1FY2A

Aspartyl dipeptidase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
229
structure length
220
Chain Sequence
b'MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNTREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTYL DIPEPTIDASE
publication title The structure of aspartyl dipeptidase reveals a unique fold with a Ser-His-Glu catalytic triad.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 72
structure length 220
sequence length 229
ec nomenclature ec 3.4.13.21: Dipeptidase E.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03575 Peptidase_S51 Peptidase family S51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fy2A00
1C30B 1OX6A 2GK3A 4Y0NA 3SF8B 3MGKA 1KWGA 1OY1A 1PDWA 4WINA 1SOAA 1A9XB 4AJ9A 2RK6A 4MTCA 1GG9A 3L7NA 1KXJA 4OJYA 3CYFA 4UZSA 1PV2A 2ZUUA 3R75A 2R1VB 1KA9H 4L8YA 3TTYA 4ENRA 5E9AA 3PQ6A 1QVWA 1S1MA 3CNEA 4Y1RB 1GGKA 1GPMA 1T36B 1T3TA 1G2IA 3EJ6A 3NOQA 3OT1A 4UOQA 4AUMA 3GRAA 1GPWB 4ENTA 1VCOA 1IZZA 5K4AA 3TTUA 3UMMA 2ZUTA 2ISSD 3PQ5A 1FYEA 2YWCA 4MNTA 4S0ZA 2YWDA 4LGYA 3NORA 1P81A 4P36A 3NONA 2RK3A 3P9QA 4UOZA 3ZR4B 3D54D 4JQSA 4ZDJA 5IP5A 2VDJA 4BFLA 3SOZA 3B3AA 3VU3A 4B5KA 3TTSA 5SY4A 3UGJA 1ONSA 3ZJ5A 1QF7A 4E08A 2YWJA 4QYXA 3TTWA 1P80A 2R1TB 4Y1EA 4BTEA 3SF8A 1M6VB 1VHQA 4P34A 4GUDA 4OGGA 1IPHA 1JVNA 1QVZA 3NVAA 1O1YA 4K2HA 1C3OB 4WXYB 5LIRA 3BWEA 4B40A 2RK4A 3B36A 4ENWA 5JZOA 4QYTA 4ENSA 2R1VA 2FEXA 2V4UA 4HCJA 3R74A 3UK7A 1J42A 3EN0A 5DFAA 1T0BA 1I1QB 1P5FA 3L3BA 1Q7RA 4Y1RA 4ZDKA 4I4NA 4B7AA 4P35A 3WFZA 4UNIA 1FY2A 1OX5A 4OQ4A 2ZUSA 1VCNA 2VXOA 2ZUWA 3PQ3A 4RKYA 4PXYA 4AUEA 4ENPA 1KWKA 1QDLB 3FIJA 2YWBA 4ZDIA 1BXRB 3UOWA 1QWSA 4ENUA 5SYAA 1OX4B 1GGEA 3NOVA 5JZMA 1QVVA 2ABWA 1KEEB 4B31A 4AUNA 4BIMA 4E5VA 3P9RA 4ENVA 4UCFA 1K9VF 3L4EA 2AD5A 3L18A 4RKWA 1L9XA 2VRNA 4D1YA 3KKLA 4R7GA 1P7YA 2XF2A 1IZYA 2R1TA 2LXNA 2VPIA 3RHTA 4ADSG 4ZGGA 3EZGA 2H2WA 3B38A 1P7ZA 4L95C 1U9CA 1CE8B 3TTXA 1JDBC 3TQIA 3P9PA 3CY6A 4Y1GA 3TTVA 4L8FA 1GGJA 3M3PA 4GE0A 2R1UA 3N7TA 4I2NA 4L78A 4L7QA 4OIFA 5SY9A 1PE0A 3F71A 3EWNA 4P5PA 2VKTA 3CZ9A 1WL8A 1SY7A 2OR3A 1GGFA 3TTTA 2GHRA 4MGHA 1CF9A 3OT1B 2WJZB 1R9GA 1UCFA 4L8WB 4OGFA 2NV0A 4Y1FA 4LRUA 3PQ4A 2D7JA 5SY6A 4OFWA 5BV2P 1OI4A 4I46A 3MIIA 3PQ8A 2A9VA 1OX4A 3F5DA 3PQ2A 3PQ7A 4AULA 4ENQA 1Q2UA 1N57A 3CZAA 4N0MA 3P9SA 3ZJ4A 2W7TA 4N12A 2ZUVA 4XLLA 3UJNA 4P2GA 2AB0A 1CS0B 1PDVA 3EFEA 2IUFA 3R76A 1I7QB 4B2YA 2NV2B 3FSEA 3NOOA 4GE3A 1VCMA 3ER6A 3BHNA 1I7SB 1GGHA
chains in the Genus database with same CATH superfamily
1XOIA 3VDRA 3TIXB 4D0RA 1SKYB 3OIGA 3U4AA 5GTDA 1A5BB 2VSQA 2I2BA 3D8NA 5FUBA 3LC7O 1UAYA 4MWCA 4EHKA 2JJ2A 2XWBF 3LOQA 1MB9A 4IQFA 1DKOA 4QIHA 2YHAA 3CNEA 5ALHA 4D42A 2BGUA 4CF7A 2YNMD 2JH3A 1XCJA 1P77A 3DF9A 3GFRA 1MHTA 5FORA 2ILTA 3I0MA 4G0QA 1N0IA 4JYMA 5ILQA 5JJCA 5YASA 5EZ6B 1USVA 1JSCA 2FMXA 3MEQA 1B3BA 2H48A 1Y3DE 1DBVO 5LUAA 3KPVA 4P5EA 5LP6C 3URMA 2ZDHA 4Y2SA 1V9SA 1XZNA 3T7DA 3ZWBA 1E7YA 4EB8A 1WDLA 5FNZA 4ZCSA 1XVLA 3RLFA 1IQRA 3FWZA 1RXIA 1JXQA 4ZVUA 7REQB 2E6UX 3OECA 3QMPA 3KSMA 4CI9A 4FC7A 1Z6ZA 4B3SB 4L0MA 2NZ8A 4JI0B 3S1LA 2WM8A 4AO8A 2BP7B 2EJVA 3EZXA 2VDMB 3ANSA 4HWSA 1A4IA 4IHKA 5CD1A 1F5NA 2P6OA 5HQJA 3OHMA 3S5UA 1U1EA 3A05A 2GPYA 1JJAA 4YT8A 1Y34E 4E30A 3NQ41 4ZO9A 2VBCA 2C4WA 2NU6A 1CNEA 5ITVA 5CLQA 5DKFA 3ZU6A 1BE8A 1QRAA 2ZI9A 1FTWA 2NU7B 3OZTA 3SHFA 3M9LA 5JWRA 5JTTA 1P7WA 2BGWA 3QX9A 3I64A 5TGZA 3MT9A 1DCKA 2QTNA 5B3JA 5CH8A 1ZJ5A 3V8RA 2ZSKA 5KCZA 1AS0A 1UL1X 3L4EA 1MR3F 4MKRA 1Q7GA 3UK2A 5JXJA 1WIWA 1XQ9A 2GF2A 1W9HA 2ZAOA 4N8DA 1EM8B 3BZBA 4ASUA 3TZ6A 1P1FA 1VJ5A 2VOJA 4G4GA 4HNAA 1EFCA 5FQOA 2QZ9A 1ZN2A 2VXYA 1XLWA 2X1HA 4HRYA 3IKLA 3GD7A 4UU8A 3W8EA 4L8FA 4BE9A 3AF3A 4FW9A 4A7PA 4BO4A 4D0SA 2QMOA 2R1UA 4TT8A 3EULA 4EF4A 2MSNA 1RZUA 3MJHA 4DA6A 1FA9A 1Y7LA 3PXEA 3ST7A 1SIBE 1XCOA 3C1TA 5FLKA 2PHZA 5ABPA 2Z3ZA 1VIVA 2HW8A 3JZDA 3K4QA 3B53X 1U2EA 4EX6A 2QMEA 3CVXA 4OQPA 1XRNA 2GM5A 5ICCA 2OPBA 1NMYA 3ASYA 4FTWA 5B53A 1KOGA 4QXRA 4XOIA 4PVCA 1O6BA 5AVRA 1NBIA 1CUEA 1ZOSA 9LDTA 1IWPB 3A1VA 5FOTA 5SYMA 3V4ZA 3K0SA 4JBLA 1KYZA 4G4SP 5F12A 1UAAA 4GI7A 1X1QA 1PQPA 3EAQA 2AD1A 1LPOA 4ITUA 3UG7A 1Z68A 4QRDA 1T9CA 5ALZA 1GKIA 3HMKA 2ZBQA 4ZZ0A 5J59A 2Z4TA 3FTEA 1GRVA 1ONNA 1QP8A 3EIHA 4NU0A 2EIXA 2RAFA 4P80A 4GKJB 4JC0A 4BJ1A 1VP9A 3Q72A 4K6FA 3BK1A 1JYFA 3P8ZA 3UATA 2JLYA 1Q91A 5ALXA 3TW4A 5C7IO 2OFPA 3RRJA 5IXJA 2XJ4A 2PMEA 4PN3A 3DVAB 1CZLA 2YMLA 3F6PA 4W5WA 1D6SA 5A7HA 3UICA 4DLRA 5BSHA 3PIDA 1KHTA 5CBPA 3C41J 5IKPA 3VMFA 1PZXA 3BXOA 2LIVA 5EC8A 5KJ6A 4DQ0A 3NRBA 2BM8A 2CSUA 4RHXA 1ZAYA 4BFZA 1A1SA 1TEVA 2V5VA 2VC2B 2ZIVB 1XVAA 3KWFA 2P5TB 4OP3A 5H3HA 5BRNA 4YWJA 4FQ8A 3EC7A 4Z7NB 4IWYA 5KVSA 3AJDA 2M6KA 5KZMB 4W5TA 3BQMB 4QNMA 4BTEA 3AEUA 3QEMA 2NZXA 2RGDA 3GXBA 3E5NA 3ABOB 3ES9A 4QA9A 3RV3A 3WK9A 3L0SA 4JI4B 2HPHA 4ZAFA 5T8KC 2I3DA 1G7RA 3GLGB 1A82A 4J7AA 3U1BA 4KR2A 1ZD4A 1SPXA 1UOEA 1CY0A 4DSAA 3UC5A 4F9EA 4E2WA 1Y48E 4BMVA 4D96A 2YZKA 5KSYA 5HK8A 1THGA 3M5DA 1B00A 3OOJA 4CIBA 3L8FA 3LUJA 4LS3A 1WUHS 4F3KA 1V25A 3E61A 4U2EA 2C00A 