 4YPOA 5ECGC 1V9CA 1P8JA 1Q14A 4XDYA 5CDFA 2NM0A 1O5TA 3AESB 2ACEA 1KMHA 3PEFA 1PLLA 4LXYA 5THKA 2GEJA 3BFJA 3BHJA 3ZWBA 3UEOA 4CNQA 3OEED 3STWA 2FNAA 3JTMA 1JH8A 2AB0A 3JQPA 1R4MB 1YS2X 2IP2A 3DEYX 3FF4A 4UMDA 2YIVX 4H4CA 1EU1A 3H3XA 4OM7A 1NLYA 1U8CB 4HVTA 3VR4H 3NEYA 2OCKA 5AI8A 4DLYA 3V4RA 1TJ3A 3IDFA 3JVIA 4HC4A 5B55A 5CTJA 1XCJA 2Z2XA 3CB2A 3EQZA 3HR8A 2HU7A 2PRKA 4I1YA 1KS2A 2BONA 4WCVA 1P0MA 1L6RA 4BMPB 1J8VA 4DSOA 5C8YA 2QTCA 1Q15A 3L7IA 5AK6A 5DPMA 5EAIA 3RASA 1RR6A 4MDFA 5LQMA 1Q0LA 1R0KA 3DAPA 3VR3A 2ZULA 4JLMA 4JI2B 2VSNA 3T94A 4OJMX 3HKEB 4F1WA 3QKWA 4CL2A 2X0NA 7YASA 3ORHA 5HIMA 3LLUA 4FM9A 5D3QA 1PTKA 4M98A 1L7EA 1U28C 3PDWA 1E3IA 3MT7A 4P4GA 1K4MA 4EKDA 4PRZA 4TN5A 3QFTA 5CDTA 3O8CA 4JFRA 2XMCA 2YQZA 1W4CA 2XUQA 3G2JA 3MUEA 2LNDA 1QXSA 3PQDA 2R6ZA 2VYNA 3SAJA 4R1PA 4WBNA 5TJHA 1L7AA 2C95A 3RSOA 3CLTC 2JCXA 1VJDA 2ZWMA 2IUUA 3COZA 2I6UA 3U4CA 4GOMD 1PV1A 4IIYA 3UFBA 5KQPA 4G4JA 4Y2XA 1EFUA 3OFND 1G7RA 3C3KA 3N5KA 5JWHA 5HGXA 2PZJA 1BFDA 3GYGA 2J9RA 3KE8A 1LK0A 1XPUA 1TUBA 1GQYA 4I08A 2DXIA 2FPGA 3DOFA 1OB5A 2EBWA 3D43A 3H5RA 3NHLA 3R9XB 1KXJA 1ZI8A 2V03A 2Q6VA 5FUBA 1KEWA 3KPWA 3KB6A 1A8SA 2NO1A 3O4VA 3NAQA 1DWOA 4MKFA 7REQA 1RP7A 4A36A 1ZK2A 1FEZA 3MB8A 3O8BA 2ZYHA 4ZYUA 1G59A 4S1OA 5DFAA 2UYHA 1E9VA 4OAOA 1XD8A 3DC2A 5J58A 1ODLA 2FFAA 4X6YA 5HDBB 4PLTA 3JZAA 2QZSA 3T1NA 4W5WA 3DT8A 1C2TA 1L8OA 3RRBA 2YYAA 1WTAA 4B5LA 2Z3VA 3GRFA 4EHBA 4YP9A 3ZE8A 4ESEA 1T15A 1KFCB 1L7PA 2YVKA 1YCDA 2O2IA 2Z8YM 4PQRA 4YAFA 4RTQA 4FMCF 3CRNA 4DJFC 1R6UA 3VVMA 1J4AA 2HK6A 4XD7D 4BX0A 5LMNB 2OORC 1SCUA 2P9FA 4ZAXA 1T5DX 3G0CA 4EF6A 1EK6A 1Y1SA 2QPTA 2YVAA 1SBQA 1P9RA 4NMLA 