1FY5A

Fusarium oxysporum trypsin at atomic resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy5A01
4MLFB 1HPGA 2VWOA 4AB9A 1E37B 1HAOH 1SFIA 2H5CA 1CBWC 2ANMH 6ESTA 2XTTB 3UPEA 5FCKA 4HFPB 5GWZA 4I31A 1G3EA 1TMUH 3CP7A 2ZPSA 4WH6A 2VVUA 4THNH 1O3MA 1AE5A 2NWNA 3Q77A 5FPTA 1C5TA 1ZSJA 2FDAA 4Y0YE 2PKSC 1UJ1A 5JBBS 3N7OA 2WINI 1GI0A 3BTGE 4B74A 2CXVA 1OPHB 1ELEE 2FOGA 1DPOA 1L1NA 1P9UA 4ZXXH 1PPBH 1AN1E 1NESE 2W26A 3ODFA 2Q6GA 4AORA 1FI8A 2BVSH 1A61H 1O3AA 2G81E 4X0WU 1F0TA 2FOHA 1AFQC 1O5BB 3TH4H 1SB1H 3UWIA 2CMYA 1MTSA 3DD2H 1SGTA 2HLCA 1DXPA 2YNAA 4D9RA 3NZIA 3MMGA 3P8NA 2IN2A 2AS9A 5ESBA 4JYVH 1Y5AT 1BMLA 3PTNA 1ETSH 3D49H 3T29A 1YPHE 3TK9A 2VH0A 1LKAA 2R3UA 1O2NA 2C8WB 3MNCA 2F9UA 3FZZA 1GI6A 3GCTG 1CBWB 3PO1C 1MZAA 4DOQA 3UQVA 1FPCH 4NIXA 4YOIA 3B9FH 1EZUC 4NFFA 3GOVB 5J4SA 1C4U2 3NK8A 3RXRA 2Y5GA 1MTNC 3RXGA 4X6MA 4X1RU 3SUFA 3GYMA 3VEQB 4BOHA 4AZ2B 2HALA 1G3DA 4MPWA 4MNXA 2EA3A 1O3JA 3SGQE 3PTBA 2OC1A 2F9NA 1C2IA 3TH3H 5CHAC 1QB1A 1CQQA 3MFJA 1K1JA 4K60A 4ISHH 3E3TA 7GCHG 1UTMA 1F2SE 3MWIU 5E0JA 2TRMA 2ZHQH 1OP0A 2M5TA 4H42U 1AZ8A 1T31A 2BD3A 1EXFA 2G00A 1AFQB 1UVSH 1W11U 5F6MA 1NRPH 1K28D 1FMGA 1UTOA 2HRVA 1BQYA 5EQRA 1JIMA 1QQUA 2VNTA 2A4OA 4IW4E 4A6LA 1O2XA 2ANWA 4JZIA 1GDNA 3O8CA 1A7SA 1MTVA 3DUXH 4AFQA 2BLVA 1E35B 1GJAB 2HGTH 1VJAU 1ZOMA 3MH4A 2GCTC 2PTCE 1NS3A 2ZHEH 2C90B 4ZMAH 1QA0A 2HVXA 4Z0KA 2H2ZA 5FX6A 1QURH 3PM3A 4K1SA 1ZMJA 4GCHF 1T32A 1LHEH 1HBTH 2PKAA 1K21H 1NPMA 2Y80A 3OY6U 1C1NA 1GMDG 3A81A 2ZFPH 2R3YA 2VIPA 2AMDA 2ZTZA 4ZROA 1GBCA 4X8VH 3S7HB 2QN5T 2AH4X 1SG8B 1FPHH 3K2UA 1G3CA 1NRSH 2ZU4A 3AW1A 3VGCC 1NFUA 2J34A 2BY7X 5CHAB 4KGAA 1EZXC 1UMAH 3PV4A 3Q3XA 2Z9LA 5HMAA 1EPTB 2VJ1A 3AW0A 3PLPA 3ZYEA 4OGYA 4WVPE 3M5LA 1EP6A 4IMQA 1A0HB 4ABJA 2Z9IA 4Y11E 1FDPA 1THPB 1XUIA 4MPUA 1KXCA 3TJUA 1K1OA 5L2YH 4ABGA 3RM2H 5BPEA 3SO3A 2ZPRA 2JETC 2CHAC 1KTSB 1C1QA 3H7OA 1TNGA 2VVVA 2RA3A 1V2OT 1W3CA 3CS0A 3U69H 7LPRA 2P8OC 4RKOB 1YPJH 2ZPQA 2QCYA 1GJDB 4YOGA 4YZUA 1LPGB 1UTNA 3VB5A 4IGDA 1GJ9B 2F91A 2HWLB 5AF9H 4LXBH 5EGMA 5A8ZA 3ATKA 5GPIB 3GY3A 1A0LA 1L0ZA 3ITIA 4ZKSU 1DY9A 3BIVH 3BTKE 1MD7A 2O8MA 3LKWA 3TJVA 2BY6X 1G32B 1MKXK 3SJKA 2A4GA 1DWEH 1RFNA 1CGHA 1TWXB 4XE4A 3S69A 2P93A 5JBAS 3SGAE 2RDLA 3RXDA 3VFEA 2GMTB 1W12U 2H9TH 4ESTE 4CH2B 1K1LA 5G4BA 2J4IA 1BT7A 4MQAA 2GVFA 1THSH 3IITA 3ZZ4A 3PMHB 4IN1A 2WYGA 1ELDE 5C1UA 1DM4B 2SGDE 1EJMA 2QA9E 1ZJDA 3V7TA 3LGWA 2ZFSA 3RUOA 3VPKA 1OOKB 5A8YA 1Z8RA 2XYAA 3S9BA 2OC8A 2Z94A 3FP7E 1HLTH 3PMBB 1TX8A 3LGUA 1O2OA 2A7JA 1MQ6A 2IPHA 4TYDA 1U6QA 1SGIB 4B2BA 1GHAF 4RN6A 2ZDVH 3G01A 1F0UA 1EUFA 5EW2H 1FNIA 1O3OA 2ODPA 2UUKB 2WPKS 3SORA 5LH8A 3RXJA 1P2NA 1GBIA 2F9OA 2XC0A 1QL9A 2WPJS 5ABWA 1TABE 4UD9H 5HYOA 2TPIZ 2Q6DA 1TMTH 1P05A 3SNAA 1OP2A 1O5GH 2NU0E 2ZU2A 3ATMA 3W95A 1HFDA 1DT2A 2BTCE 1P04A 2RA0A 1O2SA 2C8XB 1IQJA 1GHBG 3NPSA 1S5SA 3ZZBA 1UVOA 3KN2A 1THRH 2VIWA 1Y3XA 5A09A 2V35A 5EXNA 2QIQA 2LPRA 1PPHE 2UUFB 4CBNA 3PLBA 1KLIH 2R2MB 1AVXA 5TCAA 1AD8H 1BMMH 2AERH 3VXEH 2FIRH 1O5DH 3QGNB 1JBUH 3U1IB 1GG6C 1O35A 3T26A 3QWCH 1SR5C 8GCHG 1O38A 2LNCA 2SGAA 4D76A 1BTXA 1QA7A 1SQAA 1QR3E 4X8SH 1IQHA 2GV7A 1C1RA 1CSOE 3EA8A 3GCTF 1NFYA 1GJ5H 1O36A 3P17H 4TWWA 1KLTA 2D8WA 2FOCA 1YPHC 5JB8S 3M7QA 1BZXE 1O5EH 1XX9A 1HJAC 2FWWA 1YCPM 4ZAEA 1ELBA 2PKAB 1C1TA 2Q1JA 1ARBA 1GMCG 1GBBA 1MCTA 3S9AA 2ZIQH 2CJIA 3QN7A 2BX4A 7GCHF 1FAKH 2IJOB 1TGCA 2VVCA 2ZFFH 4Y8YA 3RMOH 1HJ8A 1RIWC 3LONA 2VIQA 5EOKA 1Y3UA 3GICB 4BXSA 5HXFA 1HAHH 1ARCA 1ZR0A 5DK1A 5AFYH 1AB9C 3T28A 1TPAE 1YGCH 3RXVA 1P3EA 4BAOB 4IC5A 5GJ4B 4CH8B 5E0HA 1TE0A 1UTLM 4DIHH 3KF2A 3URCA 4AFZA 1F0RA 1P2MA 3S7KB 4ZHLU 1QHRB 2OXSA 4X1NU 9ESTA 1FUJA 1GBFA 3KHVA 4ZHAA 3LOXA 1C5PA 3TGIE 2HPQH 1TPOA 1O3CA 3QK1A 3RXIA 2WUBA 1A1RA 2FYRA 1EP5A 5K0HA 3LGIA 2FX4A 1GMDF 2QF0A 1C5MD 3LC5A 1HXEH 3AASA 3PROA 3M36A 1N6XA 1VGCC 3AVZA 4IC6A 3RP2A 2Y7XA 1BTPA 2XW9A 3BTFE 4ZKOU 4CRFA 1AUTC 3U8TH 1TBZH 1S82A 1JMOH 2SNWA 1CGIE 1XKAC 1O2RA 1DUAA 4H6TA 1EOLA 2ZHDA 1X7AC 3MH7A 4TPYA 3M3SA 4CRCA 1O3BA 1TOMH 1LPKB 3U8OH 1OX1A 4TY6A 2GCHF 3TPIZ 1PQ8A 1P02A 4U01A 2FXRA 1GHWH 4FUBA 1GBJA 1LQDB 3A89A 3BTQE 4X8UH 1BRCE 1G3BA 1AB9B 1MUEB 1QB6A 2D26C 1EAXA 4NSYA 1EOJA 1DXWA 1P01A 1NRQH 2ZHFH 2OC7A 4GSOA 5FPYA 2O9QA 1GJ7B 1O2YA 2CV3A 1XXDA 1SMFE 3L3TA 2XWAA 2OBQA 1O2QA 9LPRA 2O8UA 1ZMLA 4FVDA 1S6HA 1MTWA 2W5EA 4M7GA 1K22H 2FTLE 4R0IA 5EW1H 5EPYA 4F49A 4AG1A 1GDUA 3PMAB 1V2VT 4YESB 3AAUA 1NFWA 3K6ZA 2GDEH 3P95A 5C67A 3SI3H 1DVAH 2ZWLH 4INHA 2C3SA 1RXPA 1HIAB 1AU8A 3KCGH 3HPTB 3DFLA 1B0EA 1YPMH 4A1TA 4AG2A 4X6PA 1BMAA 1W14U 3E6PH 2EI8A 1C4Y2 4Y76A 2BB4A 3EA7A 1S81A 2PGBB 4INKA 4Q7YA 3E91A 2SFAA 3GY4A 2OLGA 5TJXA 1KDQA 3LIWA 3ZVAA 1MTUA 4NA9H 1TOCB 2G55A 1HDTH 2R9PA 1O3FA 2FI5E 3ELAH 1PPZA 6GCHG 2PLXA 3U8RH 3KEEA 2BDCA 1DWBH 3K6YA 1TPPA 3T2NA 1QBOA 1TB6H 2ALVA 1O39A 3ZVEA 1ZRBA 2ZGXH 1KXDA 3OU0A 2RCEA 4AYYB 4WF8A 1NT1A 1QRXA 1AFEH 1IQGA 2KAIA 1C5ZB 2PTNA 2AEIH 3SV6A 1EAIA 2DE8A 1EX3A 1P2QA 4GLYA 4NFEA 4JZDH 1GCTC 4FVBA 