4QT0A 1ODJA 3UT0A 3C7AA 4BFCA 5AK4A 2XXAA 1J0BA 1ODTC 3V1YA 3BWXA 1WY5A 2B1GA 4QHTA 1XB2A 4DIMA 3B6KA 5IVPA 1N6OA 4P54A 4RH3A 3VU9A 2G7ZA 1COWD 1K7SN 5JO9A 3FUTA 1GQ2A 1HPLA 3GLRA 1GA6A 4ZU6X 4MRMA 1ZIDA 3E15A 3G2KA 5JXWA 4PCUA 3IVCA 4EZEA 2QVGA 4EGJA 3GEPA 2OZEA 2YV4A 2H07A 3KV3O 4Q93A 4TLCA 4MB6A 2EX1A 4HDMB 2C9OA 1TJPB 2B34A 3NASA 1TKBA 2EVWX 5IM5A 3EPHA 3FNIA 4U5XA 4F6LA 4X7MA 2KWIA 4R1PA 3AUYA 5AUNB 1N75A 3KOZA 5LR6A 5EFOA 3WRXC 3C43A 4RXMA 1VLQA 5FOQA 1X77A 4L0DA 1M0EA 1DMRA 1R8SA 2ZRCA 2BE7A 3EMBA 3RK0A 4N6NA 2OV4A 3HFRA 4ZVVA 2GM4A 2JIBA 2XBLA 3H75A 4JJ7A 1XTUA 2HCBA 2JI6A 1YA8A 4E15A 3DCIA 5BXYA 3DE0X 5E6UB 4EUSA 2MSWA 4M86A 4BLPA 2W6MA 4D4KA 1WQ3A 2ZOSA 2FU5C 4MLPA 2XYHA 1IPFA 4WECA 2FWPA 1K8QA 3N1UA 4TVOA 1IVSA 1X39A 2O1EA 2AMVA 3O47A 4LSZA 1M8GA 4R3NA 1EVJA 3O91A 1GGHA 2AQKA 2I22A 1KDYA 1CB7A 1MO4A 2VWGA 3NIGB 3R40A 1Y4UA 4US1R 3MRVA 1AK2A 4XDGA 5E9JA 1O4WA 2P7IA 4UBOA 1JB1A 2UUOA 2J6BA 3CYFA 3L7KA 4I4TA 1RWMA 1S01A 4JGBA 1USIA 4YJDA 1UBTS 3IXLA 4NQZA 1QFJA 1RFGE 1C7ZA 3T9CA 1TTQB 1AN9A 2X8LA 4C2TA 3STVA 3TXXA 4FCWA 2CLKB 4ZOLA 2AXPA 1F9EA 2FW0A 3LT5A 5K8JB 2W2NA 1C1YA 2F4NA 5C9ZA 2VHCA 1F3OA 5AXAA 4BNLA 5FLYA 2BLNA 1TM4E 5AKYA 1NNI1 5B5SA 3V32A 4KLAA 4OFZA 3DE7X 3UAXA 4NYJR 4YMVA 5KDOA 1GRRA 1BFDA 1VPLA 2Q4TA 2W6CX 1WOYA 3MMSA 4WGFA 1RJ9A 4KLCA 1FRZA 2JIMA 2Y1LA 4WIAA 5CW2A 4D99A 2ZKIA 2AN1A 3K1AA 4EG5A 1ODLA 4D44A 4OI4A 1WMEA 2XA9A 4S12A 1KK0A 1EFRA 4K9RA 3DWFA 3O3CA 3WZLA 4XDYA 2CHQA 2H0QA 3ASVA 1WTAA 4Q12A 4Y7DA 3TTWA 2WP8J 3DBIA 3ZK7A 1X15A 1F20A 3ZHVA 2HO5A 1Y9DA 2H4HA 3HR7A 3OPQA 3A1DA 1Z34A 3QPWA 4OBXA 4RVHA 3R7WA 4YUYA 4JBGA 1C7RA 5KQLA 2O0LA 5JAPA 5M04A 1J99A 2ZXUA 2YYAA 2NXJA 5JCOC 2HOQA 1MPXA 2G63A 3VNSA 4J4HA 4DA9A 4NLLA 5IJZA 3S81A 1NNSA 3FTNA 4A2WA 2YDXA 3NW9A 2ZSHA 5FI3A 5E2BA 5G40A 4F45A 2CVPA 2XGMA 3I12A 4G0WA 2EFDB 2DETA 3W8RA 2A0UA 2W6PA 4PXYA 3IALA 2CW5A 3RYHB 1LFAA 3JAWB 1EQ2A 4IUYA 1YO6A 2C82A 2XUQA 2E5WA 3L7DA 4HN9A 1XZKA 5BYAA 4IHJA 1M34B 2WIAA 4TVBA 4DVJA 1FTQA 2X15A 5EQTA 3FOCA 2W2MA 3LQ4A 2OMKA 1HXHA 1P4SA 3N3BC 3U48A 4XYEA 1Z4MA 4V02A 2X40A 4HD8A 4JJ8A 4URWR 4TLDA 1XCPA 1AGNA 2I80A 1T35A 3I42A 4BAGA 5KOJA 4M36A 1P2SA 4PRKA 1Z8DA 3IQHX 5FPQA 4BLUA 1UPBA 3PGXA 3QKSA 4K5QA 3PUXA 4TMWA 2WDPA 3LF1A 1Z4LA 2KBFA 3PYLA 1GUAA 4YREA 3ROPA 3EIXA 3OM1A 5GADl 3FHLA 3FNHA 2PWPA 3RJ5A 2WKSA 1IDN1 3NJRA 4RXTA 3RVJA 3I58A 4O29A 4LV6A 4A0FA 4BYMA 5K45A 4KQEA 5JAUA 2H1WA 4QE3A 3TVDA 4DF3A 1V4BA 3LVFO 2E87A 2ZITA 1VMEA 4LK2A 4PZLA 3M33A 3Q3CA 4XEHA 1PGOA 5J2UB 3ZWDA 5BV2P 1TK9A 1A2OA 4UHEA 5BR7A 4UD6A 3QOYA 1J20A 4H7EA 4LEIA 1V1JA 5TS3A 2DU8A 4LGMA 5EHIA 2PBLA 3LHFA 3OD1A 3UMRA 1ECGA 4DRZA 2CNLA 3PE4A 5IEJA 2IH5A 4LQDA 5LSAA 1R4MB 1ZM4A 3KU4A 2QUBA 2P65A 4Z86A 4U2GA 3ZCQA 5DU2A 5F5XA 3ZE6A 4YVFA 4RW0A 1G59A 1EBBA 4ITRC 2OHGA 4DDHA 4D79A 1JHVA 1G5PA 2XUFA 1RVV1 2J30A 2RK6A 4LHEA 3UNXA 2JKYA 3VYVA 2P1ZA 2ZCVA 3AR5A 2YFQA 1WSWA 3NBAA 4HDNB 4B3IA 3BSFA 5D3ZA 4ENRA 3QX3A 1ZD3A 3SJAA 1WG8A 1T5LA 2JKZA 2YL2A 4PZYA 4C7VA 4WZ6A 5KWVA 4BVGA 4YX9A 2HR1A 2TS1A 1EQAA 4JXXA 1BCSB 3DO6A 3THRA 4FT2A 1H2XA 1UMBA 2E3JA 2WZQA 3QLJA 4CEHA 4AU1A 1D9ZA 3OAAD 4RVGA 4TKZA 4AKGA 3K30A 1ZLXA 1U9IA 4TV9F 1VB5A 1MQ8B 3F67A 1PS8A 2D1FA 5K8TA 4G1FA 2PIDA 3H2IA 3O95A 5EOVA 5LOVA 4ZVOA 1L5QA 3IS3A 3UFXB 1ONSA 3KHTA 4PR0A 3OJEA 2Q6VA 3MOGA 1QRSA 2EKQA 3G5UA 1ZCAA 1C30A 4D9GA 4X94A 2GUWA 2PGOA 5G0UA 3ELDA 4ZT6A 1PCXA 3A1UA 3HEBA 3KL2A 4RMHA 1Q6YA 1PYGA 2QN7A 3EPRA 3MCWA 4L22A 2P8SA 3W6UA 3AXTA 3AUFA 1VJRA 2WTEA 5KOHA 1JN0A 5EQFA 4QUHA 5KJEA 2WY2D 4A23A 2D8MA 5A5GA 1Q2XA 2IHYA 2ZATA 5FBQB 4D8WA 4XJVA 4N7RA 3QUCA 3L5KA 4K6KA 1DEXA 4OOFA 1TZKA 4OXNA 4PSVA 3WB0A 3KETA 4YDSA 5AW3A 2C1EA 3ZV7A 5CA0F 3R7NA 2VT3A 2GRUA 1DX4A 5ALIA 4B6GA 1LX7A 1QVVA 4OYHA 4B31A 5LQJA 3QPCA 4K26A 3RIEA 3K9GA 4DBLC 1XNJA 2NZ2A 3A4LA 3K9WA 1WSBA 1G20B 4OHZA 3L7AA 1YB5A 3RLIA 5E4YA 1WPGA 1PR1A 2GCEA 2OYRA 4P3PA 1GN8A 3MSXA 5ALVA 1CUDA 4DJTA 1XIVA 5ADUS 4F8YA 1RMQA 1CE8B 1PW7A 2QP4A 2J6CA 3B1KA 5TY0A 4Z4GA 3DNFA 3OJXA 1AKTA 1V71A 1Z36A 2FVXA 1PGNA 2G28A 2YOFA 3P9ZA 3EPJA 1YUMA 4HDKA 4K0RA 3ND7A 4E0BA 5HHTA 4S1TA 1YVRA 4OIMA 4B87A 2VHZA 1PFVA 4G5HA 3B70A 2OHIA 4UTNA 3P20A 1P1HA 3B1ZA 2PRJA 3A1EA 4TLAA 1V9LA 1NJSA 4DMKA 4IDCA 3F98A 3RYTC 1WA5A 2WFMA 3D5TA 5ITZB 4FFSA 2BJVA 1D2EA 4F6CA 1UBEA 1ZKMA 5H1YA 2ZTSA 4RX1A 2J33A 1KAHA 1X42A 3PPXA 5I7SA 4PZPA 2HTFA 3I6QA 3CE9A 4RHUA 3PGJA 2GBGA 4C01A 2ID7A 3DPSA 4ZI5A 1H3NA 1QORA 3FFBA 2QE7A 1B8UA 2C5GA 4W7IA 4IYRA 2BHSA 1O89A 4L9WA 1UT6A 3M49A 3O4FA 4TRNA 5T3YA 3VSEA 4G81A 3QLEA 3VZDA 4AJ9A 1OB5A 3ZKWB 4MVJH 2Z2YA 3I61A 2P2DA 2II6A 2G9NA 5EE9A 3NWOA 3KB1A 2RH9B 4PIPA 3OMXA 1II0A 5F21A 3EXFB 4NTZA 2GSDA 2W2LA 4F85A 1JH9A 3PDIB 1A2BA 1NBAA 3AKCA 3OFJA 1RTKA 3KJIA 4BAUA 1CPYA 1S7CA 4EJFA 3BJZA 3KVRA 4ZYLA 1XZQA 5JS7A 1JIVA 1QG4A 4Y2XA 3AFHA 4NARA 4FYHA 2XQJA 1HDOA 4MKFA 5EE3A 1KJJA 1NVAA 2JPDA 1GZSA 3NYRA 4WERA 5KAMA 2W22A 2J0SA 4UMEA 1MCZA 2ZRIA 4JP3A 3AHHA 4JVSB 1Z5ZA 4GPEA 3UUFA 4ND1A 5IKOA 1QS0B 2AW5A 2NQ8A 4Y6QA 1UBKS 4RIEA 3RIHA 2QU7A 3E1SA 4Q4DA 