5C31A 4EHLA 4KNWA 4PXAA 3HKBB 4GGPA 4UEQA 1CJKC 5KNBA 3MMXA 3PLNA 3AOEC 5EKTA 4BNWA 3I2KA 3IR6A 1XO1A 1YRQA 3WLRA 3FRJA 1OWOA 1EGQA 3TEFA 3MTIA 1SUEA 3DAYA 3KDAA 1IEWA 2VDPB 5IS2A 1PR0A 3AYZB 4MAFA 4E03A 2TECE 5EP3A 4RTJA 3GXBA 5HWSA 1OBFO 4C21A 1ZRNA 2LBPA 2WPDD 3WLOA 3A26A 2C88A 1E9AA 2V45A 3IB3A 3FXAA 5IJ0A 4R3NA 3KTAB 4KEAA 2GK4A 1JHPA 5G0UA 3GLRA 4J0CA 3QF4B 4DLBA 3G59A 3KQHA 2GFHA 3DBHA 1KJYA 2FMUA 2OB2A 1DJPA 1U7TA 3H9GA 1Z26A 5FRDA 3DUFA 3PC4A 3ZKAA 5FCDA 1FP6A 3Q87B 1XROA 3O31A 4O25A 1X7XB 4RKEA 1PWZA 5CPFA 3BVPA 1XN1A 4XB1A 2I2AA 4Z7QB 4NCBA 1FF9A 2D54A 1QIFA 2ZSDA 3A6DA 2X58A 4JP5A 1ZW6A 2XWJI 3LDAA 3BAFA 2H92A 2ZTUA 3SJUA 4PYQA 5IJXA 1E3SA 1YASA 2FCAA 2ADMA 2QD2A 2V5UA 3GBSA 3LZ6A 4HRAA 5JCPA 3HNRA 5LYYA 1CV2A 3UG7A 4G26A 4TL8A 1KA9H 3RVPA 3IQFA 1NNI1 2G9VA 1M83A 3LVFO 1C9YA 5IZ4A 5TGTA 4HXGA 3EGWA 4A27A 2Q3CA 3KXLA 1FIUA 4CEJB 3MS4A 4JEMA 3ZCTA 3WK7A 5KYXB 2WV7A 4NULA 2Y9PB 2OZLA 3IBTA 2G9ZA 1UJNA 3WLJA 1DX4A 3AG5A 2Z57A 3IPXA 2OB1A 4ZO8A 4F9GA 4OH1A 1LLDA 1S2MA 4XSVA 1GGNA 5E38A 2I2CA 3U80A 3P1JA 1C8KA 4P92A 5HW0A 3TD6A 2FW0A 2I9PA 4TWJA 3HA2A 1FE8A 2Y93A 2NAPA 2PS1A 1KI2A 3GGCA 3QLVC 4D4MA 5IJ9B 2EFYA 3LDFA 2XOKA 1DKUA 3ENWA 3ZIDA 2XSZA 4WE3A 5C4GB 1N78A 3CJRA 2PGOA 3OX2A 4ZDJA 4FQ7A 1EGVB 3HNOA 3AF6A 1JIVA 3D7LA 5JJKA 4GR9A 4LJAA 3CSDA 3IQGX 4ROSA 2B8WA 4BMSA 1V47A 3FOCA 1GZHB 2ANBA 2HDHA 2P2NA 1ODTC 3IJRA 3KCQA 4O1IA 4QPNA 2NPOA 2VEDA 3UT0A 1E6UA 8AT1A 3F4LA 5KINB 1YQGA 3GF4A 1T1EA 4UNSA 5E6UA 4JIMA 3KZOA 3ANYB 4FT4A 621PA 5ALGA 4PG7A 3Q9UA 2OMKA 2ZG6A 5JO0A 1USUA 4DZRA 1O94A 3GJTA 5D7NA 2CVZA 1E4EB 4X1YB 2EWMA 1JAYA 1ZGZA 3CSUA 3KOUA 4LGMA 4XM0A 3ZEIA 