1FYBA

Solution structure of c1-t1, a two-domain proteinase inhibitor derived from the circular precursor protein na-propi from nicotiana alata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
111
structure length
111
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE INHIBITOR
publication title The solution structure of C1-T1, a two-domain proteinase inhibitor derived from a circular precursor protein from Nicotiana alata.
pubmed doi rcsb
source organism Nicotiana alata
molecule tags Hydrolase inhibitor
total genus 12
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02428 Prot_inhib_II Potato type II proteinase inhibitor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA02
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1fybA01
4OVOA 2KMOA 3OVOA 2KCXA 1IY5A 1SGRI 1YU6C 2XRCA 2JXDA 1CGII 2JYYA 1HDLA 1HPTA 3QTLD 1TIHA 2SGFI 1CT4I 1HJAI 1TUSA 2QQDA 1M8BA 1TURA 2N52A 2NU3I 5DAEA 2M5XA 1UVFA 2LEOA 2ARPF 2SGEI 1PCEA 1BMOA 2WCYA 1TBQR 1Y1CA 1FYBA 1PPFI 1SGDI 2KMPA 2V53A 1OVOA 1TGSI 1DS2I 2B0UC 1TBRR 3SGQI 2GKTI 1SGYI 1SGNI 1BUSA 1SGEI 1MT1A 2NU1I 1OYVI 1YTPA 2KMRA 2SGDI 1NUBA 2N17A 1CGJI 2BUSA 1IW4A 2SGQI 1CE3A 1DS3I 2F3CI 1PJUA 2GKRI 2GKVA 3HH2C 1M8CA 1H0ZA 2SGPI 1UUCA 2QQCA 1N13A 2KMQA 1AN1I 1CSOI 4SGBI 2OVOA 1OMUA 5JHWC 4GI3C 1CHOI 1UVGA 1Z7KB 1LR9A 4HGUA 3SGBI 2P6AC 2NU4I 1R0RI 3B4VC 1Y1BA 1OMTA 1SGQI 1LR7A 2ERWA 1LR8A 3SEKC 2JZMA 3TJQA 1CT2I 1CT0I 1SGPI 2NU2I 2NU0I 1IY6A 2N71A 1KMAA
chains in the Genus database with same CATH superfamily
2J87A 4A24A 4OVOA 2QPOA 2KMOA 3OVOA 2KCXA 1IY5A 2JW6A 1SGRI 1ULMA 1YU6C 1W3SA 1MJAA 2XRCA 3UOEA 2JXDA 5CCMA 1CGII 1MJBA 3UGDA 2ENZA 4DNCA 3RU0A 2JYYA 1HDLA 2DKVA 3OL0A 9WGAA 1X74A 1HPTA 3QTLD 2X3TA 2GVIA 5FUWA 1TIHA 1NXUA 2SGFI 3GOXA 2CWGA 1WKXA 2ORVA 1CT4I 3TO6A 1HJAI 1TUSA 2ODDA 2QQDA 4UXJA 1M8BA 2UVOA 5HI7A 1TURA 1V1IA 1V1HA 2N52A 2NU3I 2V1CC 5DAEA 3UGLA 2M5XA 1UVFA 2LEOA 7WGAA 2ENNA 2ARPF 5FUXA 2SGEI 1MJ9A 1PCEA 2UZ3A 4AMLA 1BMOA 2WCYA 1TBQR 1Y1CA 1FYBA 2L7XA 1PPFI 5EX3A 1SGDI 1WTJA 5CCLA 