1IBSA 4MARA 1X8JA 3DUFA 2NXNA 3ECCA 1KDVA 3ZK9A 2IIQA 2QGZA 1MAUA 3KTFA 1F60A 2JH9A 4OI2A 3IEXA 1FOEB 5H70A 3UM9A 2CXNA 4JQYA 2OORC 3IAEA 5DZSA 1H2RS 3AVPA 4EENA 3C97A 4MQ6A 5EIHA 2C59A 3GJRA 4MVJD 4KPGA 3PCRB 1CJUC 1Y1KE 1JALA 1MO2A 1PFYA 1Q7RA 4ZU1X 4BJ6A 1HYGA 5EXXA 4P35A 5KTPA 3JAKB 1ZIXA 2I33A 2IP1A 2XADA 4I9FA 3BJRA 5JWHA 2BR3A 3R7BA 4DR6B 3GJ8A 5LYJF 1ZQ9A 2B8TA 5GONF 2O8EB 1CQIA 1DDGA 1P75A 4MP3A 4LF4B 1Y3IA 1NZFA 3FNQA 4AJJA 3J7TA 1IHDA 2GJ4A 3PX7A 1BS2A 1GV0A 2P68A 2REBA 3OP4A 2IEGA 3T7TA 2HT1A 1L9XA 1ICEA 4HWGA 4ADSG 3VOSA 4DR1B 4CTKA 3KX2A 1NWCA 3PEFA 2O3RA 2COEA 3ZLBA 1ECBA 2DFNA 3TTXA 3ROMA 1D5CA 1JHUA 4HWTA 1AHHA 4O4JA 3T3GA 3BK7A 2G1PA 5E3IA 1LDNA 5DYIA 2L69A 3TGWA 4ETMA 5AW6A 1TQ4A 1FS4A 4RHTA 1Z4NA 2RHOA 3DBRB 2C58A 1QGDA 3M82A 4G5RA 4I5GA 1W19A 4G8CA 2C2XA 4P5PA 4Y2TA 3ZZ1A 3WNDA 3VC7A 3HYNA 3AKEA 3VC1A 2V7QA 3KSAC 1C8BA 1XMVA 2VRWA 2XMRA 1APBA 2WA2A 4JJKA 2C78A 1H69A 2JF0A 4O0MA 1CTQA 1K3UB 3PQ4A 4B4UA 1FE8A 1ZY2A 2EJUA 3C7TA 2F1KA 5IS2A 1GU1A 2CDBA 1G21E 3M0EA 3AESA 1V1MB 1PF7E 1V4VA 2NUPA 2E4ZA 2IUFA 3LY5A 4YLEA 2C3PA 4WW0A 1L4BA 2CJPA 2BDEA 1JLRA 2UZ4A 5LQSA 2JLQA 4P58A 2O1XA 4DUGD 1PTKA 1HOXA 2RHTA 3AQ4A 3G2QA 3ZI4A 4WUTA 1D4AA 2JI8A 3L40A 4N0PA 3PR1A 5FNVA 3MGKA 2QR5A 4GC5A 3IO3A 4S24A 1NC3A 2PUGA 4HC4A 4DJJA 4PAQA 4DIDA 4C2AA 3DP7A 4C14A 4EX7A 3B2NA 2PX0A 1A9ZA 2JAWA 2VXBA 4B45A 1GTMA 3HB5X 4MV9A 5C8YF 3ESXA 2EU8A 4CW7A 5AVQA 3R41A 3GYGA 1J8MF 4EY8A 3ETDA 3LFTA 1YZHA 2G3YA 2WU1A 4Y1RB 5EKXA 3F47A 3FSRA 1TT5A 1TIKA 4YRGA 4PYQA 1XZDA 3CMCO 4LJ8A 2ZS7A 3GCDA 3K7EA 3QQPA 4KUGA 4HX2A 1VCOA 2ZE5A 5AM2A 5TF4A 3O73A 4DSTA 2BD0A 4GZ3A 3PHIA 2JHPA 4IQ0A 4A0HA 4CDMA 1JA1A 4UAUA 5EIOA 3S3TA 1LDMA 3RUDA 1LBEA 4ND4A 4IDEA 4IDDA 1CR2A 2C42A 3OE4A 2IBMA 1TQ2A 1T43A 1UJBA 4KO8A 5EXTA 5BRJA 5IG2A 2YY5A 1NW3A 3U4MA 1NQUA 3A37A 4Q47A 4QPCA 1P5JA 5JNRA 4KPYA 3W4IA 1H66A 2JLCA 4O4LB 5I9NA 4D7AA 2MOKA 2OEPA 3NXKA 2G1JA 4BO6A 1ZH0A 1IB0A 4H7PA 2QLBA 4BZPA 1GQOA 4RKQA 2G72A 1H2EA 4RTMA 4ZARA 3ZNPA 5B1EA 5K0CA 3F8TA 5LIRA 4E13A 3GUUA 3DAYA 2CLLB 2P9CA 4HFRA 4QOIA 1ESMA 1EJ6A 1EA5A 4B76A 1A7JA 4KDRA 4R3UC 1J42A 3FVVA 1OROA 3PV0A 4H3HB 4LSGA 3PA8A 3DWEX 4AUKA 4B4KA 3I0ZA 2V5AA 4W9MC 3DAPA 1CDEA 1RD4A 1CQZA 3BCRA 2GAIA 1C7EA 1PSDA 3EDYA 3KLOA 1WCV1 3W7BA 3WRYC 3ZDRA 1JWLA 4LKOA 1RHKA 2QM0A 3ANLA 1TA9A 3CB4A 4OHUA 5A0FA 1NVXQ 3K16A 2DTXA 3BOSA 1LPNA 3NHJA 1E7WA 3AVVA 3PDUA 4I19A 4IQ8A 4DPKA 1Q16A 4MR8A 4MICA 4EMUA 2PQ0A 1SBYA 1MQSA 1OWOA 1YZYA 1U0GA 2DPXA 3LCRA 3OOWA 3HYTA 1DAEA 1MDBA 1V7ZA 2YQ4A 3LXRA 4UCFA 5IYZF 3TGLA 3QFRA 3R4CA 1E2UA 3OKFA 3KKOA 1ISMA 2W98A 2ZI7A 4HSEA 5EIXA 2KLHA 1Z28A 2VPIA 5BQPA 1QK3A 3A11A 1S2OA 5AKIA 3CLTC 2PK3A 2YJZA 3AOGA 2HUNA 4FD3A 3TD2A 2FN9A 4C1BA 3AB3A 2HMVA 3I9MA 1I2CA 2OCPA 4NU8X 3WYAA 1JPVA 1XXHB 1DE0A 3PF9A 5AI8A 5HKBA 4H3SA 4X85A 3I1JA 5I7WA 4Y6GB 3ZQJA 1Z0UA 1Y37A 2LGJA 4KX3A 4WXRA 3A1FA 1W0JA 3RYIB 2I8AA 1X9HA 3EQ8A 4L85A 2YW2A 2JFXA 3WV4A 3ROKA 1S8NA 1GYRA 3C3DA 1PG2A 5AH0A 4GPTA 1SCBA 1VIMA 2EQAA 1L3IA 2RHWA 3EGDB 4P2BA 4CG3A 2VJCA 4DEYA 2P3SA 3U3ZA 2G5TA 4MA5A 3A1NA 4DLLA 1EDEA 1E3TA 3KXPA 5AKXA 1NLFA 4MW0A 2MHCA 1Z2DA 4PGGA 3C8DA 3CKKA 3WHIA 4QDXA 4KSCA 3NIWA 3VTFA 2FN7A 4HZUA 1A9RA 2BFBB 3CLKA 3EARA 2XCIA 5TT0A 5LA6F 1XX6A 1WZEA 4I55A 2GCNA 1OASA 4MO2A 2J6IA 4NMWA 3B1YA 3G2PA 4BJ5A 4NOKA 4K28A 2VK4A 3QVVA 2ONJA 4E32A 1YS2X 2ZQZA 2PWYA 5HIAA 3U7IA 2GBLC 2PZBA 3H97A 1GZ6A 4AJPA 3RQSA 1RYZA 2C95A 1VHWA 4IH1A 4A5OA 1UXJA 3FSGD 3MGCA 4CMIA 5FWYA 4U7GA 1LPMA 1C3XA 2WSIA 3JZIA 2ZFUA 4MYRA 2BH9A 2BKVA 3FCOA 2NTJA 3HBFA 3LPCA 4UEQA 3WA6A 2Q2WA 4JT4A 2HRCA 3ER9A 1SA0A 1BWQA 3E35A 3ENVA 3MWYW 4HGQA 4S0ZA 5DTEA 4DW8A 4EQZA 2OL4A 1W30A 1ACMA 4D8VA 2F9LA 3KK0A 1ELOA 1IAQA 3J80A 3LG2A 4X1KB 4FI3F 5BQOA 1D6NA 1P0CA 5CVTA 2TYSB 4GBED 1WXDA 2QE6A 4DCJA 1C50A 2IZ1A 4M21A 4MUXA 3TTSA 1G63A 4CXMA 4KK3A 4BCBA 2PGDA 3HKEB 1S8FA 2GZAA 3CRVA 1OLSA 4M53A 3REGA 2ZRPA 1W36C 1VCIA 3KQSA 1C29B 1FSPA 3WAKA 4S05A 1K92A 1KH2A 4HO1X 2AFHB 1T6NA 3CZ5A 4GR5A 4PQGA 2PKCA 2XMQA 3AILA 2JFYA 2ZT8A 5G41A 5FT9A 1SD2A 5GJWC 3AWDA 1NQWA 2G77B 4NXMB 1JL3A 4U9IS 4IGKA 3U4HA 2IYNA 4G4IA 1Q15A 1HY3A 2AR0A 4IFTA 2JGMA 2LNDA 3BAFA 3I9NA 3MB8A 1O03A 3QE4A 1ZGHA 1WMBA 2PWBA 4O8CA 1M6YA 4BB0A 3FCYA 1MA0A 4UMVA 3HI4A 3LJKA 2WJPA 3QELB 3SMQA 2Y2UA 3DD5A 4UM7A 1CUZA 3WYDA 3JQBC 3LLCA 5HWSA 3AV0B 2WKPA 1K9VF 1RZRA 1QFXA 1TE2A 3NHRA 2VRNA 1UJ2A 2V7XA 2VEOA 4WADA 1G5FA 5EVCA 2WU3A 2X2OA 3OETA 2IQ5A 5FFMA 5BSGA 5JUWA 2R6CA 2ZUBA 3DB2A 3P32A 4IIJB 4BECA 4DNOA 5HRCA 2QLLA 1N5IA 3B38A 2L2QA 5DI3B 4CEJA 1TKCA 4GZ6A 1OXSC 3JQAA 5F3DA 3RVDA 5FTLA 1F2DA 1GPNA 1S3SA 1X7ZB 1LNZA 2W8ZA 3B6JA 4OEHA 1GFZA 4WE3A 2JLVA 2WJGA 2MINB 3WLFA 1Z7EA 4X41A 1PE0A 1SU8A 3EWNA 1GPH1 1P0MA 3FYCA 4BUZA 1QAMA 2WAOA 2YN0A 4MCAA 2D62A 1EUDA 3UJDA 3NBYC 5BSEA 4OXYA 3ZD7A 1SOUA 1G9SA 5DBIA 5FWAA 5H9VA 2R7NA 1ZLYA 1KRHA 3Q98A 3U1TA 3TG8A 3HBJA 3ESZA 2FFQA 2WAAA 3FCXA 3Q7RA 1MTOA 3Q9NA 4G1CA 4I6EA 4EABA 2O0MA 2QMHA 4FEAA 4ARBA 2IH4A 4WD3A 1K3TA 1AXRA 3X2FA 2LRHA 3BGVA 4C1NA 2LIPA 4U6SA 4DA0A 