5EODA 1A46H 4UE7H 3SW2B 1ZGVA 1VCPA 4B75A 5C5NA 1B7XB 1FAXA 3E1XB 3DFJA 1DWCH 4FUEA 1Y3WA 1GBAA 2PSYA 1BTUA 2V3HH 1MU8B 4BTTB 1QBNA 3A7YA 4JK5A 1QL8A 1BBRE 1ELCA 1DITH 3EYDA 1PPEE 3RXTA 1C1OA 1FONA 2QY0B 4PROA 1GHBF 2AMQA 1SLWB 3PWCA 2ZDMA 5T6GA 1M9UA 5DP8A 2R0KA 4I33A 4XOJA 2QF3A 3ZZ3A 4BAQB 1IQFA 3RXBA 1GI1A 1BUIA 2QXJA 4Q2KA 4AYVB 3HGPA 3M3VA 1DUEA 3M7TA 4NIYA 3UUZA 4AGKA 1MBQA 1QIXB 5DO4H 3TJNA 2STBE 4IBLH 4JCNA 5DPAA 1YKTA 3SU6A 2BY8X 1LHGH 1ZHPA 3LC3A 3UNRA 1ANDA 1MKXH 1CA0B 2B7DH 1B5GH 6LPRA 1OS8A 1EZQA 3ZVGA 4CR5A 2CF9H 1C1VH 1P12E 3RC4A 1PJPA 2FTMA 2OD3B 8GCHF 1ELVA 1GCTB 1TGNA 2Z9GA 4ASHA 1PQ5A 1T8MA 1NU7B 2FPZA 1PFXC 3M35A 3SJOA 1WU1A 1JRSA 1Z8GA 1C2FA 4KELA 1LVMA 3V12A 1HAZB 5T6FA 2HNTE 1O3NA 1NY22 1K1MA 1V3XA 5FBEA 3UNSA 2BDAA 3A86A 2OCVB 1Y3VA 3UTUH 2SGQE 1C9PA 4WJG2 3GDVA 2B9LA 4JZEH 2PUQH 1H9IE 1TA2A 2J92A 1SGQE 1SC8U 2PKSB 2WPIS 1ZPZA 2PR3A 2FS8A 4HGCA 4K1EA 1GMCF 2A1DB 1G30B 1YCPK 4NZLA 5ESTE 2GKVE 1C1MA 1HAXB 5DJ7A 3S9CA 1T4UH 1GL0E 1P2JA 3NXPA 1SGRE 1ZSKA 3BTEE 4D8NA 4XSKU 1PPCE 2ESTE 1HB0B 4SGAE 1N1LA 3UREA 1EASA 1O30A 3BG8A 1RJXB 4FU7A 3RDZA 1F92A 1OP8A 1ZTLA 2BHGA 4UFGH 3BEIB 4I8GA 3SUEA 3ODDA 1XUKA 1ZPCA 3K65B 2GV6A 2B5TB 3BG4C 3BN9A 7ESTE 1YBWA 1XVMA 1G37A 3KL6A 1QGFA 4FUHA 4WMEA 2ZZUH 1GJ8B 1LVOA 3E90B 1HAVA 1C1WH 2AYWA 2ZNKH 2TGDA 3PO1B 1E38B 1O32A 1SGNE 1OYQA 2V3OH 1DFPA 4Y6DA 3SNEA 1O2LA 1GMHG 1DLEA 5EQSA 2F9VA 3A7WA 2P59A 1L1JA 1MTNB 5T6DA 4OS2A 5HM9A 1GBKA 2EI6A 4MG3A 2QXIA 4CR9A 1VITH 1FV9A 4UFFH 4BTIB 4JMYA 1GHZA 3M61U 3VB6A 2H6MA 1DE7H 1CT0E 1AQ7A 1KYNA 4X6OA 5CE1A 1PQAA 2GCHG 1H8DH 4X2XA 2A31A 3P8GA 2BQWB 4FXGH 1A4WH 1BBRK 3SV2H 2PSXA 3FANA 1O2MA 2GTBA 3NCLA 3OTJE 1O2KA 1C5QA 1P0SH 3BTWE 4OS7A 1XUHA 4OGXA 3SNCA 2P16A 3SHAH 4QT8C 4CRGA 4DGJA 4HTCH 1WCZA 5H4IB 2GCTB 4ISLA 2W7SA 2AGIX 1O2WA 5DP5A 2BD5A 5AVDA 4BAMB 1P11E 2HPPH 1P03A 1IQEA 4MNVA 1OWJA 5GIBA 2BLWA 1N8OC 8KME2 1IAUA 1FN6A 2CF8H 2ZCLP 1TNHA 1Q3XA 3ENSB 3RLYH 1GVZA 1SPJA 1FY8E 2ZTXA 2ZCKP 3H5CB 3ZZ6A 1K9OE 1O0DH 5JB9S 1A5GH 2WPHS 3VGCB 1C5YB 1C5RA 1RTLA 1NRNH 4NZQA 3UNQA 3OY5U 1UTPA 4AGJA 3V3MA 1UK3A 3A8CA 3K9XB 1BRAA 2R2WU 3A8DA 5F8ZA 4I8LA 4BTUB 1MAXA 6GCHF 2XBXA 1UO6A 4RKJB 1ZPBA 1Y3YA 1O2HA 4UEHH 2THFB 2WV5A 4FUDA 2FZZA 3BIUH 2GZ7A 1O3LA 5LPRA 1F0SA 1MBMA 2CHAB 2JETB 2QC2A 8LPRA 3LGVA 1UCYE 3ZZ7A 1C2DA 2HOBA 2QYIA 2P8OB 2XCFA 2ALPA 3OX7U 3RU4T 3UOUA 4WY3A 4GHTA 3NKKA 3T27A 2UWOA 4LOYH 1DS2E 1N8OB 1AMHA 2QXHA 1C5VA 2BD8A 2ZI2H 5FHTA 2FX6A 5F8XA 1D3TB 1MKWK 4O03A 1Z8IB 5DP6A 1SGPE 2ODYB 3UWJH 2FM2A 2JKHA 1BHXB 2P3TB 3KQCA 3T5FH 3LGYA 1H9LB 2A5AA 4AFSA 1NTPA 1H1BA 1CVWH 1L2EA 1GWAA 1ZYOA 2Y82A 2GT8A 4H4FA 5FAHA 3RXLA 2P3FH 2I6QA 1O3EA 2VIOA 1BTHH 1DY8A 4DJZB 5A8XA 1JOUB 5J4QA 1VITG 1GDQA 5HM2A 2A2QH 1WV7H 1E36B 3KQBA 3PWBA 2DE9A 2CGAA 1LTOA 2R0LA 1TAWA 4OS1A 2G5VA 1C4V2 3RXQA 3GY6A 4I8HA 1TFXA 1QB9A 1IQNA 1D3DB 1EKBB 2ZDKA 3VB7A 1GI7B 2Q6FA 2XC4A 4B1TA 1SL3A 4NWLA 3UQOA 1AIXH 1GJ6A 3S0NA 1TPSA 4Q7ZA 3U9AH 1LHDH 1RS0A 3FP8E 1TRNA 1GJ4H 4VGCC 4MPXA 3SU0A 2Z3CA 1GI5A 1C9TA 1QL7A 3RMMH 1TALA 3A87A 1TONA 5DG6A 4ZH8A 2BDBA 2GDDA 3TGKE 3TU7H 1RD3B 3Q3YA 1Z6JH 1A0JA 1BHXF 1FN8A 3EAJA 4JK6A 1C5XB 3SI4H 2ZTYA 2C4FH 2HNTC 1TYNA 3RXHA 1Z8JB 3F68H 4U2WA 1HAVB 5SGAE 1FQ3A 4ABFA 1GGDC 3SN8A 3GY7A 1XUGA 4ZXYH 4KKDA 2WPLS 5EU8A 1BMNH 1A2CH 1C1PA 1GCDA 1P2OA 1T8OA 3PB1E 4MNWA 3P70B 3O8RA 1QJ1B 3ATIA 3O8BA 4NWKA 4A1XA 4YLUA 1J17T 2BLOA 2FP7B 1QFKH 2AIPA 1AE8H 1Y59T 4F4OC 2A5IA 3IWMA 2PWXA 3DA9B 4YLQH 1BDAA 1S0RA 3SU1A 1KXAA 4NCYA 4UDWH 4LZ4B 2BY5X 1GG6B 4MTBA 4NIVA 1V2JT 2FLRH 4B71A 1KXBA 3P8OA 5GXPA 4DCDA 3GY2A 1AZZA 4IMZA 4BAKB 4K8BA 2TBSA 5GCHG 1LVBA 1SGYE 4FU8A 5C2ZA 2WYJA 2FOAA 4O3UA 1YM0A 2QGRA 3SBKA 3ZZCA 1SLVB 2EI7A 3EDXB 3ZZ9A 1FLEE 1GMHF 4B2CA 4KTUA 1H8IH 4ZUHA 1UCYK 1C2JA 1GJBB 5EPNA 1UK2A 3FZDA 2RG3A 2PW8H 3W94A 1HJAB 3LT3A 3MU5A 3TIUA 1D3QB 4AOQA 3QZRA 1GGDB 2C93B 1QJ6B 1GI8B 2SGPE 1SGCA 1TQ0B 1ZHMA 2NU3E 1GBLA 1ZJKA 3LH3A 2V0BA 3I78A 3UR9A 3NWUA 5L2ZH 2A32A 1RIWB 1NRRH 4K5ZA 3HKIB 4UONA 2BOKA 4JYTA 4DY7B 1WTHD 2H1UA 1IHTH 1GI9B 5C5OA 1HAYB 5A0CA 1O2JA 4Y0ZE 3EE0B 2BMGB 4YT6H 3A88A 3LDXH 2JH0D 1CA8B 2FODA 4FUGA 2FI4E 1EB2A 3AAVA 2G52A 4ABDA 4GAWA 2H5DA 3UR6A 5JBTA 1YCPH 3MTYA 1JIRA 3T62A 2ANKH 1SBWA 2NU1E 3QTOH 2WV4A 1YPGH 1YP9A 3MU0A 4KTCA 1C2MA 3MNSA 4ABIA 1C5UA 2G5NA 3U1JB 1D6WA 3E16B 1QY6A 2BLQA 2ZF0H 1UVPA 5EG4A 3SU5A 2XBYA 1GBMA 1Z6EA 1O3KA 4ISIH 3RXFA 1AO5A 3ESTA 2XCNA 1VGCB 2J9NA 5E0GA 1GPZA 3CS7A 4TWYA 1OWHA 3ZVBA 1AY6H 1G36A 1GI3A 3UY9A 1O31A 1ELAA 1V2KT 4INLA 4R8TB 5FX5A 1S6FA 2C8YB 3ATWA 3SJ8A 1OWKA 1GVKB 3SNDA 4AN7A 3SV7A 3F6UH 1GL1A 2Z7FE 1WAYB 3ZZAA 1IQKA 4WWYA 3TK5A 5DP7A 2ZGHA 3RXOA 1EPTA 1IQLA 2ZO3H 1XKBC 1FZZA 4TPIZ 1XM1A 4NA8A 1CHOG 2PUXB 4X8TH 2VWMA 1IHSH 2ULLA 3ZZ5A 3MO9A 1ZTKA 1SOTA 4CRBA 4GVUA 1WBGB 2OC0A 3URDA 4XBBA 1Z1IA 3MNXA 2GT7A 1ANCA 1BB0B 2D2DA 2OQ5A 3D65E 2OTVA 5FPSA 1MAYA 2TGAA 2TGTA 1GJCB 1TX6A 5JBCS 1ABJH 3A7ZA 4DG4A 4UFDH 3TLOA 3KIDU 4YT7H 1VCQA 1P8VC 7KMEH 