1K7TA 2KMPA 3FSYA 2V53A 1OVOA 1TGSI 1DS2I 3R5BA 5E3PA 1ULKA 3BJIA 2B0UC 1TBRR 5E3QA 2K9HA 2DB6A 3QAHA 3SGQI 2GKTI 3R5AA 5J8FA 1TOTA 1TBNA 4L9MA 5EX0A 4B6DA 1FY7A 1SGYI 1SGNI 2JA1A 1XX6A 1KBEA 1BUSA 2FNFX 1SGEI 2Y0MA 5FUVA 1Y8FA 1MT1A 4FKDA 2CWFA 3FSXA 2NU1I 1OYVI 1YTPA 1RFHA 2KMRA 1NUBA 1XBTA 1CGJI 2N17A 2LB7A 2QQEA 2SGDI 2BUSA 2WVJA 5J8CA 2PQ8A 3VDPA 1IW4A 3KY9A 2E73A 2SGQI 2RIJA 1W4RA 2YUUA 3TOBA 3VE5A 1CE3A 4MPIA 2RC4A 1DS3I 4E1RA 2F3CI 1PJUA 2GKRI 1FAQA 2ELIA 5E3RA 2GKVA 2W0TA 1FARA 3E59A 3HH2C 1M8CA 1H0ZA 4E1PA 1PTRA 1R79A 2SGPI 2VRWB 1UUCA 2QQCA 3UEJA 2LUYA 1N13A 1UHAA 1ULNA 2KMQA 1AN1I 5HQ8A 2E5RA 3E2IA 2ROWA 1CSOI 3TO9A 1PTQA 2CJSC 4SGBI 4UXIA 2ORWA 4WP4A 2OVOA 3PDNA 1S20A 1OMUA 5JHWC 3QWPA 3R5DA 2OZUA 1X4SA 1CHOI 3OXLA 1WGCA 2OD1A 4GI3C 2X52A 3TOAA 3UGIA 1Z2IA 3CXLA 2QQ0A 2CWHA 3OXFA 1HEVA 1UVGA 2YQPA 1Z7KB 1XA6A 1U5KA 3D00A 2N1AB 1LR9A 4HGUA 3SGBI 3OXGA 2P6AC 2L8EA 2NU4I 3R5CA 1K7VA 1P9GA 1K7UA 1R0RI 3B4VC 1Y1BA 1OMTA 1WGTA 1SGQI 4UXHA 3VDUA 1LR7A 1Q9BA 1TBOA 1LR8A 2ERWA 3FC3A 2GIVA 3MEKA 1KBFA 2OU2A 2JZMA 3SEKC 3UEYA 2J9RA 3UFFA 3TJQA 1P9ZA 2V1CA 2B8TA 1CT2I 1CT0I 1SGPI 2DIPA 2NU2I 2NU0I 1IY6A 2N71A 2A20A 4JCVE 1KMAA 1VDDA 2WGCA 3TO7A 5FUYA
chains in the Genus database with same CATH topology
2J87A 4A24A 4OVOA 2QPOA 2KMOA 3OVOA 2KCXA 1IY5A 2JW6A 1SGRI 1YU6C 1W3SA 2XRCA 2JXDA 5CCMA 1CGII 3UGDA 2ENZA 3RU0A 2JYYA 1HDLA 3OL0A 1X74A 1HPTA 3QTLD 2GVIA 5FUWA 1TIHA 2SGFI 3GOXA 2ORVA 1CT4I 1HJAI 1TUSA 2ODDA 2QQDA 4UXJA 1M8BA 5HI7A 1TURA 1V1IA 1V1HA 2N52A 2NU3I 2V1CC 5DAEA 3UGLA 2M5XA 1UVFA 2LEOA 2ENNA 2ARPF 5FUXA 2SGEI 1PCEA 2UZ3A 1BMOA 2WCYA 1TBQR 1Y1CA 1FYBA 2L7XA 1PPFI 5EX3A 1SGDI 5CCLA 2KMPA 2V53A 1OVOA 1TGSI 1DS2I 3BJIA 2B0UC 1TBRR 2K9HA 2DB6A 3SGQI 2GKTI 1TOTA 1TBNA 4L9MA 5EX0A 4B6DA 1SGYI 1SGNI 2JA1A 1XX6A 1KBEA 1BUSA 2FNFX 1SGEI 5FUVA 1Y8FA 1MT1A 4FKDA 2NU1I 1OYVI 1YTPA 1RFHA 2KMRA 1NUBA 1XBTA 1CGJI 2N17A 2QQEA 2SGDI 2BUSA 2WVJA 3VDPA 1IW4A 3KY9A 2E73A 2SGQI 2YUUA 1W4RA 1CE3A 3VE5A 1DS3I 4E1RA 2F3CI 1PJUA 2GKRI 1FAQA 2ELIA 2GKVA 2W0TA 1FARA 