1NF2A 1WVGA 2BUCA 5IK2D 3VKVA 3Q5GA 5A5VA 1XEWY 3GAZA 4NYIR 5AVJA 4D9FA 1VHLA 4QVKA 5JNTA 2AX4A 3QLVA 2VZLA 3L4BA 4R2LA 3ZGNA 4KVFA 1XRMA 1Q5PA 4GF5A 1CW2B 1ZS9A 1C7JA 3SS8A 1MC5A 4AVYA 3TXYA 2R8PA 3IP5A 5ER9A 3ZY2A 4OJYA 4HY3A 1PV2A 3NWJA 3D4IA 1J8QA 3LDGA 2GZRA 3CF4A 4RGVA 3UXEA 4EMTA 3EE6A 1NPYA 1JPJA 3GH1A 4B7UA 2I7DA 4RA6A 3THSA 4QFCA 4AUMA 3WQQA 1ZMRA 1XZFA 3G23A 2G9ZA 3BD8A 1IOWA 3M7IA 2A9PA 2E9SA 4HP8A 5FTWA 3RF7A 3WYBA 4PYNA 3C3KA 4YPVA 5CYOA 2XLBA 2YWDA 2YTZA 2XE7A 1R5NA 2ONZA 1HUQA 2ZIGA 4IIDA 4TTQA 5K8VA 5AK6A 3CBGA 3U4QA 3KL4A 4FONA 2HN9A 2H2IA 5TARA 1NNEA 5BN4A 1NF8A 5IMBA 4F11A 1PGQA 1I32A 2VDJA 4TKLA 4OU4A 3NV7A 2ZI6A 4MJ3A 4FU0A 4LK3A 3ESAA 3QJGA 4INAA 1U0BB 4HGPA 4ZVLA 4X64B 3UZUA 4U1RA 4BZWA 1LUAA 2AEMA 1KI6A 2W00A 2JDIA 2E1RA 3GLHE 4CM9A 1OBHA 1R4NA 3TUJC 3D7KA 2EP8A 2I87A 5J2TF 5K7SA 5L3ZA 2ACVA 3G17A 1T0PA 2ZTHA 1XAGA 4DCGA 4Z7JA 4OSPA 2HB6A 2PV7A 1EHIA 5DBFA 5BOVA 3IYLW 3LKVA 1P4AA 2ALJA 2VXCA 4ZI3A 3VBCA 1IONA 2R87A 3O8OA 4JFRA 3ZHSA 1AH2A 4S1VA 4UNQA 5HUJA 2C9BA 2BFEA 1VJ0A 3AEZA 4NL4H 4RKYA 2ZIEA 5CG1A 4BNXA 1Z5UA 2WSYB 3U3RA 2YWBA 4U7PB 5ICFA 3LF2A 5CPBA 5DULA 4WOPA 3WBBA 2AOVA 3OZFA 4B81A 2W42A 4R2MA 4C5CA 3W5SA 3MFQA 2WF5A 3A9UA 1KO8A 1QDUA 1MPTA 4QATA 2EW8A 1E3WB 3B13B 4GXRA 3NS7A 3N8DA 1M2OB 3FPGA 4HNUA 1JLLA 4A15A 4FEGA 1AJEA 1TM7E 3INNA 3E9CA 4YRKA 2R86A 3V7UA 5CR9A 4AT1A 2JVJA 4M7WA 4W8HA 1U0FA 1MO3A 4LZZA 5BW5A 3ER8A 3TLXA 3UWKA 4X00A 3R0ZA 1NV9A 2JFUA 5HJ5A 1NUPA 2W6ZA 3DG9A 3GGGA 3OIVA 4FILA 4WKGA 4Y9DA 4DNFA 1ABBA 3THXB 1ND6A 5EJIA 7GPBA 1QLHA 2Q4OA 3SX4A 5EZYF 1OSNA 3B7PA 4DG8A 4Q3AA 2AX3A 4P4GA 4DWVA 5I4CA 3LRPA 5HZHA 1CF9A 3GDFA 3S40A 3K2EA 1HLFA 4B2IA 5DWQA 1FNDA 4C3UA 3TLZA 3BXPA 3EBLA 3KSBC 4GPIB 4MWSA 4TLBA 4A2CA 1MNAA 2ZE7A 2J87A 1SRRA 3TZCA 4DHEA 4OY3A 2FZLA 5GWXA 1OX4A 2GPJA 3QA9A 4FWBA 4DR3B 1M7GA 4R1SA 4YMHA 3BFVA 4Z3KA 4DKJA 2WUFA 2AB0A 4LVNA 3AEYA 3SHOA 3B1JA 1NP7A 2G0TA 3QF4A 4UREA 1Z2OX 3D6MA 3FVTA 4BNTA 1ES9A 2PA3A 1Z8HA 3N87A 3MWFA 1A2KC 3X2SA 1KSFX 2X13A 5AI0A 2P3OA 3QXXA 3SEAA 5AXCA 1X7WA 3QUTA 4BXOB 5H4GA 3SIPA 5A0TA 1C14A 3FUVA 4D8TA 2HLDD 4COKA 5E4JA 3WNVA 3JQ7B 2OE2A 2QPAA 4OVKA 1K0FA 3ABIA 1NV8A 2WF9A 3KAKA 3PBKA 3HP4A 2QNIA 3FDFA 3N86A 5G1PA 3DLAA 5E9AA 2PFKA 2F9FA 2HV8A 4JI8B 1U7HA 3HNOA 3L7CA 1QB8A 2WZBA 1AGRA 3KVVA 1DKQA 4GNKA 1ZK0A 1NZDA 3EGXA 4FQ7A 2PH3A 3H9QA 1NY6A 5CH3A 4A91A 3AR4A 4C4RA 5HUHA 4MB2A 5D5QA 3ESBA 4NY1A 4EFMA 2GD0A 4Q4CA 3D2BA 2B5VA 1ZRNA 3TBKA 3R8FA 1UBFA 1FX0A 1VE1A 2W6IA 1RS0A 2IXTA 3E82A 3GLQA 2OD9A 1JZSA 5KX5A 3DHWC 3KCQA 3E3MA 3SOZA 4EG7A 2SICE 2D7DA 4B5KA 3MW8A 2GAOA 4PPFA 2Z0MA 4YQFA 2OB2A 3ROXA 1RWQA 1X1TA 4R1NA 2AZMA 2R1TB 2V3WA 1DIHA 3ABZA 1QH9A 1X1SA 5JI3E 3CLVA 3WK5A 1RYHA 3RFTA 3ZWVA 2UZ1B 3DMNA 1RYDA 1NKSA 4NG5A 5FUXA 3R7DA 1BEEA 1RKXA 3PGKA 5BNIA 4ENWA 3DEAA 2QVLA 3LDFA 4LY3A 4C7OA 1T5HX 1EVLA 1W85B 1AUPA 3AUJB 1VSQA 3CFYA 3DZCA 3PDHA 4OQXA 2B4RO 4CIVA 1T0IA 5AI6A 3I05A 5GM1A 5TMEA 3NBMA 1E9RA 2PN1A 3ENNA 4B32A 1S3IA 3DQPA 2G7MC 1JUDA 1WCYA 4GR9A 3KTAB 3ED1A 1L2TA 4LTNA 1OWMA 4CPDA 4NI5A 3ORHA 1E6KA 3FVRA 3V1MA 1R12A 1UMCB 1RWNA 2IXDA 1REQA 2JAPA 1XZ8A 2ZRHA 3Q3IA 2XMCA 1W8DA 5A4AA 3R9XB 2ZRJA 3T4PA 3DT9A 3BJMA 1GZDA 1U6JA 4LF9B 1FTYA 3NHKA 4FFNA 5CYGA 3CX7A 1QYVA 4KXXA 5JNSA 1X2EA 1WW3A 2OHVA 3I9V6 3N2GA 1I51A 1SELA 1DEOA 4TV9A 5EY5B 3P96A 2C3UA 4EOGA 1ZJWA 1E6UA 1IOLA 2A9JA 1PR5A 2BIFA 1YDEA 2NO0A 1VLJA 2QZSA 3CT4A 3DULA 3UMGA 4D45A 3U3DA 1EXNA 3E58A 2ZYVX 3ZH9B 4LQ4A 4P7FA 1XL1A 2NVUB 2JZNA 1OKKA 5AW5A 1XTPA 3IEUA 2YRWA 3VQTA 3MINB 3U62A 2GESA 1BHQ1 1GXSA 3WIUA 4GDMA 3UAZA 3PQDA 2WHXA 4Q7JB 5CM8B 4RFSB 3I2YX 2I99A 4NNOA 5FR2A 4PHTA 1DBWA 1WMSA 3ZWNA 3L6UA 1QJCA 4AP9A 2ZSJA 5SYNA 4BMXA 1M2VB 3PXGA 3N74A 4F4DA 1EVIA 1GUYA 3U7FB 5CA0A 4V03A 4IO1A 4IV0A 4MB0A 2Z30A 1WO8A 3IUPA 4C2BA 1WMFA 3SMVA 1UKBA 1IY2A 3QXHA 4MCIA 4EWLA 1RU3A 2JZOA 3DHNA 4MZDA 5BXQC 2LP4Y 3U13A 5DN6D 4EW2A 4RGBA 2CLMB 2UVQA 4FMCB 1C41A 5TGTA 1Y1RA 3G79A 5D86A 3V2IA 1B26A 3SOPA 3H0KA 2WG1A 3CS3A 1GKUB 4DJFC 1PT5A 4ARZA 1KY2A 3NDIA 1V7CA 4GLOA 3JD2A 2RH8A 4MQMA 5A7GA 2TMYA 3UT5A 2C9MA 5LFAA 4W5QA 3O8RA 4W1SA 3IPCA 2RK3A 3TLKA 3TI9A 1XTBA 5C1BA 1TQDA 3DV0A 1J70A 3LYAA 4RAQA 2PMFA 3HKCB 4AMBA 3WP0A 4NBKA 4J1NA 3GLUA 2ZYIA 2FJ0A 3EVDA 1T2FA 2VS1A 1UJ4A 3NLLA 4QYXA 2AWNA 3AUKA 4F93B 4I66A 3SXJA 4Z0TA 3H5RA 4LA4A 3T99A 8ADHA 1DB3A 2HWWA 4IR7A 5FYDA 2QW1A 3B8EA 1A5SB 2XNCA 2Y0PA 3C16C 1X86B 2E4XA 5AW9A 5AOBA 3RT9A 4N6OA 1FDTA 2V3CC 5KQPA 3LLVA 1MB0A 4MDHA 4TS4A 3U80A 1KZHA 5AIBA 1NUAA 4UM8B 4P82A 2VLIA 1YKFA 2HPAA 3COVA 1AUVA 4ZI7B 2PKRA 1Y1QA 3TZBA 2NTYC 4OF4A 1JIQA 3OUUA 4HH1A 4UFPA 5K9ZA 1JHDA 1JEQB 4IVNA 2A67A 5K3EA 2ZJ5A 5ESDA 5BNZA 2Z5FA 3BXHA 2ZBFA 2HDHA 3HVKA 3ZE0B 4A2PA 3JRNA 4BKPA 2GLTA 4XCVA 2I6UA 4DXAA 5CITA 1OFGA 3KKNA 4IDNA 1D7OA 1I4OA 5CJ2A 5FV4A 5K3BA 1QJ4A 1Y8RB 3LY7A 5IWCA 3MBKA 4JYZA 2IEAA 2H2DA 4JYCA 3UPUA 4ID3A 4CLOA 3BD9A 3QFFA 3QNUA 4LJRA 1JR6A 1BSVA 4B1FA 4B2PA 4LJ7A 1OYYA 4NIMA 3AM3A 2QN1A 3ROFA 4BUJA 1R4AA 2H5JA 2OV1A 3DZBA 3KFLA 3TIIA 3HXTA 3ZZUA 2CK3D 2GRAA 