1WSSH 2ILNA 1L4ZA 3M5NA 3MH5A 1P2IA 2OBOA 3SHCH 3DHKH 1SGEE 1BBRH 1AKSA 5E8EH 4DURA 1DSUA 1SGFA 1BITA 1TNLA 4LK4A 1T8LA 4JZFH 1G9IE 3A7XA 3SUDA 1MMJN 2BQ7B 2ZP0H 5A0BA 1HGTH 1KY9A 1P06A 2H9HA 3TITA 1IQMA 2Y81A 1UHBA 3SQHE 1TLDA 5IDKA 1C5OH 3ZZDA 5ETXA 2J2UA 2TGPZ 4CBOA 1L1GA 1FY5A 1V2WT 2ZGJA 5JPMH 1EZSC 2B0FA 3RLWH 4NA7A 2F83A 1S84A 2FI3E 1HCGA 1PPFE 1TQ7B 1VZQH 1MD8A 2BOHB 2O8WA 1H4WA 4DT7B 3STIA 1VITF 4XFQA 1C5SA 3RXCA 3MH6A 1O2UA 2FLBH 4Y10E 1F5LA 1EAUA 1O33A 4BXWA 3ZVFA 1V2RT 3A80A 2Z3EA 1YPKH 2O8LA 5EXMA 2ZECA 3C1KA 1OWDA 1V2PT 2Y5HA 2VWLA 3E8LA 3UOPA 1TGSZ 1TBRH 2ZU3A 1UTQA 3TVJB 3RC5A 3I29A 4I8JA 1BTWA 1PQ7A 1D4PB 4YOJA 3BF6H 1SQOA 1O3GA 4CRDA 1T7CA 1MCVA 3VB4A 1BIOA 2FMJA 3LJOA 1FXYA 3RXUA 5AHGH 3GY5A 1O3PB 5EXLA 1O37A 5F8TA 1K1PA 1Z7KA 4ABAA 1Y8TA 2OQUA 4Z6AH 1RRKA 1Y5BT 4FUCA 6CHAC 4Y71A 1YLDA 1KXEA 4Y8XA 3V0XA 4K69A 3C27B 3TH2H 1KLJH 4A7IB 2BZ6H 1K2I1 4CREA 1UTKA 1ESTA 3BSQA 1GI4A 1QJ7B 3M5OA 1MKWH 2TIOA 3RXMA 3SJIA 2FO9A 1AWHB 4MPVA 4NG9H 3TNTA 2ZDAH 3TK6A 1Y5UT 5F03A 5K7RA 2UWPA 1OSSA 3B23B 4SGBE 1MQ5A 1CT2E 1D3PB 1BOQA 3KGPA 3TJOA 2FOEA 3IG6B 3D62A 3GYLB 2ZQ1A 4IN2A 1XUJA 1SLUB 1LMWB 3QLPH 1BTYA 4X1PU 1EPTC 2ZU5A 3SGBE 3ZYDA 3QDZB 1C5WB 3HGNA 3CENA 5GCHF 4D7FA 1FY1A 3SNBA 2AMPA 1AGJA 4XBDA 2BDGA 1A5HA 3SUGA 1DANH 3KQDA 2BVXH 3MO3A 3SZNA 1ETTH 1YLCA 4UFEH 1UVUH 1V2NT 2QAAA 1W8BH 1AI8H 1V2QT 1ZZZA 4IS5A 3QGJA 2BD4A 4GUXA 1C5LH 4Y79A 1O2GH 6CHAB 1F5KU 2PV9B 2ZFTA 1LHFH 4WMDA 5I25A 1AUJA 2W3IA 4B76A 1GHVH 3EQ0H 3I77A 8ESTE 3GCHC 5E2PA 3TNSA 3Q3KA 4DW2U 2F3CE 1PYTD 3RXEA 2G4TA 1SHHB 1C1SA 2VWNA 3A83A 1HV7A 1SFQB 1ORFA 5GDSH 4BANB 1EJNA 1HJ9A 4ZKNU 1ZMNA 3HK6B 5DP3A 1C1UH 4FU9A 3FFGA 1CT4E 4MVNA 3NUMA 1YYY1 1XVOA 1C5NH 3QO6A 4O3TA 2ODQA 1ZTJA 4OS6A 1KDQB 3A8AA 2YOLA 4DVAU 2A0QB 2GMTC 2J94A 3A82A 4CHAC 1A3EH 1V6DA 1GVLA 1O2TA 3BG4B 4X2YA 1HAPH 2GZ9A 4O9VA 1HUTH 2UUYA 1G2MA 1Q31A 5DP9A 3L33A 4YTAA 1KXFA 4ABHA 2PHBA 2OP9A 1E0FD 3LGTA 2NU2E 5LPFA 4HZHA 1ABIH 2KAIB 3ZVDA 1TMBH 4ZHMU 4GPGA 2ZHWH 1O5CB 5DGJA 1J9CH 3A7TA 1DDJA 4U30A 1KIGH 4A1VA 2C8ZB 1CE5A 1HRTH 3FVFB 3TGJE 2AIQA 1AHTH 4K1TA 4ABEA 1AKSB 3M7UA 3MO6A 1BJVA 2BDHA 2XWBI 3RXSA 4FUIA 1NZQH 1NN6A 1TIOA 2ZDLA 4I8KA 1V2ST 2OINA 3SV8A 1DX5M 1Z71A 2XNIA 3GCHB 2AGGX 1C2HA 3RMNH 1YPEH 3MHWU 1F7ZA 1UHBB 3UIRA 1XMNB 3PMJA 1GHXH 3BTDE 1TNIA 1CHOF 4O97A 1LDTT 2YNBA 3MI4A 2FS9A 1J8AA 1UCYH 2Z6BD 1NROH 1QQ4A 1FJSA 1GBHA 1P3CA 1EB1H 1LVYA 3MYWA 1W7XH 1JWTA 1ZLRA 4CHAB 1QBVH 4OS4A 3M5MA 1YC0A 4Y8ZA 2FEQH 4ISOA 2UWLA 1HXFH 1INCA 2ANYA 2ZFQH 2CN0H 3RMLH 2GD4B 4GHQA 1NU9A 2W3KA 2SGFE 1W2KH 4KTSA 1WTGH 1C2GA 2PGQB 4JYUH 1W7GH 2BXUH 1L4DA 4WH8A 2EC9H 3MU8A 4DIIH 1S0QA 1V2UT 4X2VA 2VGCC 3KNXA 4NIWA 2A2XH 2VU8E 5DKMA 3HK3B 4K2YA 2VB0A 1GBEA 1HIAA 1TRMA 3EGKH 1QRZA 5B6OA 3SV9A 3R0FA 1WQVH 1T4VH 4I7YH 2VIDA 1W13U 1ELGA 3GY8A 4K3JA 1O5FH 3FAOA 1OWEA 1MH0A 1HYLA 2WUCA 5DP4A 1XUFA 1LHCH 1JXPA 1N6YA 1PYTC 3EA9A 4BAHB 3LU9B 3QTVH 2JH5D 2Y7ZA 3B8JA 1UK4A 1BTZA 3RM0H 1J14A 1VCWA 3MU1A 2GP9B 2FOFA 4WXIA 1ID5H 2A7CA 3ZZ8A 3T25A 1ETRH 5C3NA 3ZV8A 2BD9A 1HAIH 2D1JA 1LKBA 3VB3A 3RXKA 4B73A 2J95A 1UVTH 3BTHE 1EATA 2ZDNA 1O34A 1FY3A 2Z9KA 3ZV9A 3D23A 3BEUA 2ZEBA 4YO9A 1RTFB 4NSVA 3ZVCA 5T3HA 3M3TA 3LPRA 1K1NA 5IYTA 1E34B 1ANBA 3SQEE 1ZGIA 2G8TA 3DT0H 2F9PA 3P6ZB 5C1YA 1SSXA 2VGCB 1TNJA 1GBTA 4X2WA 1AVGH 3SU4A 1SLXB 1W10U 4E7RG 3GISB 1Q2WA 2BY9X 5LGOA 1SVPA 5A2MH 3O8DA 3JZ1B 2Y5FA 5L6NH 1B0FA 2A4RA 3LJJA 2AGEX 1CO7E 1NO9H 1GHYH 1O5AB 3RU4E 1NM6A 4U32A 2BQ6B 1MU6B 4Y7BA 1IQIA 3F1SB 2Y6TA 1HAGE 2ASUB 2Z3DA 1DICA 1S83A 1J15A 4J2YB 5AFZH 2XRCA 1AWFH 2SNVA 1PPGE 1ELTA 1LCYA 3GDSA 1H9HE 1C2KA 3L6PA 1K1IA 1GI2A 1NFXA 4CRAA 2BXTH 3BTTE 2BDYA 1YPLH 1ESAA 3SU3A 2BYAX 4AFUA 1SQTA 3PLKA 2IOTA 5C1XA 1ACBE 1V2TT 3U98H 1O3HA 1VR1H 1T8NA 1C2LA 3OSYA 1OWIA 1P9SA 1LQEA 4RSPA 2BM2A 3Q76A 4HI3A 1O2PA 2WPMS 1OYTH 3HATH 5I46H 2GX4A 3A8BA 4AX9H 4VGCB 3SJ9A 2ZC9H 3F9FA 1TRYA 4ZKRU 4E7NA 4LZ1H 1GBDA 3P92A 2XC5A 2P3UB 1OXGA 4Y7AA 5JDUB 1BA8B 2FESH 1IOEA 3F9HA 3RC6A 1TNKA 5E2OA 2A7HA 1J16A 1JRTA 2ZCHP 2P94A 4XBCA 4MNYA 3F9GA 1A5IA 1WQSA 3A7VA 2QV1A 4WMFA 1LPZB 1EAWA 1AVWA 2A5KA 2K1QA 3KQEA 4GCHG 2GZ8A 4AB8A 1SOZA 1ZSLA 1EJAA 3GDUA 1FIZA 2OUAA 2UUJB 4FUJA 3VXFH 3JZ2B 4BNRA 2G4UA 3QUMP 1F5RA 1CU1A 1TBQH 2XXLA 2ZG0H 2ZGBH 4Q80A 3HKJB 2BVRH 2SGEE 3A84A 4H6SB 4YM9A 2STAE 1D9IA 3PYHA 5TCCA 1LO6A 1BRBE 2G51A 1WYKA 2PFEA 1CHGA 1P2KA 3M37A 5C20A 2BX3A 1QRWA 3H7TA 3P8FA 2ZU1A 3STJA 1A3BH 2BZAA 2ZA5A 5A0AE 1MZDA 2QXGA 1VJ9U 3GCOA 1DOJA 3LH1A 3MOCA 2ZFRH 5FCRA 3MU4A 4E06H 3QX5H 3F9EA 1P57B 4Q7XA 5FXLA 2V6NA 4X6NA 2A4QA 1QTFA 1TA6A 3ATLA 1ZHRA 1TX7A 4I32A 1O2ZA 1ANEA 1DLKB 1V2MT 4FUFA 3V13A 1RGQA 2HNTF 2ZQ2A 1FIWA 4KP0A 1YF4A 4A5TS 1O2VA 1QNJA 3GCNA 1CGJE 3RXAA 5L30H 5CMXH 1FY4A 1ESBA 2VINA 1HNEE 5JYIA 1Z1JA 2F9BH 5FBIA 2J38A 4X1SU 5HGGA 1D6RA 1O3IA 4E05H 2W7UA 4MDSA 3RU4D 2JH6D 1P10A 1RTKA 4X1QU 1BJUA 5EQQA 3R3GB 1SGDE 3Q00A 4JZ1A 2XBWA 3SOSA 3E0PB 3MNBA 3FP6E 3UFAA 4WXVA 1KTTB 2NU4E 1NC6A 2A45B 3A85A 4A92A 2ZGCA 3RXPA 4K8YA 1SHYA 1XXFA 2DUCA 3BEFB 1G2LA 1TGBA 1BRUP 4ABBA 3SU2A 1C2EA 4D7GA 4D9QA 3WY8A 2H9EH 3BV9B 5BRRE 1ELFA 2ZKSA 1DWDH 1SI5H 1OKXA 1TGTA 4ISNA 1DSTA 2VIVA 4TY7A 2XBVA 1P09A 2Z9JA 2O8TA 1WUNH 2FYQA 5PTPA 4OS5A 4NGAH 1CA0C 2BD7A 3E0NB 1EQ9A 1KSNA 2P95A 2BD2A 2B8OH 2GGVB 3BTME 1W0ZU 1ZRKA 5LPEA 2VH6A 1W0YH 1WOFA 1GHAG 1QCPA 2FOMB 4XDEA 2BDIA 2I6SA 1O3DA 1BCUH 3OYPA 1SGFG 4J1YA 2EEKA 1V2LT 4B2AA 1S85A 1UTJA 1O2IA 2AFQB 3QZQA 2FOBA