2X4LA 4OHPA 4D9FA 2QK4A 3T35A 5DO9A 3AXTA 1O4VA 1TMKA 3H65A 4JJIA 2BJWA 1EVKA 2JVJA 1IH8A 2C98A 3VNSA 3ZZUA 4FFLA 4F72A 3VTKA 3V7YA 1YS7A 4G1CA 2YJ4A 2RHRA 4JGGA 2Z5VA 3DZIA 4G5RA 3BXGA 5LOVF 1TJ4A 2VR1A 5HE9A 1SKAA 5KSZA 1U0FA 2R6JA 5HR5A 1Q1ZA 2N3ZA 4YR7A 4OFZA 4XYMA 4KK3A 5FULA 3CBGA 4Q1CA 2RGXA 5E3HA 4KMOA 5T8KA 3WIOA 1FUYB 1HQDA 2QTNA 1WXXA 3IBSA 1HY3A 3SN6A 5B4UA 1KR5A 3U81A 3DMNA 4QFCA 4H7HA 1W87A 3IE0A 1V8FA 4HDCA 2I7TA 4QG7A 5D3MB 1UM8A 2WFLA 4RVOA 3VSEA 4YRZA 2H1CA 5AUQA 1EDDA 4Z4HA 2SNIE 1Y3DE 2XYQA 3GJQA 2PDAA 2BHSA 1RAHA 4GBJA 4N3AA 3U7FB 5JNVA 2OXIA 1AQNA 4G8JA 4XX0A 3GBVA 4Z4IA 5ALVA 3U9TA 2HQRA 4ENQA 2ZLBA 3A58B 1YJCA 3CF4A 3M9WA 2QJWA 3EW7A 4FW8A 2QTLA 1A4RA 1JHXA 1RAGA 5AO9A 5DGXA 4XQ9A 4WLEA 3CZ4A 3OJOA 1M34B 3DCYA 3O84A 4NPHA 5BOSB 3IDQA 2NU9A 4HNAA 1JHZA 3I4FA 1R9GA 4NBKA 3FBTA 3BE5A 2QUAA 2PS0A 4DL9A 4GM4A 4NC9A 2XMBA 3W2FA 4V1CI 2HLNA 3OQMA 1XA0A 2EBHX 1JDPA 4I5IA 2H1IA 1KKLA 5DTQA 4OHOA 5LB2A 4BNNA 4F4UA 3PGJA 4OLBA 4KNYA 1U5AA 3ZJ5A 1D2CA 2JJMA 4G25A 4JWKA 1ULZA 4NCXA 3NBQA 4GX1A 4YTEA 1RSZA 4DC9A 4DDTA 2NSDA 3ZLJA 4KZKA 5IM4A 3D2LA 1RXCA 1KYVA 2YJ5A 3QBJA 4YJ3F 4KL8S 2EP7A 3FE2A 5JJLA 1QAMA 3WBBA 2WB2A 2OV6A 4WKGA 3L7BA 1QQTA 4JLBA 4UEOA 3U3ZA 2QD4A 2DOKA 3R6WA 1ORDA 3NDBB 5ALDA 1BS2A 3SFZA 2J30A 1D4AA 2B36A 3DB1A 4K6MA 3RYTC 3X2EA 3IC5A 2IGTA 4LZLA 4RKFA 5EC8A 5JCOA 1RHUA 2IITA 3MNFA 2B20A 1ISMA 4JR2A 3IUBA 4WZZA 4B8YA 3NBAA 1JR6A 3QVWA 2YWEA 2MSKA 3L05A 2CLMB 4E09A 2QNBA 2Z2KA 3L0ZA 3QU9A 2M6RA 4BU1A 1U1EA 2QRJA 3TLGA 5HKBA 2QRZA 3WLAA 1K4YA 4IH1A 4PFQA 3K0FB 3IVCA 2ZSHA 1XDDA 3KHUA 2WE7A 3GQBA 3JARB 1OGYA 3QE0A 3KC2A 4MYUA 1G8PA 1E96A 2EW1A 4ILKA 