2YH2A 3HP7A 3V1NA 2Q2NA 3BQ9A 3K8QA 1K8YB 4QBKA 4L78A 3ZUPA 4A8PA 3B85A 5K6RA 1IUKA 3U16A 1R6BX 5FBHA 3NCTA 1B0PA 4YJ3A 1XAHA 1FRNA 3K2IA 5ES4B 3OFND 3WO0A 2JCXA 4CJXA 4PQRA 3V4LA 4UHCA 4ZODA 2IYWA 2P67A 4J16A 4AZSA 1KPIA 2H63A 1MT3A 4MV1A 1XZAA 2EG5A 4A8TA 4G89A 3WNQA 5GJVC 5P21A 3VH2A 2GXUA 3WLHA 3HY4A 4RMIA 3HA2A 4HX5A 4RA9A 3QE9Y 4LRTB 4D5EA 3QGMA 2ZRNA 1RPNA 1J07A 2WABA 2C7OA 2F3SA 1OX6A 4Q16A 3PUIA 4MI6A 1EM6A 1W8IA 5EIWA 4ND5A 3ZWKA 5LYJA 4EJSA 2C31A 1M6WA 1QGUA 1QIGA 1SOAA 4W1PA 1ZYUA 3TZHA 1IJFA 3AZQA 4FZ3A 4LVUA 5DF1A 5M34A 4AY6A 2F55A 4PYKA 4Z4IA 3E6AA 2FX2A 2YXPX 4EHLA 1B73A 1TO2E 2O7RA 2DE0X 4HQOA 4F2WA 3RAJA 1D2MA 1XQWA 4ZDWA 2VRCA 1LK5A 2NU6B 3JVDA 3IPRA 3C3AA 3SY8A 3EJ6A 3ZUGA 4JENA 2ORED 4PX9A 1UBHS 3V3KA 1ZVKA 1ZPDA 2IZZA 2RG7A 3OSZA 4R6XA 5TEWA 4YRBA 5B7QA 1AZLA 1FP2A 4HH4A 1YQUA 3TQRA 3Q8KA 4JP1A 3R9WA 2VYVD 1U8TA 3AHFA 1OLUB 3R5TA 5AJYA 1JTVA 1VIDA 4AYWA 1M75A 1ESCA 1E4OA 5D87A 4J90A 1V8ZA 3UAGA 1L1FA 2HHLA 1FDRA 3E9MA 1I7PA 2WFAA 4G2TA 2DPMA 1QNFA 1T9GR 4OFXA 2QNBA 4MIEA 4CL2A 1UZNA 2WE8A 2IY9A 3EPPA 4KMOA 2ZIWB 3WGUA 2FB9A 3GFFA 5T4EA 1FQKA 4HB2A 4W8OA 1PLKA 1D0IA 3FYSA 3T35A 1CDDA 2G4LA 3QVSA 3HCWA 4BKUA 1VM6A 2GBPA 1VE9A 1YFZA 3SLRA 4NPHA 1DBIA 2BHNA 3DL2A 5IUNC 1Y89A 2QM3A 3WTCA 1XDZA 4RZXA 4IMJB 2RI0A 4UBIA 4Q9LA 1XWIA 5E2AA 4N5DA 1VE6A 4KACA 3ZNOA 4ESOA 4ZDKA 5CEEA 1SQSA 4DSNA 1PL7A 2JFWA 5JFTA 2QX4A 3CH5A 4XEUA 5FLEX 1D8AA 1GPDG 3UKOA 3EEBA 1QDLB 2NO9A 2ZP1A 3K2BA 5KPDA 1JEOA 1O0SA 1D1PA 3CPSA 3RUEA 1YAJA 2Z6UA 1IY8A 2AKEA 3K96A 2O2ZA 4WLOA 5C8YA 1G21A 3RUAA 3B5EA 3EXHA 1ZK2A 3V00A 2P9EA 2XX3A 2OO5A 2WWGA 5TX7A 2HQOA 2PSHA 1G38A 5KX5B 1CRQA 4GMGA 2IUSA 4H3VA 1GPJA 1JR3E 1ETUA 1TA0A 2NO1A 5TQVA 1LWOA 2Q41A 2YS7A 2OV3A 1W88A 5JATA 4UAVA 4ZVNA 5EUCA 1CZRA 2NM0A 3IIKA 3IL2A 1SUFA 5LUBA 3W4JA 1AUQA 3HHPA 4M98A 2EJBA 3UEOA 1MXHA 3ZVKA 1BQ4A 1GGVA 4I50F 2WP0A 1ZXBA 2YZGA 3TNFA 4Z9AA 4UMDA 2OILA 4TKVA 1Z5PA 2J5QA 2GK6A 1AQNA 4MINA 1PFKA 2QVBA 1GQFA 3LX6A 3CUEF 5EWJA 2HA4A 2C83A 2Y05A 4I9NA 3NALA 4MWOA 2CNDA 1WDMA 3T1VA 2R6ZA 4EL0A 1G60A 1WV0A 1PWEA 1BMFA 1ESDA 2OK8A 4C6SA 2VDQB 3V8QA 1HA3A 3LC0A 4W7HA 1G2OA 1J2UA 4V0QA 5CBPB 1I3LA 1Q2UA 3EVAA 2PD4A 1PT9A 2WHYA 1JJVA 2DZDA 3LK6A 4WY8A 3O7WA 4EI7A 2O2XA 1IHYA 1IHUA 1KXZA 3H4VA 1O9GA 2HADA 2QX8A 4AY3A 3AEUB 3QEMB 3U09A 1ZFNA 5L40A 4BMPB 4RF3A 1AIPA 1NLYA 2I4IA 4QGHA 4Q1DA 1N2CE 1ZC4A 4C04A 3MJEA 3PNOA 4JSRA 2JFHA 2IXBA 4B75A 1YULA 4KQHA 5IYZA 5T5QA 1V95A 1WULS 4GMFA 4JT2A 4YBRA 2Z1DA 1PS9A 4TQ9A 5IBRA 4EF6A 2Z5VA 1CV2A 2C97A 3AKYA 4N0DA 1N9ZA 1DC3A 2OCBA 3GJXC 3QKWA 4PQEA 1CIJA 1E9DA 1GG8A 2HREA 3CZMA 3F9IA 3IX7A 3RGWS 1EDDA 1FXWF 2C07A 2GHQA 2XXAB 2JK0A 1FVFA 2OQ2A 4M89A 4BO5A 2FUG6 2I2DA 3KPJA 4WK6A 4WK4B 3EG5A 3RIXA 3CKMA 4ZYVA 3O3MB 2WSSD 3VU9B 3IDSA 1YQGA 1E5LA 3HUDA 4Q37A 1PL0A 3TZKA 3WL4A 1GUBA 2JL1A 1G5RA 4K9KA 4R7ZA 1VYTA 3IQEA 3ZBQA 1VBNA 3VO1A 2JCBA 3GGSA 4CMEC 3I30X 4GXQA 4C7KA 1YCHA 2BUBA 3LIPA 1O1YA 1GKLA 1N8KA 2J9ZB 3CGGA 2CFCA 3ONEA 4KGZA 4ZEOA 4Q24A 3B36A 3G1UA 4LXXA 3FJYA 3ACDA 4OP1A 2H51A 1SZPA 2G36A 3SGLA 1B0AA 3RC8A 4ZAZA 3H9UA 1T1IA 2W0SA 2QRGA 1F12A 3VO2A 1G8HA 5TS2A 4CG0A 1XG5A 3GRVA 5LA6A 1K66A 1ZM3A 2IDKA 3NHAA 4PAGA 1XRLA 2BJHA 4XOUA 2DBYA 2E21A 4YI3A 1AQYA 2VNKA 4JU8A 2I6GA 4YCSA 1Z2EA 2UZIR 2X5KO 4LYFA 1FUIA 2Q5OA 3DZHA 1TF2A 3ZD9A 1NSTA 2B78A 2PMBA 3JX9A 5EHZA 2YV2A 1JAIA 3G2NA 3OVMA 4GVPA 2QM8A 1QIIA 4OYYA 3RANA 4E1AA 1LPSA 2IQIA 3IV6A 1K4YA 5A4FS 3ETJA 2OHOA 2PX6A 2QT9A 4YH1A 4GZMA 2I3AA 4LTDA 5ENZA 4EKYA 4FGZA 3CVUA 3JYLA 1HLPA 2W71A 2V0CA 3L2OB 3M81A 4X20A 3RHTA 2WM9B 2WTXA 2M6RA 1HURA 4EVQA 2EBHX 4L8GA 3RIYA 2Z9BA 3VZSA 3W5AA 2GUGA 1IZ9A 1JE1A 4MVWA 4RF5A 3CC8A 2PR7A 4Y1GA 3TQIA 3IE0A 3S1SA 2F2TA 2ZUEA 1BVRA 3KYJB 2C54A 3O1HB 1QPGA 3QLVC 3GLIE 2YJ4A 3L4BC 4N47A 4I4TB 1P91A 3DFMA 2JJ2D 2WG0A 3PWTA 4E14A 3H19A 4GH5A 2RKWA 1I0IA 3IEKA 4HDAA 3HDYA 3RSQA 3E2PA 3WMGA 1XJQA 2EGUA 4ZOLB 3WA7A 4Q7LA 2CL6X 3PFHA 3UAOA 4ND8A 2NSJA 2I1WA 2XITA 4DGQA 4O4IA 3IBTA 1XP8A 2ZSIA 4IOJA 1XVIA 3IPXA 1E9AA 3M4XA 3Q11A 3UFBA 1OA1A 3DNPA 1M66A 5GP1A 5I8WA 4D9MA 1W44A 1W94A 3AHIA 3D43A 3GJ5A 3PS9A 3USES 1H6BA 3DSRA 5I7UA 3VPAA 3K1AB 4RD0A 1YE5A 2ATVA 1WCWA 4FDMA 2J4DA 3AERA 5AJUA 1SXPA 1JAXA 4LG1A 4WPGA 3AR2A 3IHKA 3ZTTA 4RKRA 4ETIA 1AA9A 1Q19A 1QHNA 3EW7A 4AB1A 1M2JA 3R7WB 1PR4A 2RHLA 1FSFA 3B9BA 3HMQA 4L4ZA 1JG4A 4PG4A 2CUKA 3I1YA 3SM3A 2IHBA 1RKVA 3D6VA 4HS4A 3V46A 3VAAA 1NWHA 1GSHA 1GJRA 3I2KA 4MTLA 3TTYA 3A9RA 3A4NA 1S2IA 1WE2A 5ITWA 1WQ1R 1FUYB 4DT1A 4EATA 1RQPA 3O8BA 4OUDA 2G25A 3IMEA 3OZIA 1E1RD 2CXXA 3DA8A 5CW1A 4AMZA 2V5UA 1U80A 3DKPA 4MCHA 3TFOA 4HQ6A 2ZXFA 1KO7A 5LIPA 2J7PA 1U2GC 4IHJB 1JR2A 1I14A 3AX6A 3UWSA 1UXIA 2Q1UA 1XLUA 2PBZA 3C5HA 2BMFA 1G8YA 3EYWA 2I9PA 4I4CA 4X1IA 2R4TA 2VWHA 3K0FA 5KOJB 4ICIA 2CLFB 1ENZA 3ME5A 3L8DA 2WAXA 3QKSB 4FYIA 5HEKA 3T95A 2ZYDA 4ASUD 3MERA 1GNTA 4E22A 4GLJA 3BTUA 2A5DA 3ZEIA 3ROQA 3ZCPA 4PS1A 1O7JA 2IA5A 3ZWCA 4CQMA 1AS3A 3E4DA 4G0MA 4AJ1A 1MQ9A 2Q3LA 5KYNA 2BZ0A 3Q7SA 3F1LA 3OZWA 3L8ZA 1ORTA 2YS6A 2PA0A 1D0SA 1DC6A 