3E59A 3HH2C 1M8CA 1H0ZA 4E1PA 1PTRA 1R79A 2SGPI 2VRWB 1UUCA 2QQCA 3UEJA 2LUYA 1N13A 2KMQA 1AN1I 5HQ8A 2E5RA 3E2IA 2ROWA 1CSOI 1PTQA 2CJSC 4SGBI 4UXIA 2ORWA 2OVOA 3PDNA 1OMUA 5JHWC 3QWPA 1X4SA 1CHOI 3OXLA 4GI3C 2OD1A 3UGIA 3CXLA 2QQ0A 3OXFA 1UVGA 2YQPA 1Z7KB 1XA6A 1U5KA 3D00A 2N1AB 1LR9A 4HGUA 3SGBI 3OXGA 2P6AC 2L8EA 2NU4I 1R0RI 3B4VC 1Y1BA 1OMTA 4UXHA 1SGQI 3VDUA 1LR7A 1TBOA 2ERWA 1LR8A 3FC3A 1KBFA 3MEKA 3SEKC 2JZMA 3UEYA 3UFFA 2J9RA 3TJQA 2V1CA 2B8TA 1CT2I 1CT0I 1SGPI 2DIPA 2NU2I 2NU0I 1IY6A 2N71A 2A20A 4JCVE 1KMAA 1VDDA 5FUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVO A;  2KMO A;  3OVO A;  2KCX A;  1IY5 A;  1SGR I;  1YU6 C;  2XRC A;  2JXD A;  1CGI I;  2JYY A;  1HDL A;  1HPT A;  3QTL D;  1TIH A;  2SGF I;  1CT4 I;  1HJA I;  1TUS A;  2QQD A;  1M8B A;  1TUR A;  2N52 A;  2NU3 I;  5DAE A;  2M5X A;  1UVF A;  2LEO A;  2ARP F;  2SGE I;  1PCE A;  1BMO A;  2WCY A;  1TBQ R;  1Y1C A;  1FYB A;  1PPF I;  1SGD I;  2KMP A;  2V53 A;  1OVO A;  1TGS I;  1DS2 I;  2B0U C;  1TBR R;  3SGQ I;  2GKT I;  1SGY I;  1SGN I;  1BUS A;  1SGE I;  1MT1 A;  2NU1 I;  1OYV I;  1YTP A;  2KMR A;  2SGD I;  1NUB A;  2N17 A;  1CGJ I;  2BUS A;  1IW4 A;  2SGQ I;  1CE3 A;  1DS3 I;  2F3C I;  1PJU A;  2GKR I;  2GKV A;  3HH2 C;  1M8C A;  1H0Z A;  2SGP I;  1UUC A;  2QQC A;  1N13 A;  2KMQ A;  1AN1 I;  1CSO I;  4SGB I;  2OVO A;  1OMU A;  5JHW C;  4GI3 C;  1CHO I;  1UVG A;  1Z7K B;  1LR9 A;  4HGU A;  3SGB I;  2P6A C;  2NU4 I;  1R0R I;  3B4V C;  1Y1B A;  1OMT A;  1SGQ I;  1LR7 A;  2ERW A;  1LR8 A;  3SEK C;  2JZM A;  3TJQ A;  1CT2 I;  1CT0 I;  1SGP I;  2NU2 I;  2NU0 I;  1IY6 A;  2N71 A;  1KMA A; 
#chains in the Genus database with same CATH topology
 2J87 A;  4A24 A;  4OVO A;  2QPO A;  2KMO A;  3OVO A;  2KCX A;  1IY5 A;  2JW6 A;  1SGR I;  1ULM A;  1YU6 C;  1W3S A;  1MJA A;  2XRC A;  3UOE A;  2JXD A;  5CCM A;  1CGI I;  1MJB A;  3UGD A;  2ENZ A;  4DNC A;  3RU0 A;  2JYY A;  1HDL A;  2DKV A;  3OL0 A;  9WGA A;  1X74 A;  1HPT A;  3QTL D;  2X3T A;  2GVI A;  5FUW A;  1TIH A;  1NXU A;  2SGF I;  