5EPOA 3PWSA 4KXYA 4RF2A 4ZANA 2PT9A 1I2ZA 2WV9A 3R3JA 1UZUA 3OJCA 5KSPA 3GFVA 4L02A 4MQFA 4OF4A 3HSSA 4O2AB 3CM0A 4QJBA 1IOVA 4ZHSA 1KSJA 1UPAA 1MJNA 3Q8KA 5FNZA 5LU9A 2VATA 3F5SA 3OCJA 1AQUA 3AP2A 1VSQA 4XQ0A 2HJHA 5K3FA 4LYDA 1U6JA 4PSVA 3ZY2A 3O8OA 4OM8A 3E2IA 4TUYF 4CEIA 5DI9A 3H4TA 1EP2B 4NLLA 4QBTA 1MRNA 3MLAA 4RULA 5FAXA 1L5ZA 3CWQA 5BPFA 2QL7A 2C58A 4MO9A 2YW9A 1CR4A 3QU4A 3O8LA 1DO8A 1JAIA 2G36A 2B7LA 2QE7A 4J3FA 4OJYA 2UUCB 4OLAA 5EE1A 2ZUDA 4PO9A 2XBLA 2DJIA 1MHPA 4MQ5A 4XB2A 3NVDA 2Y1LA 1EA5A 3ICPA 4GL4A 3SU8A 1C8BA 1W4AA 4MV1A 4UTRA 4HQKA 3H0CA 1HYHA 2A14A 2V9CA 2WK1A 3WNZA 1AMUA 1AGPA 5FFFA 4ZTZB 821PA 1OZFA 3EGXA 2IVZA 4I4TB 3DB2A 5AW0A 5HX7A 3ZWKA 4RW0A 3NTXA 4KO4S 2WILA 1UXOA 5FP0A 4V24A 3M2PA 3CMMA 2Q99A 4UU1A 1Y8QA 1U2QA 1B23P 2HREA 1UK8A 2XF2A 2VYCA 1OGIA 4GHWA 1BOOA 3RTEA 3WK8A 1RQNA 3O7WA 5KVSA 1N2EA 4GI7A 4K87A 1E5LA 3OZGA 3T9FA 3K73O 1ZUNA 3T4EA 4CGYA 2UYGA 3F90A 3KZNA 4QQ8A 1CJUC 3KOOA 1NJ5A 1PT6A 3O94A 3QX8A 4K9RA 1DEHA 4KZPA 4UREA 5ILGA 3SQOA 2AOUA 1XRLA 4OXXA 1G9SA 3NBFA 1I4LD 1Z34A 4IMRA 3F8TA 4QICA 1Y8RA 1GRNA 4MB2A 2QAGA 4D3YA 4RVHA 1EGAA 1ZU5A 3GY0A 4Y1RA 1BVYF 4M1ZA 1G7TA 5AVRA 5BOVA 2DPYA 1HTWA 5BR8B 5SY6A 3M5PA 4Q3CA 5LIRA 1GL7A 3KQNA 5KC8A 2QMQA 1NP3A 1F6WA 3ND7A 1D0SA 1TPZA 4P38A 1JAHA 2XIQA 3O1JC 1J0BA 1GU7A 1UFOA 3PWZA 1AUPA 4OCZA 4PPQA 4E94A 3SDSA 3F5QA 2XNKA 1YOVA 1ZNWA 3TPZA 4RGYA 1SCUB 2R3SA 4XIIA 5IM5A 4Y18A 4GQIA 5T4BA 3NBYC 1F2VA 1I9GA 1OW3B 1CJTC 2EIHA 2VP6A 2ZT7A 4AKHA 2F8TA 4B6PA 5HZHA 2KM1A 3E84A 3G0GA 3A8TA 1BCSB 5IH7A 2HRDA 4H35A 5C9ZA 4MULA 2I66A 1XL1A 4QVGA 2WAYA 5JQGB 2GYYA 1WZNA 3CNEA 1E79D 2C94A 3ONNA 3I01M 3UK6A 