chains in the Genus database with same CATH superfamily
4MLFB 1HPGA 2VWOA 4AB9A 1E37B 1HAOH 1SFIA 2H5CA 1CBWC 2ANMH 6ESTA 2XTTB 3DSOA 3UPEA 5FCKA 4HFPB 5GWZA 4I31A 1G3EA 1TMUH 4I86A 3CP7A 2ZPSA 4WH6A 2VVUA 4THNH 1O3MA 1AE5A 2NWNA 3Q77A 5FPTA 1C5TA 1ZSJA 2FDAA 4Y0YE 2PKSC 1UJ1A 2RDEA 3N7OA 2WINI 5JBBS 1GI0A 2K8IA 3BTGE 4B74A 2CXVA 1OPHB 1ELEE 2FOGA 1DPOA 1L1NA 1P9UA 4ZXXH 1PPBH 1AN1E 1NESE 2W26A 3ODFA 2Q6GA 4AORA 1FI8A 2BVSH 1A61H 1O3AA 2G81E 4X0WU 1F0TA 2FOHA 1AFQC 2M2AA 1O5BB 3TH4H 1SB1H 3UWIA 2CMYA 1MTSA 3DD2H 1SGTA 2HLCA 1DXPA 2YNAA 3F2FA 4D9RA 3NZIA 3MMGA 3P8NA 2IN2A 2AS9A 5ESBA 4JYVH 1Y5AT 1BMLA 3PTNA 1ETSH 3D49H 3T29A 1YPHE 3TK9A 2VH0A 1LKAA 2R3UA 1O2NA 2C8WB 3MNCA 2F9UA 3FZZA 1GI6A 3GCTG 1CBWB 3PO1C 1MZAA 4DOQA 3UQVA 1FPCH 4NIXA 4YOIA 3B9FH 1EZUC 4NFFA 3GOVB 5J4SA 1C4U2 3NK8A 3RXRA 2Y5GA 1MTNC 3RXGA 4X6MA 4X1RU 3SUFA 3GYMA 4B6FA 3VEQB 4BOHA 4AZ2B 2HALA 1G3DA 4MPWA 4MNXA 3VG8A 2EA3A 1O3JA 3SGQE 3PTBA 2OC1A 2F9NA 1C2IA 3TH3H 5CHAC 1QB1A 1CQQA 3MFJA 3W1EA 1K1JA 4K60A 4ISHH 3E3TA 7GCHG 1UTMA 1F2SE 3MWIU 5E0JA 2TRMA 2ZHQH 1OP0A 2M5TA 3H09A 4H42U 1AZ8A 4ASUD 1T31A 2BD3A 1EXFA 2G00A 1AFQB 1UVSH 1W11U 5F6MA 1NRPH 1K28D 1FMGA 1UTOA 2HRVA 1BQYA 4Z1MD 5EQRA 1JIMA 1QQUA 2VNTA 2A4OA 4IW4E 4A6LA 1O2XA 2ANWA 4JZIA 1GDNA 3O8CA 1A7SA 1MTVA 3DUXH 4AFQA 2BLVA 1E35B 1GJAB 2HGTH 1VJAU 1ZOMA 3MH4A 2GCTC 2PTCE 1NS3A 2ZHEH 2C90B 4ZMAH 1QA0A 2HVXA 4Z0KA 2H2ZA 5FX6A 1QURH 3PM3A 4K1SA 1ZMJA 3N99A 4GCHF 1T32A 1LHEH 1HBTH 2PKAA 1K21H 1NPMA 2Y80A 3OY6U 1C1NA 1GMDG 1H8ED 5C17A 3A81A 2ZFPH 2R3YA 2VIPA 2AMDA 2ZTZA 4ZROA 1GBCA 4X8VH 3S7HB 2QN5T 3OAAD 2AH4X 1SG8B 1FPHH 3K2UA 1G3CA 1NRSH 2ZU4A 3AW1A 3VGCC 1NFUA 2J34A 2BY7X 5CHAB 4KGAA 1EZXC 1UMAH 3PV4A 3Q3XA 2Z9LA 5HMAA 1EPTB 2VJ1A 3AW0A 3PLPA 3ZYEA 4OGYA 4WVPE 3M5LA 1EP6A 4IMQA 1A0HB 4ABJA 2Z9IA 4Y11E 1FDPA 2IJD1 1THPB 1XUIA 4MPUA 1KXCA 3TJUA 1K1OA 5L2YH 4ABGA 3RM2H 5BPEA 3SO3A 2ZPRA 2JETC 2CHAC 3OE7D 1KTSB 1C1QA 3H7OA 1TNGA 2VVVA 2RA3A 1V2OT 1W3CA 3CS0A 3U69H 7LPRA 2P8OC 4RKOB 1YPJH 2ZPQA 2QCYA 1GJDB 4YOGA 4YZUA 1LPGB 1UTNA 3VB5A 4IGDA 1GJ9B 2F91A 2HWLB 5AF9H 4LXBH 5EGMA 5A8ZA 3ATKA 5GPIB 3GY3A 1A0LA 1L0ZA 3ITIA 4ZKSU 1DY9A 3BIVH 3BTKE 1MD7A 2O8MA 3LKWA 3TJVA 2BY6X 5CDFE 1G32B 1MKXK 3SJKA 2A4GA 1DWEH 3DSPA 1RFNA 1CGHA 1TWXB 4XE4A 3S69A 2P93A 5JBAS 3SGAE 2RDLA 3RXDA 3VFEA 2GMTB 1W12U 2H9TH 4ESTE 4CH2B 1K1LA 5G4BA 2J4IA 1BT7A 4MQAA 2GVFA 1THSH 3IITA 4XD7D 3ZZ4A 3F2HA 3PMHB 4IN1A 2WYGA 1ELDE 5C1UA 1DM4B 2SGDE 1EJMA 2QA9E 1E1QD 1ZJDA 2KCPA 3LGWA 3V7TA 2ZFSA 3RUOA 3VPKA 1OOKB 5A8YA 1Z8RA 2XYAA 3S9BA 2OC8A 2Z94A 3FP7E 2AFQB 1HLTH 3PMBB 1TX8A 3LGUA 1O2OA 2A7JA 1WXRA 1MQ6A 2IPHA 4TYDA 1U6QA 1SGIB 4B2BA 1GHAF 4RN6A 2ZDVH 3G01A 1F0UA 1EUFA 5EW2H 1FNIA 1O3OA 2ODPA 2UUKB 2WPKS 3SORA 5LH8A 3RXJA 1P2NA 1GBIA 2F9OA 2XC0A 1QL9A 2WPJS 5ABWA 1TABE 4UD9H 5HYOA 2TPIZ 2Q6DA 1TMTH 1P05A 3SNAA 1OP2A 1VKYA 1O5GH 2NU0E 2ZU2A 3ATMA 3W95A 1HFDA 4F55A 1DT2A 2BTCE 1P04A 2RA0A 1O2SA 2C8XB 1IQJA 1GHBG 1MABB 3NPSA 1S5SA 3ZZBA 1UVOA 3KN2A 1THRH 2VIWA 1Y3XA 5A09A 3NRLA 2V35A 5EXNA 2QIQA 2HVYB 2L6OA 2LPRA 1PPHE 2UUFB 4CBNA 3PLBA 1KLIH 5HKKD 2R2MB 1AVXA 5TCAA 1AD8H 1BMMH 2AERH 3VXEH 2HLDD 2FIRH 1O5DH 3F3BA 2XNDD 3QGNB 1JBUH 3U1IB 1GG6C 1O35A 3T26A 3SYJA 3QWCH 1SR5C 8GCHG 1O38A 2LNCA 2SGAA 4D76A 1BTXA 1QA7A 1SQAA 1QR3E 4X8SH 1IQHA 2GV7A 1C1RA 3F0OA 1CSOE 3EA8A 3GCTF 1NFYA 1GJ5H 1O36A 3P17H 4TWWA 1KLTA 2D8WA 2FOCA 1YPHC 5JB8S 2KZ4A 3M7QA 1BZXE 1O5EH 1XX9A 2VBCA 1HJAC 2FWWA 1YCPM 4ZAEA 1ELBA 4TSFD 2PKAB 1C1TA 2V7QD 2Q1JA 1ARBA 1GMCG 1GBBA 1MCTA 3S9AA 5KEDA 2ZIQH 2CJIA 3QN7A 2BX4A 7GCHF 1FAKH 2IJOB 1TGCA 2VVCA 2ZFFH 4Y8YA 3RMOH 1HJ8A 1RIWC 3LONA 2VIQA 5EOKA 1Y3UA 3GICB 4BXSA 5HXFA 1HAHH 1ARCA 1ZR0A 5DK1A 5AFYH 1AB9C 3T28A 1TPAE 1YGCH 3RXVA 1P3EA 4BAOB 1BMFD 4IC5A 5GJ4B 4CH8B 5E0HA 1TE0A 1UTLM 4DIHH 3KF2A 3URCA 4AFZA 1F0RA 1P2MA 3S7KB 4ZHLU 1QHRB 2OXSA 4X1NU 9ESTA 1FUJA 1GBFA 3KHVA 4ZHAA 3LOXA 1C5PA 2QF5A 3TGIE 2HPQH 1TPOA 5CHBA 1O3CA 3QK1A 3RXIA 2WUBA 1A1RA 2FYRA 1EP5A 5K0HA 3LGIA 2FX4A 1GMDF 2QF0A 1C5MD 3LC5A 1HXEH 3AASA 3PROA 3M36A 1N6XA 1VGCC 3AVZA 4IC6A 3RP2A 2Y7XA 1BTPA 2XW9A 3BTFE 4ZKOU 4CRFA 1AUTC 3U8TH 1TBZH 1S82A 1JMOH 2SNWA 5DN6D 1CGIE 1XKAC 1SKYE 1O2RA 1DUAA 4H6TA 1EOLA 2ZHDA 1X7AC 3MH7A 4TPYA 3M3SA 4CRCA 1O3BA 1TOMH 1LPKB 3U8OH 1OX1A 3OEED 4TY6A 2GCHF 3TPIZ 1PQ8A 1P02A 4U01A 2FXRA 1GHWH 4FUBA 1GBJA 1LQDB 3A89A 3BTQE 3WW7A 4X8UH 1BRCE 1G3BA 1AB9B 1MUEB 1QB6A 2D26C 1EAXA 4NSYA 1EOJA 1DXWA 1P01A 1NRQH 2ZHFH 2OC7A 2QE7D 4GSOA 5FPYA 2O9QA 