4RIGA 5GOTA 5BO5A 3NHLA 3VAZA 3SX2A 2O07A 4LRYA 1X94A 1XMOB 5FEMA 1ZNQO 3B48A 3ZVLA 2RAUA 1RHJA 2ZM5A 1K2WA 1Q0QA 3H5VA 421PA 1GGMA 3TOVA 1SC9A 1L0BA 4EEKA 2GF9A 1K0UA 1AV6A 3BGIA 4G67A 1G291 3CM0A 5AOVA 2C8LA 2ACWA 1NONA 2NLOA 1F2UB 2BFOA 2E55A 5IJXA 4Y6SA 5JXGA 1ETHA 1GRQA 1GILA 4P7BA 1L5ZA 3BDAA 2AN4A 2V7EA 2C84A 1DAOA 2JIZA 4N0EA 5JV5A 3AFMA 4X7RA 2WUWE 2ZTVA 5BMOA 1GTSA 2G5CA 2VYQA 5J4VA 2OO3A 4JLSA 1JWAB 2PL1A 3OCJA 1S2NA 1ZNYA 2XF8A 2C98A 3TQCA 2H31A 3WY9A 3D81A 4U6QA 3C39A 4NOLA 1SVNA 1Y4AE 1L5LA 4JXJA 5EINA 2GEVA 1FFGA 3OJFA 1CY2A 5ALQA 2PWZA 3DE1X 4JUFA 2LCQA 3QVLA 3U7QA 3ZX5A 1UMBB 1JJBA 4BB5A 3HVRA 4CEHB 3Q0TA 1OI4A 2PV0A 3MJVA 1G5QA 3BL5A 4HEQA 4CM3A 5J2TA 2WU8A 3TLEA 2Q8NA 1YQ9A 3M3HA 3ETEA 2G1AA 3QU5A 3WNCA 3BK2A 1NLMA 1KEWA 3WL7A 4DEVA 5I3CA 1R16A 3L4KA 2YUIA 3NU1A 1SCDA 2AA3A 2P5SA 5LOVB 1MG0A 1RLJA 2QUIA 4GE3A 3UO8B 3QSYA 1NQ5A 1XYGA 1JDTA 1YNOA 1I1OA 5C3UA 5EESA 1K89A 4G1EB 1AMUA 1C30B 3ON5A 4R98A 3H2BA 2PFGA 1OY1A 1JKMA 2G08A 3F7MA 1HETA 2X41A 3GLHA 2AOXA 2PKQO 2WLTA 4P8RA 4QC2A 1OPXA 4LF6B 2YIJA 3T3PB 1SVSA 3PIRA 1RE0A 2IYFA 4UCWA 2ECPA 4MULA 4TGLA 5TPWA 4KIUA 3M3DA 3NP7A 5KOHB 1A9TA 4AECA 4C29A 2K2QB 2QTLA 4WN9B 1QO0A 5UKDA 3W9SA 1U3WA 4NJMA 1U8CB 4BMOB 4NECA 3GVIA 2KYRA 1OFTA 1GPWB 1ODSA 1Q1AA 2A2ZA 3EH1A 1QWOA 4N65A 2IWHA 1WBBA 4B3MB 5EXSA 2C8VA 3OU2A 1O96A 1A77A 3N2ZB 4RSGA 2QTFA 2NZUG 3M6IA 5EZYA 1XVVA 3AH8A 3RWBA 3X1WA 4BFLA 4EK9A 2VT7A 3PFNA 4ZYUA 2P41A 5LXTF 1L7QA 4NK5A 3L1IA 2VYNA 3DXFA 4ZQIA 4UPDA 1V26A 4LV8B 4CRWB 3UHAA 3PEUA 2NYRA 4JVOA 1Q1NA 5EERA 3U26A 1DDIA 3OA0A 5JSQA 1PUIA 3BWEA 2WYHA 3BHIA 5F7XA 3GQBA 4OHYA 2WHRA 3P52A 1M76A 1QGAA 1ODKA 4XWTA 4DV0B 2FR0A 4Y6OA 4HDKB 3CCBA 5F4ZA 16PKA 1F7VA 5HFAA 4BU0A 3KYCA 4OU5A 4W5OA 4OQ4A 1H4QA 2ZRFA 1CS4C 1QO7A 5G53C 2BFNA 3HBNA 3HU3A 5CB0A 2D0IA 4MA4A 5A6VA 4M1WA 3ACCA 1CEXA 1H6DA 1WR8A 3KQKA 3HWX1 3IQZA 4HAIA 3RU3A 1N2IA 1UPCA 4M22A 3EEYA 4AUNA 2YVQA 2YZMA 4XLTA 3TOXA 4LZNA 4G6ZA 4BZXA 4D46A 4YLGA 1AZSC 3W5JA 5FFNA 4B5LA 3A25A 3MWLA 1UKEA 1BN6A 1F2VA 2FX5A 1FS5A 1R6DA 2R5FA 1NRWA 4B6QA 4UQLA 1H1DA 5M2QA 2CDNA 3CLHA 3S8YA 5EVJA 1UDAA 3UJHA 2HXGA 3A32A 4H6WA 3AEKA 4NFLA 5HQ3A 3DT6A 3TPZA 3BREA 3M5CA 1F0PA 4IBOA 4X95A 1SB9A 3VNVA 5CB6A 1GGFA 1KI8A 2B25A 1DDOA 3FMOB 3L6BA 3FLBA 4MVJE 4Q66C 1WNFA 3ZS9A 3EF0A 3V8NA 1UZMA 2C5LA 3H2KA 3NGLA 2Q3CA 4MKXA 4OXIA 5P8WA 4R40A 3K9NA 5EXEA 2I1LA 2YV1A 2RKBA 1UMDB 5T64A 4ER6A 2XZOA 1B1CA 3LHKA 4D9IA 1UWVA 2PRSA 3L7YA 5KYYA 3DHEA 1T3ZA 3TN7A 3F6BX 3N8GA 1DUSA 2VPTA 1NBMA 2YVUA 2LKCA 3MILA 4XGQA 2P4EA 3FSEA 1M1NA 5E9QA 3GGJA 5AVTA 4FE7A 3UUEA 1BYUA 3IUJA 3J81A 1EFRD 1I94B 1CHDA 1FYDA 2AL7A 2XVAA 5B12A 2IU6A 1A9QA 2HJVA 3UMCA 4RTKA 1PK9A 4JOCA 1URPA 3IR7A 2JBAB 2OAGA 5KWIA 3U3XA 1I6KA 4XWAA 2FI1A 3QRWA 1A0OA 2X6QA 4LKRA 1YHZA 3QOXA 1D2RA 1AF4A 2P9TA 4JVLA 5E7MA 5L45A 2NUAA 4N41A 3LRTA 1OXVA 4FR2A 1E6WA 4RU1A 4HF7A 3ZQUA 2P4UA 5E3HA 5F76A 2NSDA 4PSDA 2OHHA 4M1TA 3PC3A 5J4LA 3HK2A 1F8YA 1Z39A 4U63A 2DBQA 1TKRA 5EI5A 1GV1A 1JP7A 2O2DA 2VI5A 4X3PA 2GVDC 1MIOA 3GBVA 4Q1VA 1JHOA 4XKJA 2XZTA 4ME6A 2PUAA 1B23P 4G5OA 1RT9A 4KIWA 2X7JA 1XEXA 3BFPA 3IUQA 2OWDA 2KQUA 4N5LA 4TM7A 4UDXX 4E11A 2YX1A 3UT6A 1J00A 3KVOA 2OSVA 4UVHA 4L07A 1ORWA 3T4UA 4J4BA 3WVNA 1DBQA 2FN4A 2YWJA 3O9VA 2PY6A 1XA0A 4KBGA 5TVKA 3V42A 1YDFA 3KJXA 3CZPA 2HBZA 4GYWA 121PA 1JVBA 2A9KA 4R2XA 1JW9B 4Y1EA 3T3HA 1Y63A 2IOFA 5JFGA 2FLVA 2H1OA 1R88A 2EBWA 3SR0A 3PLNA 2I7VA 3I5UA 4JLDA 4O4JB 3EA5A 3QUBA 1QHYA 4WXYB 4I08A 3U9SA 2D2EA 3BD7A 3O5AA 3ORRA 1KR5A 2W2QA 2PX2A 3BXFA 3IOCA 3HADA 4FBLA 2J5XA 4JYPA 3ZJYA 5HOQA 1ZD2P 3FMIA 4LJ6A 1Q7CA 1Q20A 1Z26A 4IJUA 4QJIA 5FBZA 4DLYA 5JDCA 2QBYA 4JLJA 3CX8A 1SVLA 1B8VA 2DHDA 4D57A 1P3DA 2DAPA 4D26A 2HWKA 1V8OA 1EAYA 3GOHA 2W4IA 2DP4E 3E8XA 4FBGA 1Z45A 3PZRA 4KQ6A 1ZMXA 3GGCA 3SQLA 1NG1A 1RI3A 3NFRA 3CLSC 3E9RA 1MZVA 4H60A 3STUA 4ALNA 3HB4X 2OCLA 2X1LA 4ENUA 3KOOA 4LC0A 3W2TA 5A03A 4X66B 5LL6P 1NL3A 1EX9A 3LUBA 3ZY5A 1AD2A 3WFIA 3AESB 4LC1A 4B7XA 1GUDA 3BTSA 4W82A 3U49A 5HIKA 2BMEA 2NUPB 2X6RA 3SSNA 3HJTA 1JJFA 1F1BA 3HDTA 5C1OA 1W4ZA 5AI4A 4BNHA 3Q2KA 1BTOA 4GKVA 3H8JA 2IY7A 4ZVTA 4IOKA 3ROGA 3VSCA 2J46A 1FFHA 1IJKA 1TAGA 5FNVB 1NJ2A 1OH8A 5MFPA 4TUYF 4ALLA 2I8LA 1QQ7A 1JHAA 2BGNA 2DCMA 4U2DA 3NHWA 4LPSA 5DXJA 4L4RA 4XQEA 5GZ1A 3FFTA 2QGFA 2A0WA 3RUIA 4LHWA 4JT8A 4LN1A 1TA4A 2IKQA 1Y6GA 3JATA 1OAKA 3CH4B 3JS5A 1SEPA 4A10A 3BWDD 3M34A 1TT5B 2GZHA 4MWGA 4A73A 2CGEA 2NG1A 4PGMA 1K8RA 3EDQA 3ONDA 4Q9HA 3DEKA 2OM2A 2VJAA 5COBA 2H92A 5BNWA 1K6EA 1NNLA 2P4QA 2Q29A 4REMA 4IHQA 3OO0A 4GPD1 3SC3A 3UJBA 1V48A 3GPDG 2NYAA 5DM2A 3VGJA 4DZZA 3GROA 3T61A 2FH5B 4LDPA 4BEWA 4NCJA 1D1QA 4G65A 1S8AA 4ZJUA 2GZMA 3V1LA 4EJMA 6NULA 1VKZA 4MGEA 2EWWA 3OD5A 5BRAA 5LP1A 1VCMA 1IM2A 2GB4A 2N42A 2Q5CA 2NUBA 2AFIE 4I81A 4C88A 2HRZA 1JFFB 1TPZA 2GK3A 4C0LA 4DM7A 3L93A 1G20E 3IAFA 3CZQA 1Q95A 4Y2QA 5HZGA 3TECE 3HXQA 2XZPA 5EMHA 2PMDA 1UQUA 5AHOA 3V97A 2KB0A 2HXYA 3FUWA 3W5HA 4J6EA 2AF3C 5A4KA 4RHEA 3BRSA 2OV8A 3AVOA 3D4OA 3WWYA 1JAYA 1XKLA 1MU0A 1GOTA 1BS1A 1JSZA 3ZOKA 4BWVA 