1BG6A 2PY6A 3KUKA 1T35A 4TYWA 2H3EA 3BJEA 1PZEA 2CBXA 4IINA 2Q5OA 1AZLA 1ZL0A 1X80B 2QIOA 3FCSB 4PTZA 1IJBA 1XCOA 4MRPA 1I5OA 5CGQB 2QXYA 5H82A 3H8JA 1ST3A 4FGSA 3CB4A 3LUKA 1ZM3A 3TINA 3ZCQA 3HSKA 1PX0A 4OD0A 2D4HA 4A2WA 5E7QA 4NYMR 1EH5A 2E4UA 3VHXA 3DKKA 1ZI6A 3S2FA 4DILA 3NAZA 4ZAZA 1AV6A 1T8SA 3VHXB 1GO2A 1X7ZB 3KUDA 1T5SA 3DULA 4FFDA 3NHMA 5KOJB 3ESAA 1TCAA 4KR2A 4M0EA 4OHBA 3RT1A 3L7NA 5FB3A 1HUQA 2VNHA 1WY5A 2R8ZA 4P3YA 2HA4A 2CYBA 2OO5A 3EFBA 1Y9JA 2IH2A 4BJ1A 1ZUHA 3OCCA 4RH1A 1JQAA 4LYJA 2C5BA 2H4ZA 3ZUGA 3U3XA 1SUIA 3EA0A 1M34E 2A9FA 4IUYA 3ETGA 3VH2A 3KQUA 3N05A 4RHCA 5GPBA 1IRXA 1CEEA 2WUFA 1RTKA 4B1FA 5EEGA 1FY2A 1D9ZA 3UKDA 1H2AS 4CQMB 2BJHA 1I80A 1XRRA 2XGOA 2XWPA 1Z0FA 5LC1A 1T1SA 1HDRA 2EZ8A 2WOOA 1JEQA 1TZJA 1BFKA 3BH7A 4HNSA 4PY2A 1PDVA 4A8TA 3U13A 3Q6IA 2XSZD 3Q8WA 2Y05A 3S2SA 2BFCB 4CF6A 2XRMA 1AZTA 4Q16A 2Y6UA 3EE6A 1SA0A 4U7FA 1YFLA 5TMBA 1A8HA 3AKEA 1VI5A 5EHQA 4ICIA 4HG2A 2CNWA 2XLBA 4E4TA 1GCAA 1JX6A 5GZ6A 3BXEA 2VHXA 3W2TA 3EXIB 5HS4A 1LQTA 3FFWA 3ELYA 1Z7EA 5LKRA 3DW1X 4P6VF 3R0ZA 3ZU4A 4HCJA 5HPYB 1VIAA 3RUCA 1IHPA 1D6MA 3JYLA 1C81A 4S1VA 3M34A 3IHKA 4G0ZA 3R74A 2AOTB 1RXVA 4M60A 5JS6A 3OTOB 3ZD6A 2X0RA 4YI5A 2G40A 4HEQA 2IBTA 4W7HA 4LFCB 5KVQA 1V41E 4IVPA 2WG1A 5BWMA 3WWOA 4TL7A 2P9BA 4KUHA 4K6GA 3A6PC 1NJ2A 1V7QA 3AK4A 3LYHA 5AKKA 4W1QA 3CZAA 1W4RA 1UWCA 3FMFA 3BB3A 1DCKA 4Q02A 1N9GB 2W6OA 3AERA 3K1YA 1JEOA 3Q8MA 1J00A 1RQXA 3F9IA 4BJHB 2ZRHA 2OM2A 1UDBA 3RF7A 5IDXA 1JA1A 3F6SA 1WULS 1CZOA 1Q0ZA 4KGVA 1RADA 5FTKA 5A3QA 4OB6A 1IZ0A 4ZCPA 4LMAA 1ETHA 1TMOA 2D2IA 1K3FA 4FLEA 2VPPA 3L6EA 4IDNA 1L5LA 3L77A 3WOVA 3N3AC 5E3JA 1G20E 1VYHA 2B1GA 