3OFND 1GJ7B 1O2YA 2CV3A 1XXDA 1SMFE 3L3TA 2XWAA 2OBQA 1O2QA 9LPRA 2O8UA 1ZMLA 4FVDA 1S6HA 1MTWA 2W5EA 4M7GA 1K22H 2FTLE 4R0IA 5EW1H 5EPYA 4F49A 4AG1A 1GDUA 3PMAB 1V2VT 4YESB 3AAUA 1NFWA 3K6ZA 2GDEH 3P95A 5C67A 3SI3H 1DVAH 2ZWLH 4INHA 2C3SA 1RXPA 1HIAB 1AU8A 3KCGH 3HPTB 3DFLA 5B6LA 1B0EA 1YPMH 4A1TA 4AG2A 4X6PA 1BMAA 1W14U 3E6PH 2EI8A 2KM0A 1C4Y2 4Y76A 2BB4A 5F53A 3EA7A 1S81A 2PGBB 4INKA 4Q7YA 3E91A 2SFAA 3GY4A 2OLGA 5TJXA 1KDQA 3LIWA 3ZVAA 1MTUA 4NA9H 1TOCB 2G55A 1HDTH 2R9PA 1O3FA 2FI5E 3ELAH 1PPZA 6GCHG 2PLXA 3U8RH 3KEEA 2BDCA 1DWBH 3K6YA 1TPPA 2JDID 3T2NA 1QBOA 1TB6H 2ALVA 1O39A 3ZVEA 1ZRBA 2ZGXH 1KXDA 3OU0A 2RCEA 4AYYB 4WF8A 1NT1A 1QRXA 4DT4A 3MQKC 1AFEH 1IQGA 2KAIA 1C5ZB 2PTNA 2AEIH 3SV6A 1EAIA 2DE8A 1EX3A 1P2QA 4GLYA 4NFEA 4JZDH 2J97A 1GCTC 4FVBA 5EODA 1A46H 4UE7H 3SW2B 1ZGVA 1VCPA 4B75A 5C5NA 1B7XB 1FAXA 3E1XB 3DFJA 1DWCH 2QF4A 4FUEA 1Y3WA 1GBAA 2PSYA 1BTUA 2V3HH 1MU8B 4BTTB 1QBNA 3A7YA 4JK5A 1QL8A 1BBRE 1ELCA 1DITH 3EYDA 1PPEE 1W0KD 3RXTA 1C1OA 1FONA 2QY0B 4PROA 1GHBF 2AMQA 1SLWB 3PWCA 2ZDMA 5T6GA 1M9UA 5DP8A 2R0KA 4I33A 4XOJA 2QF3A 3ZZ3A 4BAQB 1IQFA 3RXBA 4F48B 1GI1A 1BUIA 2QXJA 4Q2KA 4AYVB 3HGPA 3M3VA 1DUEA 1UW7A 3M7TA 4NIYA 3UUZA 4AGKA 1MBQA 1QIXB 5DO4H 3TJNA 2STBE 4IBLH 4JCNA 5DPAA 1YKTA 3SU6A 2BY8X 1LHGH 1ZHPA 3LC3A 3UNRA 1ANDA 2WHXA 4ZCNA 1MKXH 1CA0B 2B7DH 1B5GH 2YMSD 6LPRA 1OS8A 2WZQA 1EZQA 3ZVGA 4CR5A 2CF9H 1C1VH 1P12E 3RC4A 1PJPA 2FTMA 2OD3B 8GCHF 1ELVA 1GCTB 1TGNA 2Z9GA 4ASHA 1PQ5A 1T8MA 1NU7B 2FPZA 1PFXC 3M35A 3SJOA 1NBME 1WU1A 1JRSA 1Z8GA 1C2FA 4KELA 3U28C 1LVMA 3V12A 1HAZB 5T6FA 2HNTE 1O3NA 1NY22 1K1MA 1V3XA 5FBEA 3UNSA 2BDAA 3A86A 2OCVB 1Y3VA 5HIYA 2SGQE 1C9PA 4WJG2 3UTUH 3GDVA 2B9LA 4JZEH 2PUQH 4P02A 1H9IE 1TA2A 2J92A 1SGQE 1SC8U 2PKSB 2WPIS 1ZPZA 2PR3A 2FS8A 4HGCA 4K1EA 1GMCF 2A1DB 1G30B 1YCPK 4NZLA 5ESTE 2GKVE 1C1MA 1HAXB 5DJ7A 3S9CA 1T4UH 1GL0E 5C0UA 1P2JA 3NXPA 4B6EA 1SGRE 1ZSKA 3BTEE 4D8NA 4XSKU 1PPCE 2ESTE 1HB0B 4SGAE 1N1LA 3UREA 1EASA 1O30A 3BG8A 1RJXB 3AK5A 4FU7A 3RDZA 1F92A 1OP8A 1ZTLA 2BHGA 4UFGH 3BEIB 5EJ1A 4I8GA 3SUEA 3ODDA 1XUKA 1ZPCA 3K65B 2GV6A 2B5TB 3BG4C 3BN9A 7ESTE 1YBWA 1XVMA 1G37A 3KL6A 4Q63A 1QGFA 4FUHA 4WMEA 2ZZUH 1GJ8B 3ZIAD 1LVOA 3E90B 3DSGA 1HAVA 5DSFA 1C1WH 2AYWA 2ZNKH 2TGDA 3PO1B 1E38B 1O32A 1SGNE 1OYQA 2V3OH 1DFPA 4Y6DA 3SNEA 1O2LA 1GMHG 1DLEA 5EQSA 2F9VA 3A7WA 2P59A 1L1JA 4ACAA 1MTNB 5T6DA 4OS2A 3FKSD 1GBKA 2EY4C 5HM9A 2EI6A 4MG3A 2QXIA 4CR9A 1VITH 1FV9A 4UFFH 4BTIB 4JMYA 1GHZA 3M61U 3VB6A 2H6MA 1DE7H 1CT0E 1AQ7A 1KYNA 4X6OA 5CE1A 1E1RD 1PQAA 2GCHG 1H8DH 4X2XA 2A31A 3P8GA 2BQWB 4FXGH 1QZ8A 1A4WH 1BBRK 3SV2H 2PSXA 3FANA 1O2MA 2GTBA 3NCLA 3OTJE 1O2KA 1C5QA 1P0SH 3BTWE 4OS7A 2YMSC 1XUHA 4OGXA 3SNCA 2P16A 3SHAH 4QT8C 4CRGA 4DGJA 4HTCH 1WCZA 5H4IB 2GCTB 4ISLA 2W7SA 2AGIX 1O2WA 5DP5A 2BD5A 5AVDA 4BAMB 1P11E 2HPPH 1P03A 1IQEA 4MNVA 1OWJA 5GIBA 2BLWA 1N8OC 8KME2 1IAUA 3SZEA 1FN6A 2CF8H 2ZCLP 1TNHA 1Q3XA 3ENSB 1NBMD 3RLYH 1GVZA 1SPJA 1FY8E 2ZTXA 2ZCKP 3H5CB 3ZZ6A 1K9OE 1O0DH 5JB9S 1A5GH 2WPHS 3VGCB 1C5YB 1C5RA 1RTLA 1NRNH 4NZQA 3UNQA 3OY5U 1UTPA 4AGJA 3V3MA 1UK3A 3A8CA 3K9XB 1BRAA 2R2WU 3A8DA 3F2GA 5F8ZA 4I8LA 4BTUB 1MAXA 6GCHF 1OHHD 2XBXA 1UO6A 4RKJB 1ZPBA 1Y3YA 1O2HA 4UEHH 2THFB 3KYFA 4FOUC 2WV5A 4FUDA 2FZZA 3BIUH 2GZ7A 5GNDA 1O3LA 5LPRA 1F0SA 1MBMA 2CHAB 2JETB 2QC2A 8LPRA 3LGVA 1UCYE 3ZZ7A 1C2DA 2HOBA 2QYIA 2OK5A 2P8OB 1WDIA 2XCFA 2ALPA 3OX7U 3RU4T 3UOUA 4WY3A 4GHTA 3NKKA 3T27A 2UWOA 4LOYH 1DS2E 5EIYA 1N8OB 1AMHA 2QXHA 1C5VA 2BD8A 2ZI2H 5FHTA 2FX6A 5F8XA 1D3TB 1MKWK 4O03A 3N7DA 1Z8IB 5DP6A 1SGPE 1YLNA 2ODYB 3UWJH 2FM2A 2JKHA 1BHXB 2P3TB 3KQCA 3T5FH 3LGYA 1H9LB 2A5AA 4AFSA 1NTPA 1H1BA 1CVWH 1L2EA 1GWAA 1ZYOA 2Y82A 2GT8A 4H4FA 5FAHA 3RXLA 2P3FH 2I6QA 1O3EA 2VIOA 1BTHH 1DY8A 4DJZB 5A8XA 1JOUB 5J4QA 3KYGA 1VITG 1GDQA 5HM2A 2A2QH 1WV7H 1E36B 3KQBA 3PWBA 2DE9A 2CGAA 1LTOA 2R0LA 1TAWA 4OS1A 2G5VA 1C4V2 3RXQA 3GY6A 4I8HA 4M9FA 1TFXA 1QB9A 1IQNA 1D3DB 1EKBB 2KR7A 2ZDKA 3VB7A 1GI7B 2Q6FA 2XC4A 4B1TA 1SL3A 4NWLA 1FX0B 3UQOA 1AIXH 1GJ6A 3S0NA 1TPSA 4Q7ZA 3U9AH 1LHDH 1RS0A 3FP8E 1TRNA 1GJ4H 4VGCC 4MPXA 3SU0A 2Z3CA 2KCOA 1GI5A 1C9TA 1QL7A 3RMMH 1TALA 3A87A 4XRNA 1TONA 3PV2A 5DG6A 4ZH8A 2BDBA 2GDDA 3TGKE 3TU7H 1RD3B 3Q3YA 1Z6JH 1A0JA 1BHXF 1FN8A 3EAJA 4JK6A 1C5XB 3SI4H 2ZTYA 2EQNA 2C4FH 2HNTC 1TYNA 3RXHA 1Z8JB 3F68H 4U2WA 1HAVB 5SGAE 1FQ3A 4OM9A 4ABFA 1GGDC 3SN8A 2JJ2D 3GY7A 1XUGA 4ZXYH 4KKDA 2WPLS 5EU8A 1BMNH 1A2CH 1C1PA 1GCDA 1P2OA 1T8OA 3PB1E 4MNWA 3P70B 3O8RA 1QJ1B 3ATIA 3O8BA 4NWKA 4A1XA 4YLUA 1J17T 2BLOA 2FP7B 1QFKH 2AIPA 1AE8H 1Y59T 4F4OC 2A5IA 3IWMA 2PWXA 3DA9B 4YLQH 1BDAA 1S0RA 3SU1A 1KXAA 4NCYA 4UDWH 4LZ4B 2BY5X 1GG6B 4MTBA 4NIVA 1V2JT 2FLRH 4B71A 1KXBA 3P8OA 5GXPA 4DCDA 3GY2A 1AZZA 4IMZA 3EE7A 4BAKB 4K8BA 2TBSA 5GCHG 3KQ5A 1LVBA 1SGYE 4FU8A 5C2ZA 2WYJA 2FOAA 4O3UA 1YM0A 2QGRA 3SBKA 3ZZCA 1SLVB 2EI7A 3EDXB 2KCAA 3ZZ9A 1FLEE 1GMHF 4B2CA 4KTUA 2CK3D 1H8IH 4ZUHA 1UCYK 1C2JA 1GJBB 5EPNA 1UK2A 3FZDA 2RG3A 2PW8H 3W94A 1HJAB 3LT3A 3MU5A 3TIUA 1D3QB 