3GOX A;  2CWG A;  1WKX A;  2ORV A;  1CT4 I;  3TO6 A;  1HJA I;  1TUS A;  2ODD A;  2QQD A;  4UXJ A;  1M8B A;  2UVO A;  5HI7 A;  1TUR A;  1V1I A;  1V1H A;  2N52 A;  2NU3 I;  2V1C C;  5DAE A;  3UGL A;  2M5X A;  1UVF A;  2LEO A;  7WGA A;  2ENN A;  2ARP F;  5FUX A;  2SGE I;  1MJ9 A;  1PCE A;  2UZ3 A;  4AML A;  1BMO A;  2WCY A;  1TBQ R;  1Y1C A;  1FYB A;  2L7X A;  1PPF I;  5EX3 A;  1SGD I;  1WTJ A;  5CCL A;  1K7T A;  2KMP A;  3FSY A;  2V53 A;  1OVO A;  1TGS I;  1DS2 I;  3R5B A;  5E3P A;  1ULK A;  3BJI A;  2B0U C;  1TBR R;  5E3Q A;  2K9H A;  2DB6 A;  3QAH A;  3SGQ I;  2GKT I;  3R5A A;  5J8F A;  1TOT A;  1TBN A;  4L9M A;  5EX0 A;  4B6D A;  1FY7 A;  1SGY I;  1SGN I;  2JA1 A;  1XX6 A;  1KBE A;  1BUS A;  2FNF X;  1SGE I;  2Y0M A;  5FUV A;  1Y8F A;  1MT1 A;  4FKD A;  2CWF A;  3FSX A;  2NU1 I;  1OYV I;  1YTP A;  1RFH A;  2KMR A;  1NUB A;  1XBT A;  1CGJ I;  2N17 A;  2LB7 A;  2QQE A;  2SGD I;  2BUS A;  2WVJ A;  5J8C A;  2PQ8 A;  3VDP A;  1IW4 A;  3KY9 A;  2E73 A;  2SGQ I;  2RIJ A;  1W4R A;  2YUU A;  3TOB A;  3VE5 A;  1CE3 A;  4MPI A;  2RC4 A;  1DS3 I;  4E1R A;  2F3C I;  1PJU A;  2GKR I;  1FAQ A;  2ELI A;  5E3R A;  2GKV A;  2W0T A;  1FAR A;  3E59 A;  3HH2 C;  1M8C A;  1H0Z A;  4E1P A;  1PTR A;  1R79 A;  2SGP I;  2VRW B;  1UUC A;  2QQC A;  3UEJ A;  2LUY A;  1N13 A;  1UHA A;  1ULN A;  2KMQ A;  1AN1 I;  5HQ8 A;  2E5R A;  3E2I A;  2ROW A;  1CSO I;  3TO9 A;  1PTQ A;  2CJS C;  4SGB I;  4UXI A;  2ORW A;  4WP4 A;  2OVO A;  3PDN A;  1S20 A;  1OMU A;  5JHW C;  3QWP A;  3R5D A;  2OZU A;  1X4S A;  1CHO I;  3OXL A;  1WGC A;  2OD1 A;  4GI3 C;  2X52 A;  3TOA A;  3UGI A;  1Z2I A;  3CXL A;  2QQ0 A;  2CWH A;  3OXF A;  1HEV A;  1UVG A;  2YQP A;  1Z7K B;  1XA6 A;  1U5K A;  3D00 A;  2N1A B;  1LR9 A;  4HGU A;  3SGB I;  3OXG A;  2P6A C;  2L8E A;  2NU4 I;  3R5C A;  1K7V A;  1P9G A;  1K7U A;  1R0R I;  3B4V C;  1Y1B A;  1OMT A;  1WGT A;  1SGQ I;  4UXH A;  3VDU A;  1LR7 A;  1Q9B A;  1TBO A;  1LR8 A;  2ERW A;  3FC3 A;  2GIV A;  3MEK A;  1KBF A;  2OU2 A;  2JZM A;  3SEK C;  3UEY A;  2J9R A;  3UFF A;  3TJQ A;  1P9Z A;  2V1C A;  2B8T A;  1CT2 I;  1CT0 I;  1SGP I;  2DIP A;  2NU2 I;  2NU0 I;  1IY6 A;  2N71 A;  2A20 A;  4JCV E;  1KMA A;  1VDD A;  2WGC A;  3TO7 A;  5FUY A; 