4KQMA 4NEHB 2WTNA 4YMTA 3KB8A 1QANA 1NZJA 4IY1A 4EF4A 3ROZA 2HPAA 3O92A 4G4SO 4MROA 3CN7A 4TYNA 4A82A 1C7FA 4US0R 3RUIA 1RJFA 1VMAA 3P9SA 4RIHA 1VZ2A 3D5EA 3CF0A 3L92A 4I4LA 2HIGA 5F52A 5FWDA 3VPSA 3WRXC 1BKDR 4N9WA 1R0ZA 2QT0A 2OO3A 5HUQA 1EE2A 5EZSA 5JTTA 1EESA 1GCUA 4US1R 3PUIA 3OWOA 2C8VA 1DKLA 3F6EX 4WNIA 1V96A 4A0RA 3JZDA 1YJ8A 2BKLA 2FJPA 3D0OA 1VPLA 5JOQA 4WCFC 1OV4A 3LHIA 4MP8A 3N0TA 3H99A 4WCDA 1AKTA 2FU5C 1VI2A 1B8VA 4XLZA 5DHFA 1GTG1 3L01A 2PX4A 2LCQA 5KOYA 2PYIA 3KL4A 4CQLB 4FZJA 2CXQA 1EAYA 2UZAA 3T7TA 3AYXB 3I28A 4JKYA 1PP4A 5EINA 3W1WA 4EHKA 3SQXA 2G9QA 1IWPB 1O96B 1PL8A 4B34A 4E5VA 2Y1WA 3BTSA 3EIFA 2XNDD 3DWGA 3ZYZA 3GVPA 1NE7A 4MR8A 4ZCMA 3D4NA 3OP4A 4FYYA 1BNCA 1YS4A 2SBTA 4CUZA 1SRQA 5ALXA 3MGKA 4B3BA 5I9IA 1M72A 1OXTA 2ZQ5A 5E0KB 4DV5B 3PF8A 3DMHA 3GRKA 5UKDA 4LHEA 3H42B 3P19A 4K8OA 4BO3A 3PPWA 2DPGA 4PRKA 3PWKA 2LKDA 3VDQA 1G3RA 4WFJA 3R8CA 3UMJA 3QELB 1NPTO 4RVSA 4U7HA 3C85A 3ROQA 3I6YA 2AMFA 3C7CB 1DIGA 1QR2A 1H1LA 5EHNA 3T4XA 1YBAA 2ZDGA 3NI2A 3OQIB 3RABA 1FTGA 2ZIGA 3Q2KA 3UJ9A 2XOXA 4KE9A 1X7HA 3GJ4A 4WN9B 4A6EA 2E49A 3ZQJA 3HO1A 4UQOA 3FZGA 1VE3A 1E4OA 1YDMA 1Q19A 2PXXA 1I7PA 2JATA 1XYVA 2AKAB 3EVZA 3FPLA 1V5GA 3O2QB 2GS9A 3LQ4A 1DNPA 3QEKA 3A05A 4QBHA 2CDAA 2PHZA 4OMCA 3I61A 1ZVQA 2VK8A 4FZ5A 1ATZA 4X94A 5KJ6A 2XKAA 3BGVA 3KR0A 1UWLA 3QWBA 4IW3B 4OGLA 3AHFA 4GUDA 3RHTA 1QZ3A 4IL5A 2ZRQA 4H4DA 5CYPA 1ISSA 1MDFA 2H00A 4OKNA 4Q9JA 3V6LA 1EEHA 4FD3A 3P0EA 2VDRB 2FVXA 2RI1A 2FOXA 3RVDA 4RTSA 3EBPA 2PKRA 2VYFA 3PDIB 3DOIA 2O4CA 5JI3E 3MZ0A 2NO9A 3NWEA 4CDMA 1IWOA 2V6MA 4JLDA 4H7IA 3L6DA 2CLLB 3C5HA 1ZRMA 3OZSA 4OLFA 4X1OA 2J9XB 5IU6A 1X13A 4RSHA 2J9GA