4AOQA 3QZRA 1GGDB 2C93B 1QJ6B 1GI8B 2SGPE 1SGCA 1TQ0B 1ZHMA 2NU3E 1GBLA 1ZJKA 3LH3A 2V0BA 3I78A 3UR9A 3NWUA 5L2ZH 2A32A 1RIWB 1NRRH 4K5ZA 3HKIB 4UONA 2BOKA 4JYTA 4DY7B 1WTHD 2H1UA 4RT0A 1IHTH 1GI9B 5C5OA 1HAYB 5A0CA 1O2JA 4Y0ZE 3EE0B 2BMGB 4YT6H 3A88A 5KGOA 3LDXH 2JH0D 3FOAA 1CA8B 2FODA 4FUGA 2FI4E 1EB2A 3AAVA 2G52A 4ABDA 4GAWA 2H5DA 3UR6A 5JBTA 1YCPH 3MTYA 1JIRA 2KFWA 3T62A 2ANKH 1SBWA 2NU1E 3QTOH 2WV4A 1YPGH 1YP9A 3MU0A 4KTCA 1C2MA 3MNSA 4ABIA 1C5UA 2G5NA 3U1JB 1D6WA 3E16B 1QY6A 2BLQA 2ZF0H 1UVPA 5EG4A 3SU5A 2XBYA 1GBMA 1Z6EA 1O3KA 4ISIH 3RXFA 2LELA 1AO5A 3ESTA 2XCNA 1VGCB 2J9NA 5E0GA 1GPZA 3CS7A 4TWYA 1OWHA 3ZVBA 1AY6H 1G36A 1GI3A 3UY9A 1O31A 1ELAA 1V2KT 4INLA 4R8TB 5FX5A 1S6FA 2C8YB 3ATWA 3SJ8A 1OWKA 1GVKB 3SNDA 4AN7A 3SV7A 3F6UH 1GL1A 2Z7FE 1WAYB 3ZZAA 1IQKA 4WWYA 3TK5A 5DP7A 5EJZA 1W0JD 2ZGHA 3RXOA 1EPTA 1IQLA 2ZO3H 1XKBC 1FZZA 4TPIZ 1XM1A 4NA8A 1H8HD 1CHOG 2PUXB 4X8TH 2VWMA 1IHSH 2ULLA 3ZZ5A 3MO9A 1ZTKA 1SOTA 4CRBA 4GVUA 1WBGB 2OC0A 3URDA 4XBBA 1Z1IA 3MNXA 2GT7A 1ANCA 1BB0B 1COWD 3GS9A 4AC9A 2D2DA 2OQ5A 3D65E 2OTVA 5FPSA 1MAYA 2TGAA 2TGTA 1GJCB 1TX6A 5JBCS 1ABJH 3A7ZA 4DG4A 4UFDH 3TLOA 3KIDU 4YT7H 1VCQA 1P8VC 7KMEH 3OTPA 1WSSH 2ILNA 1L4ZA 3M5NA 3MH5A 1P2IA 2OBOA 3SHCH 3DHKH 1SGEE 1BBRH 1AKSA 5E8EH 4DURA 1DSUA 1SGFA 2F4LA 1BITA 1TNLA 4LK4A 1T8LA 4JZFH 1G9IE 3A7XA 3SUDA 1MMJN 2RFKC 2BQ7B 2ZP0H 5A0BA 1HGTH 1KY9A 1P06A 2H9HA 3TITA 1IQMA 2Y81A 1UHBA 3SQHE 1TLDA 4TT3D 5IDKA 5FL7D 1C5OH 3ZZDA 5ETXA 2J2UA 2TGPZ 4CBOA 2V3MA 1L1GA 1K0HA 1FY5A 1V2WT 2ZGJA 5JPMH 1EZSC 2B0FA 3RLWH 4NA7A 2F83A 1S84A 2FI3E 1HCGA 1PPFE 1TQ7B 1VZQH 1MD8A 2BOHB 5T1VA 2O8WA 1H4WA 4DT7B 3STIA 1VITF 4XFQA 1C5SA 3RXCA 3MH6A 1O2UA 2FLBH 4Y10E 1F5LA 1EAUA 1O33A 4BXWA 3ZVFA 1V2RT 3A80A 2Z3EA 1YPKH 2O8LA 5HIZA 5EXMA 2ZECA 3C1KA 1OWDA 5IK2D 1V2PT 2Y5HA 2VWLA 4Q4LA 3E8LA 3UOPA 1TGSZ 1TBRH 2ZU3A 4FETA 1UTQA 3TVJB 3RC5A 3I29A 4I8JA 1BTWA 1PQ7A 1D4PB 4YOJA 3BF6H 1SQOA 1O3GA 4CRDA 1T7CA 1MCVA 3VB4A 1BIOA 2FMJA 3LJOA 1FXYA 3RXUA 5AHGH 3GY5A 1O3PB 5EXLA 1O37A 5F8TA 1K1PA 1Z7KA 4ABAA 1Y8TA 2OQUA 4Z6AH 1RRKA 1Y5BT 4FUCA 6CHAC 4Y71A 1YLDA 1KXEA 4Y8XA 3V0XA 4K69A 3C27B 3TH2H 1KLJH 4A7IB 2BZ6H 1K2I1 4CREA 1UTKA 1ESTA 3BSQA 1GI4A 1QJ7B 3M5OA 1MKWH 2TIOA 3RXMA 3SJIA 2FO9A 1AWHB 4MPVA 4NG9H 3TNTA 2ZDAH 3TK6A 1Y5UT 5F03A 5K7RA 3UB0A 2UWPA 1OSSA 3B23B 4SGBE 1MQ5A 1CT2E 1D3PB 1BOQA 3KGPA 3TJOA 2FOEA 3IG6B 3D62A 2L74A 3GYLB 2ZQ1A 4IN2A 1XUJA 1SLUB 1LMWB 3QLPH 1BTYA 4X1PU 1EPTC 2ZU5A 3SGBE 3ZYDA 3QDZB 1C5WB 3HGNA 3CENA 5GCHF 4D7FA 1FY1A 3SNBA 2AMPA 1AGJA 4XBDA 2BDGA 1A5HA 3SUGA 1DANH 3KQDA 2BVXH 3MO3A 3SZNA 1ETTH 1YLCA 4UFEH 1UVUH 1V2NT 2QAAA 1W8BH 1AI8H 1V2QT 1ZZZA 4IS5A 3QGJA 2BD4A 3PRDA 4GUXA 1C5LH 4Y79A 1O2GH 6CHAB 1F5KU 3OEHD 2PV9B 2ZFTA 1LHFH 5KECA 4WMDA 3CNRA 5I25A 1AUJA 2W3IA 2WV9A 4B76A 1GHVH 3EQ0H 3I77A 8ESTE 3GCHC 5E2PA 3TNSA 3Q3KA 4DW2U 2F3CE 1PYTD 3RXEA 1YY3A 2G4TA 1SHHB 1C1SA 2VWNA 3A83A 1HV7A 1SFQB 1ORFA 5GDSH 4BANB 1EJNA 1HJ9A 4ZKNU 1ZMNA 3HK6B 5DP3A 1C1UH 4FU9A 3FFGA 1CT4E 2XOKD 4MVNA 3NUMA 1YYY1 1XVOA 1C5NH 3QO6A 4O3TA 2ODQA 1ZTJA 4OS6A 1KDQB 3A8AA 2YOLA 4DVAU 2A0QB 2GMTC 2J94A 3A82A 4CHAC 1A3EH 1V6DA 1GVLA 1O2TA 3BG4B 4RT1A 4X2YA 1HAPH 2GZ9A 4O9VA 1HUTH 2UUYA 1G2MA 1Q31A 5DP9A 3L33A 4YTAA 1KXFA 4ABHA 2PHBA 2OP9A 1E0FD 3LGTA 2NU2E 5C94A 5LPFA 4HZHA 1ABIH 2KAIB 3ZVDA 1TMBH 4ZHMU 4GPGA 2ZHWH 1O5CB 5DGJA 1J9CH 3A7TA 1DDJA 4U30A 1KIGH 4A1VA 2C8ZB 1CE5A 1HRTH 3FVFB 3TGJE 2AIQA 1AHTH 4K1TA 4ABEA 1AKSB 3M7UA 3MO6A 1BJVA 2BDHA 2XWBI 3RXSA 4FUIA 1NZQH 1NN6A 1TIOA 2ZDLA 4I8KA 1V2ST 2OINA 3SV8A 3FN8A 1DX5M 1Z71A 2XNIA 3GCHB 2AGGX 1C2HA 3RMNH 1YPEH 3MHWU 1F7ZA 1UHBB 3UIRA 1XMNB 3PMJA 1GHXH 3BTDE 1TNIA 1CHOF 4O97A 1LDTT 2YNBA 3MI4A 2FS9A 1J8AA 1UCYH 2Z6BD 1NROH 1QQ4A 1FJSA 2J98A 1GBHA 1P3CA 1EB1H 1LVYA 3MYWA 1W7XH 1JWTA 1ZLRA 2YMSB 2KCYA 4CHAB 1QBVH 4OS4A 3M5MA 1YC0A 4Y8ZA 2FEQH 4ISOA 2UWLA 1HXFH 1INCA 2ANYA 2ZFQH 2CN0H 3RMLH 2GD4B 4GHQA 1NU9A 5C0TA 2W3KA 2SGFE 1W2KH 4KTSA 1WTGH 3DCLA 1C2GA 2PGQB 4JYUH 1W7GH 2BXUH 1L4DA 4WH8A 2EC9H 3MU8A 4DIIH 1S0QA 1V2UT 4X2VA 2VGCC 3KNXA 4NIWA 2A2XH 2VU8E 5EJLA 5DKMA 3HK3B 4K2YA 2VB0A 1GBEA 1HIAA 1TRMA 3EGKH 1QRZA 5B6OA 3SV9A 3R0FA 1WQVH 1T4VH 4I7YH 2VIDA 1W13U 2K0QA 1ELGA 3GY8A 4K3JA 1O5FH 3FAOA 2WSSD 1OWEA 1MH0A 1HYLA 2F43B 2WUCA 5DP4A 1XUFA 1LHCH 1JXPA 1N6YA 1PYTC 3EA9A 4BAHB 3LU9B 3QTVH 2JH5D 2Y7ZA 3B8JA 1UK4A 1BTZA 3RM0H 1J14A 3FO8D 4P00A 1VCWA 3MU1A 2GP9B 2FOFA 4WXIA 1ID5H 2A7CA 3ZZ8A 3T25A 1ETRH 5C3NA 3ZV8A 2BD9A 1HAIH 2D1JA 1LKBA 3VB3A 3RXKA 4B73A 2J95A 1UVTH 3BTHE 1EATA 2ZDNA 1O34A 1FY3A 2Z9KA 3ZV9A 3D23A 3BEUA 3PRBA 2ZEBA 4YO9A 1RTFB 4NSVA 3ZVCA 5T3HA 3M3TA 3LPRA 1K1NA 5IYTA 1E34B 1ANBA 3SQEE 1ZGIA 2G8TA 3DT0H 2F9PA 3P6ZB 5C1YA 1SSXA 1SQRA 2VGCB 1TNJA 1GBTA 4X2WA 1AVGH 3SU4A 1SLXB 1W10U 4E7RG 3GISB 1Q2WA 2BY9X 5LGOA 1SVPA 3F0PA 5A2MH 3O8DA 3JZ1B 2Y5FA 5L6NH 1B0FA 2A4RA 2KX4A 3LJJA 2AGEX 1CO7E 1NO9H 1GHYH 1O5AB 3UAIC 3RU4E 1NM6A 4U32A 2BQ6B 1MU6B 4Y7BA 4RI0A 1IQIA 3F1SB 2Y6TA 1HAGE 2ASUB 