5LU8A 1H9AA 1LC3A 1WZCA 3ESQA 2IYSA 1EFPA 4I2VA 4OBEA 4OXXA 5JH7A 4XIJA 1IIRA 4G07A 5FPHA 1V47A 1OE0A 2GYWA 3G2MA 3UGKA 1NVFA 3IRUA 5EZQA 2O8DA 3EVBA 1A9YA 4Y2YA 2XW6A 1N2ZA 1Y6RA 4KNVA 3QMMA 1TEHA 2I4NA 1P61B 2QD3A 4WUVA 4J43A 3U56A 3DOHA 4N48A 4R9NA 2CHEA 1EK0A 1LPPA 2CEKA 2PUFA 1EGHA 3HO6A 3EMDA 3EXHC 2CMHA 4MO9A 3KJNA 5ALNA 4EITA 3JQEA 1GVHA 2OO5C 2QAGA 1K63A 3E9EA 2WDZA 4IX9A 3MJCA 5ALUA 1Y5LA 1DAPA 2O48X 3I73A 4D4HA 5JCXA 1YJQA 1PK7A 2HXSA 1FTGA 2GO7A 1NY5A 2QM7A 4Q15A 1FVOA 1B1AA 2X42A 1PNOA 3LWZA 4LYDA 4DM3A 3WBFA 1QGZA 3LGAA 4HCJA 2J0EA 5LQKA 3QU2A 4EDFA 3BBLA 4O2BA 3RU2A 1BRMA 1RE1A 2M6LA 3BTVA 4KXWA 1IFXA 1MNQA 2GZDA 3M1IA 3PVZA 5LM3A 4R2HA 1EZ4A 4TYMA 1Q0ZA 4RSMA 2G1KA 3HB7A 3PWZA 3G9UA 3WMFA 3KWMA 4K6HA 4LBZA 4OQFA 1D4ZA 1WMAA 2BRUC 4IF4A 4M2LA 3IAHA 1QRDA 5HMLA 1E6EA 2AI3A 1EEXB 2ZRDA 3MLEA 3DBLA 4M3NA 3RWOA 4I5DA 4CT0A 5KEIA 1POXA 2OWEA 3EZNA 3S2UA 4HZUB 3VZPA 3KKQA 3HXMA 2VP9A 3LY9A 3MNFA 3HL0A 3KYDA 3P94A 5AW1A 5K0JA 4IIGA 1JEDA 3OY2A 4I55B 4L95C 1EK5A 4QPNA 2QE7D 3L8YA 1UR5A 5MHTA 4UJ3A 5I7OA 4LNAA 3INYA 3OOYA 4GYYA 4HFNA 4LOHA 1GUFA 1GADO 4B3TB 4B3RB 4KH1A 4O63O 2AG6A 1HF3A 3N9IA 5C53B 3LD9A 3J81k 3M1LA 1KARA 3ANYB 4RM3A 1V6SA 4AI6A 5FWYB 2OR3A 4CMIB 3FMGA 3K70C 2W2LD 2WUGA 2A9QA 5PGMA 1KPGA 2PE5A 1P6UA 4YJFA 3QYFA 1XRJA 4LC9A 1CUHA 2D7JA 3DBOB 3LUPA 1UKAA 1XDDA 3NKFA 3TW8B 4WLNA 1NAHA 5BN5A 4JJ4A 2DTDA 3ZE9A 3EIUA 3TLYA 2O8NA 3E8SA 4OQMA 1XZCA 2DHEA 3FRJA 2IUEA 4RDHA 1B7GO 1AKMA 3KPYA 4QAJA 2ZW9A 2IV7A 5FUQA 4HAZA 1Q14A 1ZW6A 3OWXA 3NJ4A 3CB2A 3QE3A 1QVRA 1P2VA 1DPFA 1TU4A 1OLSB 1T5DX 1BA3A 2HRQA 3D6JA 4MP6A 4UHBA 5IX8A 1G0NA 2O2HA 3A58B 5HVNA 5G0TA 1UBCA 2NO5A 3NNDA 1LK0A 4BVEA 2C4HA 2WJJA 5FUYA 5K2MA 1WUJS 4BFTA 1PR6A 1RPTA 2ZUUA 4M9XA 4ZAXA 2P75A 1S3FA 3K3PA 2OK7A 3OQHA 4EMSA 1MOZA 1OWPA 2B9EA 3W1VA 3KYBA 4X8OA 2P9GA 4TTTS 1ZMOA 5DE3A 1UPUA 1GTJ1 2QN6A 4MQUA 4V0RA 3DMRA 2OPHA 4J9VA 5LQMA 2EKZA 3NTVA 4TX1A 2AF4C 4ZO8A 1SH7A 2AC4A 2AYYA 3OE7A 4JIMA 1KQPA 2AJCA 3WL5A 1KNXA 1DL5A 4DLKA 5JBQA 2P9JA 1UJ6A 2ROQA 3EAFA 1GQSA 3SG0A 4KE8A 1MO5A 1QF9A 5AVUA 4ESHA 1Z0KA 1JR3A 1TGVA 2CMFA 1IG0A 1MDFA 4TS9A 5DT2A 4CIXA 5JZSA 1H5QA 3T3IA 1O6FA 3KUDA 1JLMA 2J7KA 3DDZX 5K8LA 3V1UA 4CEJB 1XQ6A 1OGYA 2W11A 3JQAB 3LA8A 3Q1KA 4RK4A 5ALFA 1FIUA 3WWPA 3SFZA 1QG6A 4FX5A 1VDMA 3GRPA 5LQAA 4XJSA 1GZHB 2ZREA 3AYZB 5M5BA 2IEYA 4DN6A 2DPGA 1QHFA 1Q74A 2G04A 3HZHA 3TX2A 3VDMA 2ORWA 4B7AA 3ICQB 3C6QA 1EUDB 3AETA 5EJAA 2H4JA 1KBOA 2V7QD 4FI3C 5JSZA 5I7VA 3ACBA 2H1CA 1YRAA 2W6OA 5T41A 1N9KA 2MCFA 2Q0XA 2X8JB 3FYUA 3K09C 2WIFA 3HCFA 2YASA 4H9GA 4P4SB 1DV2A 3GFOA 5FBKA 3ZHXA 5F2NA 2HA6A 1P19A 3LHSA 1PD1A 2QSZA 3GU3A 4N9QA 3DL7A 3WC4A 5AVXA 5JJKA 3ZHRA 4GHWA 2QNRA 4W99A 3VSDA 4ZHQF 4OBWA 3WGNA 2B20A 1FRFS 1ISRA 3SNHA 1J8DA 1LGYA 1H1TA 4UTRA 2WVGA 1C3VA 4A16A 2LCIA 2RI6A 1FXWA 4XW2A 1UZLA 2PGIA 1QQBA 1CHNA 4DV4B 3ND9A 1E6LA 2VPZA 3OPXA 3BULA 4OB7A 4I2NA 3RSZA 5LP6F 1Q83A 4AURA 1EUQA 1UP4A 2OC4A 1OHHA 2QD2A 3BRCA 2X5OA 1ZUD1 3AO0B 4TV8A 3ZV3A 1MXFA 2QTRA 4BOYA 1YV9A 2J8ZA 1W5TA 1GU0A 3NYIA 2YUTA 1GQQA 3I9LA 4MGYR 4ITVA 1UCFA 4L8WB 1PFQA 1WCIA 2OECA 3DT8A 4PWYA 3DNMA 3AY7A 4C7XA 3DL0A 1XWFA 4GEKA 2H52A 4GX5A 4YC7A 3U4QB 2GNPA 3QH4A 3JW8A 1C5KA 2ID4A 3W3ZB 3ZV5A 2F8MA 5GINE 4CODB 3U7HB 1ENOA 1K27A 2GKOA 5BN4B 5CCBA 2O8BB 1XPUA 2ZUVA 2HF7A 4FFDA 4HV4A 3ODPA 3GH3A 1K97A 1SVIA 1TU0A 2B69A 4RD6A 4JX8A 3RVRA 4R9UC 3MWJA 3N59A 1UBLS 2JFQA 3QU7A 1ZZEA 2OBBA 5DWVA 4ERXA 3A6PC 1E0JA 1SVUA 2AUNA 4FYMA 2FMTA 2V98A 5D00A 4LSMA 2WSBA 3OTWA 3I45A 3IR6A 3DCNA 1R4NB 4Q7MB 5H3LA 4PRYA 2QMZA 1KEPA 2Q5EA 2VH1A 3L82B 3UANA 3WLOA 4C0JA 3I3OA 1ZHOA 3P0RA 2GBCA 4PONA 1YA6A 1N0WA 2G8LA 3PQ6A 4NH4A 3ASUA 3GUYA 1ZGJA 1DPGA 1OTXA 1E1KA 1NVVQ 3O8OB 4MUGA 2QJOA 4BV9A 3T7RA 4OKNA 3G0CA 2BFEB 2O1WA 2YRXA 4R41A 3JQ8B 4WZAE 4FGLA 2RBGA 4U2CA 3QWIA 1L8OA 1M1YE 3QV2A 4TWRA 1Y8CA 1NKTA 1JKXA 3W2IA 4WCFC 2MDTA 1XQXA 4OO3A 5DI9A 5A06A 1JG3A 1GL3A 3I5XA 1ZW1A 3TAHA 3L1VA 4B3BA 1K8ZB 1T8SA 2VK8A 2YCBA 4OHXA 1PZGA 2FGJA 4NVRA 2ZT5A 5JLAA 1AHIA 1ZN9A 1JLLB 2H9YA 2V59A 3FXAA 5J4YA 3LBIA 4KAXA 3VU8A 5JJ5A 3U5ZB 2JRLA 4KQGA 4B3JA 4OHFA 4FWTA 1A98A 1FMLA 2VJNA 3SSAA 2Q21A 3GIWA 3RVBA 1KAEA 1UBUS 3RF6A 1ZI9A 3P0EA 3L41A 4BZQA 1RI2A 4C0SA 2JLWA 4CNBA 5G2OA 2WYIA 2B99A 2EXXA 3TJMA 3GJ3A 3OCXA 2XYQA 4XZ3A 2Q5JA 4PC3A 1WX1A 5SZIA 5C2JB 1NKVA 1MKYA 4QBGB 1PJQA 3INTA 4KLZA 4XJXA 3LAWA 3REQA 1P29A 3T1NA 1QHGA 3WFZA 4H59A 4C0KA 2QN8A 1HDEA 1W2GA 1W0JD 5HS6A 5GZ3A 2H29A 3W7AA 4MVYA 1A8QA 1EP1B 4DTCA 1XKQA 2P2CA 2H08A 1MVNA 2ZCUA 4HNRA 1OX4B 4JQZA 4DIUA 1JEAA 3G68A 4YDQA 1SCJA 1G41A 3HCBA 1JU4A 4IIYA 3E3LA 3RK1A 4CLEA 1PV4A 4NCKA 2P27A 1LPAB 2FZ5A 4BY9E 4G3XA 3MUEA 1AG9A 3QF4B 3OPVA 5EHXA 5JDIC 2AK3A 2CD9A 1DIRA 5AKHA 4K46A 4B6PA 5B57C 2UXCB 2AFRA 5EJ7A 4RULA 4F6RA 4GLFA 1QYWA 2REXB 3KE9A 4YAWA 2JGAA 5JCJD 2Q45A 3SICE 4OAPA 1RYBA 3TQHA 1L3BA 2F17A 3GNSA 5DH9A 2WR8A 5F73A 1PUXA 3ZY3A 5IRCD 6ADHA 2IIBA 2ERXA 5LKRA 1JSLA 1JILA 1V35A 3ZBTA 5AVKA 3IBFA 1KJQA 2CVOA 1AKYA 5J23A 2YIVX 4B3GA 3EGXB 4YDRA 2AFHE 1T26A 2HBYA 