2Z3DA 1DICA 1S83A 1J15A 3N7EA 4J2YB 5AFZH 2XRCA 1AWFH 2SNVA 1PPGE 1ELTA 1LCYA 3GDSA 1H9HE 1C2KA 3L6PA 1K1IA 1GI2A 1NFXA 4CRAA 2BXTH 3BTTE 2BDYA 1YPLH 1ESAA 3SU3A 2BYAX 4AFUA 1SQTA 3PLKA 2IOTA 5C1XA 1ACBE 1V2TT 3U98H 1O3HA 1VR1H 1T8NA 1C2LA 3OSYA 1OWIA 1P9SA 1LQEA 4RSPA 2BM2A 1E79D 3Q76A 4HI3A 1O2PA 2WPMS 4HG6A 1OYTH 2AHME 3HATH 5I46H 2GX4A 3A8BA 4AX9H 4VGCB 3SJ9A 2ZC9H 3F9FA 1TRYA 4ZKRU 4E7NA 4LZ1H 1GBDA 3P92A 2XC5A 2P3UB 1OXGA 4Y7AA 5JDUB 1BA8B 2FESH 1IOEA 3F9HA 3RC6A 1TNKA 5E2OA 2A7HA 1J16A 1JRTA 2ZCHP 2P94A 4XBCA 4MNYA 3F9GA 1A5IA 1WQSA 3A7VA 2QV1A 4WMFA 1LPZB 1EAWA 1AVWA 2A5KA 2K1QA 3KQEA 4GCHG 2GZ8A 4AB8A 3PV5A 1SOZA 1ZSLA 1EJAA 3GDUA 1FIZA 2OUAA 2UUJB 4FUJA 2WPDD 3VXFH 3JZ2B 4BNRA 2G4UA 3QUMP 1F5RA 1S6LA 1CU1A 1TBQH 1KMHB 2W6JD 2XXLA 2ZG0H 2ZGBH 4Q80A 2IPQX 3HKJB 4YXWD 2BVRH 2SGEE 3A84A 2JIZD 4H6SB 4YM9A 2STAE 1D9IA 2W6ID 3PYHA 5TCCA 1LO6A 1BRBE 2G51A 1WYKA 2PFEA 1CHGA 1P2KA 3M37A 5C20A 2BX3A 1QRWA 3H7TA 3P8FA 2ZU1A 3STJA 1A3BH 2BZAA 2PP6A 2ZA5A 5A0AE 1MZDA 2QXGA 1VJ9U 3GCOA 1DOJA 3LH1A 3MOCA 2ZFRH 5FCRA 3MU4A 2J98B 4E06H 3QX5H 3F9EA 1P57B 1YWUA 4Q7XA 5FXLA 2V6NA 4X6NA 2A4QA 1QTFA 1TA6A 3ATLA 1ZHRA 1TX7A 4I32A 1O2ZA 1ANEA 1DLKB 1V2MT 4FUFA 3V13A 1RGQA 2HNTF 2ZQ2A 1FIWA 4KP0A 1YF4A 4ACBA 4A5TS 1O2VA 1QNJA 3GCNA 1CGJE 3RXAA 3WWFA 5L30H 5CMXH 1FY4A 1ESBA 2VINA 1HNEE 5JYIA 1Z1JA 2F9BH 5FBIA 2J38A 4X1SU 5HGGA 1D6RA 1O3IA 4E05H 2W7UA 4MDSA 3RU4D 2JH6D 1P10A 1RTKA 4X1QU 1BJUA 5EQQA 3R3GB 1SGDE 3Q00A 4JZ1A 2XBWA 3SOSA 2J5UA 2LP6A 3E0PB 3MNBA 3FP6E 3UFAA 4WXVA 1KTTB 2NU4E 1NC6A 2A45B 3A85A 4A92A 2ZGCA 3RXPA 4K8YA 1SHYA 1XXFA 2DUCA 3BEFB 1G2LA 1TGBA 1EFRD 1BRUP 4ABBA 3SU2A 1C2EA 4D7GA 4D9QA 3WY8A 3WWBA 2H9EH 3BV9B 5BRRE 1ELFA 2ZKSA 1DWDH 1SI5H 1OKXA 1TGTA 4ISNA 1DSTA 2VIVA 4TY7A 2XBVA 1P09A 2Z9JA 2O8TA 2GJGA 1WUNH 2FYQA 5PTPA 4OS5A 4NGAH 1CA0C 2BD7A 3E0NB 1EQ9A 1KSNA 2P95A 2BD2A 2B8OH 2GGVB 3BTME 1W0ZU 1ZRKA 5LPEA 2VH6A 1W0YH 1WOFA 1GHAG 1QCPA 2FOMB 4XDEA 2BDIA 2I6SA 1O3DA 1BCUH 3OYPA 1SGFG 4J1YA 2EEKA 1V2LT 4B2AA 1S85A 1UTJA 1O2IA 2JJ1D 3QZQA 2FOBA
chains in the Genus database with same CATH topology
4MLFB 1HPGA 2VWOA 4AB9A 1E37B 1HAOH 1SFIA 2H5CA 1CBWC 2ANMH 6ESTA 2XTTB 3UPEA 5FCKA 4HFPB 5GWZA 4I31A 1G3EA 1TMUH 3CP7A 2ZPSA 4WH6A 2VVUA 4THNH 1O3MA 1AE5A 2NWNA 3Q77A 5FPTA 1C5TA 1ZSJA 2FDAA 4Y0YE 2PKSC 1UJ1A 5JBBS 3N7OA 2WINI 1GI0A 3BTGE 4B74A 2CXVA 1OPHB 1ELEE 2FOGA 1DPOA 1L1NA 1P9UA 4ZXXH 1PPBH 1AN1E 1NESE 2W26A 3ODFA 2Q6GA 4AORA 1FI8A 2BVSH 1A61H 1O3AA 2G81E 4X0WU 1F0TA 2FOHA 1AFQC 1O5BB 3TH4H 1SB1H 3UWIA 2CMYA 1MTSA 3DD2H 1SGTA 2HLCA 1DXPA 2YNAA 4D9RA 3NZIA 3MMGA 3P8NA 2IN2A 2AS9A 5ESBA 4JYVH 1Y5AT 1BMLA 3PTNA 1ETSH 3D49H 3T29A 1YPHE 3TK9A 2VH0A 1LKAA 2R3UA 1O2NA 2C8WB 3MNCA 2F9UA 3FZZA 1GI6A 3GCTG 1CBWB 3PO1C 1MZAA 4DOQA 3UQVA 1FPCH 4NIXA 4YOIA 3B9FH 1EZUC 4NFFA 3GOVB 5J4SA 1C4U2 3NK8A 3RXRA 2Y5GA 1MTNC 3RXGA 4X6MA 4X1RU 3SUFA 3GYMA 3VEQB 4BOHA 4AZ2B 2HALA 1G3DA 4MPWA 4MNXA 2EA3A 1O3JA 3SGQE 3PTBA 2OC1A 2F9NA 1C2IA 3TH3H 5CHAC 1QB1A 1CQQA 3MFJA 1K1JA 4K60A 4ISHH 3E3TA 7GCHG 1UTMA 1F2SE 3MWIU 5E0JA 2TRMA 2ZHQH 1OP0A 2M5TA 4H42U 1AZ8A 1T31A 2BD3A 1EXFA 2G00A 1AFQB 1UVSH 1W11U 5F6MA 1NRPH 1K28D 1FMGA 1UTOA 2HRVA 1BQYA 5EQRA 1JIMA 1QQUA 2VNTA 2A4OA 4IW4E 4A6LA 1O2XA 2ANWA 4JZIA 1GDNA 3O8CA 1A7SA 1MTVA 3DUXH 4AFQA 2BLVA 1E35B 1GJAB 2HGTH 1VJAU 1ZOMA 3MH4A 2GCTC 2PTCE 1NS3A 2ZHEH 2C90B 4ZMAH 1QA0A 2HVXA 4Z0KA 2H2ZA 5FX6A 1QURH 3PM3A 4K1SA 1ZMJA 4GCHF 1T32A 1LHEH 1HBTH 2PKAA 1K21H 1NPMA 2Y80A 3OY6U 1C1NA 1GMDG 3A81A 2ZFPH 2R3YA 2VIPA 2AMDA 2ZTZA 4ZROA 1GBCA 4X8VH 3S7HB 2QN5T 2AH4X 1SG8B 1FPHH 3K2UA 1G3CA 1NRSH 2ZU4A 3AW1A 3VGCC 1NFUA 2J34A 2BY7X 5CHAB 4KGAA 1EZXC 1UMAH 3PV4A 3Q3XA 2Z9LA 5HMAA 1EPTB 2VJ1A 3AW0A 3PLPA 3ZYEA 4OGYA 4WVPE 3M5LA 1EP6A 4IMQA 1A0HB 4ABJA 2Z9IA 4Y11E 1FDPA 1THPB 1XUIA 4MPUA 1KXCA 3TJUA 1K1OA 5L2YH 4ABGA 3RM2H 5BPEA 3SO3A 2ZPRA 2JETC 2CHAC 1KTSB 1C1QA 3H7OA 1TNGA 2VVVA 2RA3A 1V2OT 1W3CA 3CS0A 3U69H 7LPRA 2P8OC 4RKOB 1YPJH 2ZPQA 2QCYA 1GJDB 4YOGA 4YZUA 1LPGB 1UTNA 3VB5A 4IGDA 1GJ9B 2F91A 2HWLB 5AF9H 4LXBH 5EGMA 5A8ZA 3ATKA 5GPIB 3GY3A 1A0LA 1L0ZA 3ITIA 4ZKSU 1DY9A 3BIVH 3BTKE 1MD7A 2O8MA 3LKWA 3TJVA 2BY6X 1G32B 1MKXK 3SJKA 2A4GA 1DWEH 1RFNA 1CGHA 1TWXB 4XE4A 3S69A 2P93A 5JBAS 3SGAE 2RDLA 3RXDA 3VFEA 2GMTB 1W12U 2H9TH 4ESTE 4CH2B 1K1LA 5G4BA 2J4IA 1BT7A 4MQAA 2GVFA 1THSH 3IITA 3ZZ4A 3PMHB 4IN1A 2WYGA 1ELDE 5C1UA 1DM4B 2SGDE 1EJMA 2QA9E 1ZJDA 3V7TA 3LGWA 2ZFSA 3RUOA 3VPKA 1OOKB 5A8YA 1Z8RA 2XYAA 3S9BA 2OC8A 2Z94A 3FP7E 1HLTH 3PMBB 1TX8A 3LGUA 1O2OA 2A7JA 1MQ6A 2IPHA 4TYDA 1U6QA 1SGIB 4B2BA 1GHAF 4RN6A 2ZDVH 3G01A 1F0UA 1EUFA 5EW2H 1FNIA 1O3OA 2ODPA 2UUKB 2WPKS 3SORA 5LH8A 3RXJA 1P2NA 1GBIA 2F9OA 2XC0A 1QL9A 2WPJS 5ABWA 1TABE 4UD9H 5HYOA 2TPIZ 2Q6DA 1TMTH 1P05A 3SNAA 1OP2A 1O5GH 2NU0E 2ZU2A 3ATMA 3W95A 1HFDA 1DT2A 2BTCE 1P04A 2RA0A 1O2SA 2C8XB 1IQJA 1GHBG 3NPSA 1S5SA 3ZZBA 1UVOA 3KN2A 1THRH 2VIWA 1Y3XA 5A09A 2V35A 5EXNA 2QIQA 2LPRA 1PPHE 2UUFB 4CBNA 3PLBA 1KLIH 2R2MB 1AVXA 5TCAA 1AD8H 1BMMH 2AERH 3VXEH 2FIRH 1O5DH 3QGNB 1JBUH 3U1IB 1GG6C 1O35A 3T26A 3QWCH 1SR5C 8GCHG 1O38A 2LNCA 2SGAA 4D76A 1BTXA 1QA7A 1SQAA 1QR3E 4X8SH 1IQHA 2GV7A 1C1RA 1CSOE 3EA8A 3GCTF 1NFYA 1GJ5H 1O36A 3P17H 4TWWA 1KLTA 2D8WA 2FOCA 1YPHC 5JB8S 3M7QA 1BZXE 1O5EH 1XX9A 1HJAC 2FWWA 1YCPM 4ZAEA 1ELBA 2PKAB 1C1TA 2Q1JA 1ARBA 1GMCG 1GBBA 1MCTA 3S9AA 2ZIQH 2CJIA 3QN7A 2BX4A 7GCHF 1FAKH 2IJOB 1TGCA 2VVCA 2ZFFH 4Y8YA 3RMOH 1HJ8A 1RIWC 3LONA 2VIQA 5EOKA 1Y3UA 3GICB 4BXSA 5HXFA 1HAHH 1ARCA 1ZR0A 5DK1A 5AFYH 1AB9C 3T28A 1TPAE 1YGCH 3RXVA 1P3EA 4BAOB 4IC5A 5GJ4B 4CH8B 5E0HA 1TE0A 1UTLM 4DIHH 3KF2A 3URCA 4AFZA 1F0RA 1P2MA 3S7KB 4ZHLU 1QHRB 2OXSA 4X1NU 9ESTA 1FUJA 1GBFA 3KHVA 4ZHAA 3LOXA 1C5PA 3TGIE 2HPQH 1TPOA 1O3CA 3QK1A 3RXIA 2WUBA 1A1RA 2FYRA 1EP5A 5K0HA 3LGIA 2FX4A 1GMDF 2QF0A 1C5MD 3LC5A 1HXEH 3AASA 3PROA 3M36A 1N6XA 1VGCC 3AVZA 4IC6A 3RP2A 2Y7XA 1BTPA 2XW9A 3BTFE 4ZKOU 4CRFA 1AUTC 3U8TH 1TBZH 1S82A 1JMOH 2SNWA 1CGIE 1XKAC 1O2RA 1DUAA 4H6TA 1EOLA 2ZHDA 1X7AC 3MH7A 4TPYA 3M3SA 4CRCA 1O3BA 1TOMH 1LPKB 3U8OH 1OX1A 4TY6A 2GCHF 3TPIZ 1PQ8A 1P02A 4U01A 2FXRA 1GHWH 4FUBA 1GBJA 1LQDB 3A89A 3BTQE 4X8UH 1BRCE 1G3BA 1AB9B 1MUEB 1QB6A 2D26C 1EAXA 4NSYA 1EOJA 1DXWA 1P01A 1NRQH 2ZHFH 2OC7A 4GSOA 5FPYA 2O9QA 1GJ7B 1O2YA 2CV3A 1XXDA 1SMFE 3L3TA 2XWAA 2OBQA 1O2QA 9LPRA 2O8UA 1ZMLA 4FVDA 1S6HA 1MTWA 2W5EA 4M7GA 1K22H 2FTLE 4R0IA 5EW1H 5EPYA 4F49A 4AG1A 1GDUA 3PMAB 1V2VT 4YESB 3AAUA 1NFWA 3K6ZA 2GDEH 3P95A 5C67A 3SI3H 1DVAH 2ZWLH 4INHA 2C3SA 1RXPA 1HIAB 1AU8A 3KCGH 3HPTB 3DFLA 1B0EA 1YPMH 4A1TA 4AG2A 4X6PA 1BMAA 1W14U 3E6PH 2EI8A 1C4Y2 4Y76A 2BB4A 3EA7A 1S81A 2PGBB 4INKA 4Q7YA 3E91A 2SFAA 3GY4A 2OLGA 5TJXA 1KDQA 3LIWA 3ZVAA 1MTUA 4NA9H 1TOCB 2G55A 1HDTH 2R9PA 1O3FA 2FI5E 3ELAH 1PPZA 6GCHG 2PLXA 3U8RH 3KEEA 2BDCA 1DWBH 3K6YA 1TPPA 3T2NA 1QBOA 1TB6H 2ALVA 1O39A 3ZVEA 1ZRBA 2ZGXH 1KXDA 3OU0A 2RCEA 4AYYB 4WF8A 1NT1A 1QRXA 1AFEH 1IQGA 2KAIA 1C5ZB 2PTNA 2AEIH 3SV6A 1EAIA 2DE8A 1EX3A 1P2QA 4GLYA 4NFEA 4JZDH 1GCTC 4FVBA 5EODA 1A46H 4UE7H 3SW2B 1ZGVA 1VCPA 4B75A 5C5NA 1B7XB 1FAXA 3E1XB 3DFJA 1DWCH 4FUEA 1Y3WA 1GBAA 2PSYA 1BTUA 2V3HH 1MU8B 4BTTB 1QBNA 3A7YA 4JK5A 1QL8A 1BBRE 1ELCA 1DITH 3EYDA 1PPEE 3RXTA 1C1OA 1FONA 2QY0B 4PROA 1GHBF 2AMQA 1SLWB 3PWCA 2ZDMA 5T6GA 1M9UA 5DP8A 2R0KA 4I33A 4XOJA 2QF3A 3ZZ3A 4BAQB 1IQFA 3RXBA 1GI1A 1BUIA 2QXJA 4Q2KA 4AYVB 3HGPA 3M3VA 1DUEA 3M7TA 4NIYA 3UUZA 4AGKA 1MBQA 1QIXB 5DO4H 3TJNA 2STBE 4IBLH 4JCNA 5DPAA 1YKTA 3SU6A 2BY8X 1LHGH 1ZHPA 3LC3A 3UNRA 1ANDA 1MKXH 1CA0B 2B7DH 1B5GH 6LPRA 1OS8A 1EZQA 3ZVGA 4CR5A 2CF9H 1C1VH 1P12E 3RC4A 1PJPA 2FTMA 2OD3B 8GCHF 1ELVA 1GCTB 1TGNA 2Z9GA 4ASHA 1PQ5A 1T8MA 1NU7B 2FPZA 1PFXC 3M35A 3SJOA 1WU1A 1JRSA 1Z8GA 1C2FA 4KELA 1LVMA 3V12A 1HAZB 5T6FA 2HNTE 1O3NA 1NY22 1K1MA 1V3XA 5FBEA 3UNSA 2BDAA 3A86A 2OCVB 1Y3VA 3UTUH 2SGQE 1C9PA 4WJG2 3GDVA 2B9LA 4JZEH 2PUQH 1H9IE 1TA2A 2J92A 1SGQE 1SC8U 2PKSB 2WPIS 1ZPZA 2PR3A 2FS8A 4HGCA 4K1EA 1GMCF 2A1DB 1G30B 1YCPK 4NZLA 5ESTE 2GKVE 1C1MA 1HAXB 5DJ7A 3S9CA 1T4UH 1GL0E 1P2JA 3NXPA 1SGRE 1ZSKA 3BTEE 4D8NA 4XSKU 1PPCE 2ESTE 1HB0B 4SGAE 1N1LA 3UREA 1EASA 1O30A 3BG8A 1RJXB 4FU7A 3RDZA 1F92A 1OP8A 1ZTLA 2BHGA 4UFGH 3BEIB 4I8GA 3SUEA 3ODDA 1XUKA 1ZPCA 3K65B 2GV6A 2B5TB 3BG4C 3BN9A 7ESTE 1YBWA 1XVMA 1G37A 3KL6A 1QGFA 4FUHA 4WMEA 2ZZUH 1GJ8B 1LVOA 3E90B 1HAVA 1C1WH 2AYWA 2ZNKH 2TGDA 3PO1B 1E38B 1O32A 1SGNE 1OYQA 2V3OH 1DFPA 4Y6DA 3SNEA 1O2LA 1GMHG 1DLEA 5EQSA 2F9VA 3A7WA 2P59A 1L1JA 1MTNB 5T6DA 4OS2A 5HM9A 1GBKA 2EI6A 4MG3A 2QXIA 4CR9A 1VITH 1FV9A 4UFFH 4BTIB 4JMYA 1GHZA 3M61U 3VB6A 2H6MA 1DE7H 1CT0E 1AQ7A 1KYNA 4X6OA 5CE1A 1PQAA 2GCHG 1H8DH 4X2XA 2A31A 3P8GA 2BQWB 4FXGH 1A4WH 1BBRK 3SV2H 2PSXA 3FANA 1O2MA 2GTBA 3NCLA 3OTJE 1O2KA 1C5QA 1P0SH 3BTWE 4OS7A 1XUHA 4OGXA 3SNCA 2P16A 3SHAH 4QT8C 4CRGA 4DGJA 4HTCH 1WCZA 5H4IB 2GCTB 4ISLA 2W7SA 2AGIX 1O2WA 5DP5A 2BD5A 5AVDA 4BAMB 1P11E 2HPPH 1P03A 1IQEA 4MNVA 1OWJA 5GIBA 2BLWA 1N8OC 8KME2 1IAUA 1FN6A 2CF8H 2ZCLP 1TNHA 1Q3XA 3ENSB 3RLYH 1GVZA 1SPJA 1FY8E 2ZTXA 2ZCKP 3H5CB 3ZZ6A 1K9OE 1O0DH 5JB9S 1A5GH 2WPHS 3VGCB 1C5YB 1C5RA 1RTLA 1NRNH 4NZQA 3UNQA 3OY5U 1UTPA 4AGJA 3V3MA 1UK3A 3A8CA 3K9XB 1BRAA 2R2WU 3A8DA 5F8ZA 4I8LA 4BTUB 1MAXA 6GCHF 2XBXA 1UO6A 4RKJB 1ZPBA 1Y3YA 1O2HA 4UEHH 2THFB 2WV5A 4FUDA 2FZZA 3BIUH 2GZ7A 1O3LA 5LPRA 1F0SA 1MBMA 2CHAB 2JETB 2QC2A 8LPRA 3LGVA 1UCYE 3ZZ7A 1C2DA 2HOBA 2QYIA 2P8OB 2XCFA 2ALPA 3OX7U 3RU4T 3UOUA 4WY3A 4GHTA 3NKKA 3T27A 2UWOA 4LOYH 1DS2E 1N8OB 1AMHA 2QXHA 1C5VA 2BD8A 2ZI2H 5FHTA 2FX6A 5F8XA 1D3TB 1MKWK 4O03A 1Z8IB 5DP6A 1SGPE 2ODYB 3UWJH 2FM2A 2JKHA 1BHXB 2P3TB 3KQCA 3T5FH 3LGYA 1H9LB 2A5AA 4AFSA 1NTPA 1H1BA 1CVWH 1L2EA 1GWAA 1ZYOA 2Y82A 2GT8A 4H4FA 5FAHA 3RXLA 2P3FH 2I6QA 1O3EA 2VIOA 1BTHH 1DY8A 4DJZB 5A8XA 1JOUB 5J4QA 1VITG 1GDQA 5HM2A 2A2QH 1WV7H 1E36B 3KQBA 3PWBA 2DE9A 2CGAA 1LTOA 2R0LA 1TAWA 4OS1A 2G5VA 1C4V2 3RXQA 3GY6A 4I8HA 1TFXA 1QB9A 1IQNA 1D3DB 1EKBB 2ZDKA 3VB7A 1GI7B 2Q6FA 2XC4A 4B1TA 1SL3A 4NWLA 3UQOA 1AIXH 1GJ6A 3S0NA 1TPSA 4Q7ZA