2VWPA 3E48A 1FYXA 3Q7QA 2BUAA 5IN4A 1SBTA 1CRLA 1U5AA 3KZMA 3K5HA 1IB6A 1R0LA 2VF8A 3CNQS 3AF2A 3HJCA 3JCZA 3SDSA 4DV5B 4IXMA 4L5YA 2G70A 1CUAA 1L4UA 1FX0B 3MT7A 2G5GX 1PJTA 2GBIA 2H18A 1CUUA 2DQKA 4ZQBA 3KU1A 4KQJA 5FUWA 3BH6A 1OYWA 1I7QB 4EA8A 3K6JA 2BGGA 3ID6C 1L4LA 1GPLA 3LC1O 3LX5A 3NT5A 4DPLA 3FPLA 4Z9BA 3O93A 2A5JA 3MRXA 4H35A 3ZLVA 1AHPA 4MYHA 1E2GA 2HWXA 4CMGA 5CDFE 2B5OA 5K0EA 5K2OA 3AVUA 1AUXA 1S4QA 5IBQA 3PC8A 4C7OB 4L8YA 3E2MA 5LZ7A 4QYSA 2OCIA 4ZRDA 5EJ4A 2PH5A 3DONA 3WYNA 3IT0A 3WWDA 2XIJA 1G2IA 2P35A 4G5XA 3WGVA 2IX9A 3NOQA 2BKUA 1KYIA 4TMKA 3SLGA 5ETJA 2HIAA 3CF6R 1ZSYA 2JGKA 4KLNA 1MUUA 5DHAA 3SYTA 2VP0A 1ZHFA 4Y0VA 4E21A 4KDFA 1J22A 2GLUA 3K1YA 1MOSA 4R16A 4JI6B 4DDKA 1NR7A 1OU4A 3O1JC 3IUNA 4FZ5A 4YXWD 1R50A 3SM9A 4MV5A 4ZXFA 4AWXA 3MM4A 1NVKA 4AYXA 3CSDA 3G6WA 2NN3C 4KPUA 1REQB 4DCOA 2J67A 1J1ZA 1X7HA 3M6FA 2QENA 3JD3A 1RZRD 3KNZA 3QLUA 4OHMA 5AHWA 3MC1A 4ZEWA 1BVHA 4Z53A 2OQVA 1AY0A 4B4WA 4YJGA 4GBMA 4Z0NA 1N25A 1RM0A 2NYUA 2W83A 2B61A 3A28A 3N2GB 3JQAD 4TV9B 4JEMA 5JQGF 3FPBA 3WO1A 3U61B 3ZD8A 1J2TA 5CPFA 4AKIA 1R0ZA 1ZJYA 1GA1A 4IVRA 4DBZA 3JSAA 3ROEA 4ER7A 1OX5A 1H2FA 3SVTA 2MSCB 2FG5A 2YJ5A 5BSTA 3CX3A 2ZAGA 1P0PA 1RQNA 3A6GA 4G0NA 3LPDA 2QPOA 5KU1A 4MUFA 2HNAA 3MCVA 4M0DA 4QX6A 3TL2A 4BB6A 2F1JA 1TVMA 2O6LA 4MI3A 2WNHA 2CXSA 2ABWA 4M49A 5EG5A 3AQIA 3TFWA 3RRXA 3JYHA 4KAJA 3L7JA 1A04A 5DHFA 4QYIA 4LCJA 4XVUA 2NYVA 3K2QA 3MCTA 5DO9A 2PBFA 3W3AA 5D6NA 5JAOA 3HDHA 3T52A 3K1JA 4ES6A 1EGVB 5CA0B 1DRWA 4R8SA 1VE7A 1EFDN 2FZVA 4QWMA 1CC1S 1GN9A 1T6ZA 2F7SA 3DW1X 4RKFA 4RLFA 3F6SA 2QXYA 1QLJA 4QGAA 4CG1A 1OI3A 1GGJA 2C5BA 1K08A 1E1CA 2HSEA 3KP1A 3CNBA 4NFSA 5ARBA 1PI3A 4E7PA 1IEVA 1IVNA 1NUTA 4PZUA 8MHTA 1PNVA 2C94A 1T2UA 4EEXA 1GO2A 2VFAA 2KI5A 5IT4A 2O57A 3FBGA 4XCQA 4MAFA 3MJRA 1YE8A 5BSRA 5FI5A 1GZVA 4WBXC 1OV4A 4ARZB 3EA4A 4DT1B 3UT5B 1OLXB 3GN1A 5C37A 4TTPA 1DADA 3L6OO 5ICMA 5SZHB 5CTAA 2GN6A 4XFKA 3WJ7A 3WTBA 3DV0B 4MWDA 4FGUA 4NBLA 4BQSA 4PFQA 1B76A 2Z2KA 3EIQA 1YRLA 3DV2A 5T4FA 4Z51A 1IJBA 2C57A 2HMAA 3R7AA 1GNQA 3A1SA 1T10A 1UFQA 5ESWA 4LCEA 5C34B 3ILSA 2BMDA 1PVDA 2CFTA 3NBQA 3R5SA 4TXJA 3WGLA 4DIBA 4UM9B 4UPEA 2ATIA 1MMFB 2BAGA 2PX4A 3ITDA 2RGUA 3ZWOA 5EJ9A 1JWBB 4C3OB 5ESRA 1YI1A 2JDID 3FHOA 4CM6A 1TZMA 2WU0A 3K6KA 4FN5A 4C22A 4QQKA 1SK9A 4JROA 2CUNA 5AI5A 821PA 2IX3A 1NRIA 3Q87B 4JOQA 1CULC 3OEHA 3UMSA 4O8ZA 2X19A 5IH7A 4NJOA 3IIEA 4G36A 2K2WA 1FNSA 1O4VA 1QCZA 4N82A 1RBYA 3FZQA 5CYPA 4NYMR 2YWEA 3O4HA 3MFYA 5EE0A 2QQ5A 1MVLA 5JDCC 3WB9A 3PR3A 1Z47A 1ARZA 1E9CA 2WLSA 3LCUA 1E9SA 4NMMA 2ADOA 3OC0A 3PUJA 4GM1A 4FNAA 2V7TA 3OF5A 1I4DD 4TN1A 1BX0A 1ESNA 1H2WA 2OTCA 2OCAA 4C4XA 1TF7A 4P38A 5FI0B 4CQLB 2AOUA 2PJDA 1ADBA 2XUIA 4FE3A 5JFOA 2ORYA 2JA1A 3MT8A 1KAGA 2G9UA 4P4UA 5JNVA 4NDNE 5K0BA 4CLOB 2PZJA 2XUZA 4YAIA 2WWIA 3ZXYA 2HQRA 4B6RA 1M5RA 4OGGA 4WI1A 5AJVB 4TQAA 4I8XA 2YY6A 2VNIA 2E82A 3JWHA 1NW5A 2DUNA 4HWOA 5LPNA 3GDWA 3D7MA 3EMVA 2I4LA 3KUUA 1G66A 3PPYA 4MGIR 5KYUA 5EIEA 2DPHA 2FPPA 1Q0LA 2A3NA 2GPNA 3JQFA 4TKUA 4D0LB 2EHJA 2BGJA 3ENZA 2VDKB 3LVBA 5BSKA 1Z7YA 3DAGA 2IRWA 5LDGA 3B2QA 2WD7B 4ZGBA 3BVPA 3L92A 2UUPA 3GFBA 4QSHA 4II3A 4OX9B 1CF4A 4PAMA 4XQ9A 1P62B 3NWBA 4ZRMA 3OJCA 4QUDA 1AN0A 2HPZA 5FPYA 1HX7A 3HUTA 5LMZA 1Z6QA 4E94A 4RA9B 4TVSA 4AY5A 4DLAA 2EBUA 3EY4A 5MN6A 4HLUA 3H9JA 1N0UA 2XEXA 3HFGA 3AUTA 3SC2A 4PSAA 4URUR 1ZJ6A 3MS4A 1P7ZA 3OM0A 4H17A 3LMKA 3WRVA 4EJSB 5LYJB 3LGSA 1QGUB 5GONB 4LWPA 5EJMA 4KKXB 2XIQA 1BKYA 3SVZA 4D4JA 2IHNA 3FD8A 2ZJAA 2I6QA 2R6DA 2ZJ0A 2E4YA 3BSSA 3ETGA 3FROA 3L79A 2A4MA 4V0KA 1NN0A 1FUKA 3E53A 3I53A 5GJCA 4AZWA 3D2AA 3AZPA 1BOOA 2Z1NA 3ZC3A 3QI2A 3G7UA 1IDOA 5LVAA 1VTKA 2SCUA 3WP1B 2HYDA 3PQEA 4ABTA 2V9ZA 1ZSVA 1JYSA 1VBKA 1JDVA 1FC0A 1NN5A 1VI6A 2B2XA 2NW6A 2R6FA 2VTEA 3MT0A 1KIMA 4M6WA 1DQZA 4UEJA 5DTIA 2OZLA 3T0GA 3WISA 4YRSA 5AUQA 3SBXA 1ZITA 1YK0A 4CMCA 2AVDA 3TUIC 4QQFA 3UGQA 3OQMA 1PSWA 1MRZA 1GIAA 2W6ID 2RB5A 4DJDC 1G7CA 3FY4A 2TMGA 4DBLE 1KQOA 4RADA 5K03A 2PZFA 2QZPA 2DXIA 1G1AA 4G0XA 4PGFA 1OLOA 4OGKA 4P3KA 4B2YA 2Q49A 1FDWA 4AROA 4X6UA 3PXBA 5BVGB 3I76A 2AH5A 2ZJ7A 3BDIA 1ZGAA 3DEHA 4EDHA 5CAEA 1HK7A 1XRSB 4HRVA 1L4NA 4TMYA 4IG4A 1U1IA 5KBYA 1JEJA 4NNPA 5CU7A 2WWWA 1Q0PA 5I9MA 1KYYA 2GOYA 2YC2C 3GRRA 3IV7A 3R0XA 2R96A 2YHUA 3PPWA 4UDNA 5JG7A 3WYCA 5CDTA 1QE0A 3EW9A 4PYIA 4B6OA 4AN1A 4WA7A 4U7FA 3GFPA 4HNQA 1X7DA 2RGEA 2XRYA 2AEFA 1RC8A 3T0FA 1QO9A 3KELA 3IAUA 4YXFA 4PFKA 4JC8A 4E46A 1RNLA 2DB3A 5JE8A 4D8YA 1Y8QA 1AF7A 2WKRA 2XB8A 3UH0A 4JHXA 5KYWA 5C8YB 1G21B 3G0BA 4QD3A 1AZWA 2PGJA 3OEYA 4JQSA 3CUSA 4N5IX 3DE4X 1CFJA 3QI7A 2YJNA 3L8MA 5B3JC 5E7JA 3T4EA 2R25B 3ZJ5A 5B3KA 1VZ2A 2W9XA 3G6KA 1A50B 2QN9A 1OXMA 1A4RA 3P0JA 1YDGA 4EUHA 2J31A 1W88B 1UFRA 3C6ZA 1ZL2A 2I71A 3EFOA 4BEBA 2QJFA 3NOXA 1CJSA 1C3OB 4UHFA 5MN5A 3R3HA 4WHMA 3JQPA 4HQFA 5DM0A 3GZTB 5LZ9A 3DDCA 5DFAA 4LZWA 3WYEA 4G5SA 4TKVB 4XDHA 3TNJA 4HH0A 5AYVA 4ZV4A 5I4IA 3L5OA 3PA6A 3AL2A 4FNMA 4PHHA 1VHTA 5EWJB 3VVBA 1I2AA 2ZYUX 1NE2A 1AK1A 1RMYA 2ZUWA 3AEXA 3KQVA 5DB4A 3VRHA 4RVFA 3TRIA 3FTQA 4OPMA 1B43A 3L8EA