#chains in the Genus database with same CATH homology
 2J87 A;  4A24 A;  4OVO A;  2QPO A;  2KMO A;  3OVO A;  2KCX A;  1IY5 A;  2JW6 A;  1SGR I;  1YU6 C;  1W3S A;  2XRC A;  2JXD A;  5CCM A;  1CGI I;  3UGD A;  2ENZ A;  3RU0 A;  2JYY A;  1HDL A;  3OL0 A;  1X74 A;  1HPT A;  3QTL D;  2GVI A;  5FUW A;  1TIH A;  2SGF I;  3GOX A;  2ORV A;  1CT4 I;  1HJA I;  1TUS A;  2ODD A;  2QQD A;  4UXJ A;  1M8B A;  5HI7 A;  1TUR A;  1V1I A;  1V1H A;  2N52 A;  2NU3 I;  2V1C C;  5DAE A;  3UGL A;  2M5X A;  1UVF A;  2LEO A;  2ENN A;  2ARP F;  5FUX A;  2SGE I;  1PCE A;  2UZ3 A;  1BMO A;  2WCY A;  1TBQ R;  1Y1C A;  1FYB A;  2L7X A;  1PPF I;  5EX3 A;  1SGD I;  5CCL A;  2KMP A;  2V53 A;  1OVO A;  1TGS I;  1DS2 I;  3BJI A;  2B0U C;  1TBR R;  2K9H A;  2DB6 A;  3SGQ I;  2GKT I;  1TOT A;  1TBN A;  4L9M A;  5EX0 A;  4B6D A;  1SGY I;  1SGN I;  2JA1 A;  1XX6 A;  1KBE A;  1BUS A;  2FNF X;  1SGE I;  5FUV A;  1Y8F A;  1MT1 A;  4FKD A;  2NU1 I;  1OYV I;  1YTP A;  1RFH A;  2KMR A;  1NUB A;  1XBT A;  1CGJ I;  2N17 A;  2QQE A;  2SGD I;  2BUS A;  2WVJ A;  3VDP A;  1IW4 A;  3KY9 A;  2E73 A;  2SGQ I;  2YUU A;  1W4R A;  1CE3 A;  3VE5 A;  1DS3 I;  4E1R A;  2F3C I;  1PJU A;  2GKR I;  1FAQ A;  2ELI A;  2GKV A;  2W0T A;  1FAR A;  3E59 A;  3HH2 C;  1M8C A;  1H0Z A;  4E1P A;  1PTR A;  1R79 A;  2SGP I;  2VRW B;  1UUC A;  2QQC A;  3UEJ A;  2LUY A;  1N13 A;  2KMQ A;  1AN1 I;  5HQ8 A;  2E5R A;  3E2I A;  2ROW A;  1CSO I;  1PTQ A;  2CJS C;  4SGB I;  4UXI A;  2ORW A;  2OVO A;  3PDN A;  1OMU A;  5JHW C;  3QWP A;  1X4S A;  1CHO I;  3OXL A;  4GI3 C;  2OD1 A;  3UGI A;  3CXL A;  2QQ0 A;  3OXF A;  1UVG A;  2YQP A;  1Z7K B;  1XA6 A;  1U5K A;  3D00 A;  2N1A B;  1LR9 A;  4HGU A;  3SGB I;  3OXG A;  2P6A C;  2L8E A;  2NU4 I;  1R0R I;  3B4V C;  1Y1B A;  1OMT A;  4UXH A;  1SGQ I;  3VDU A;  1LR7 A;  1TBO A;  2ERW A;  1LR8 A;  3FC3 A;  1KBF A;  3MEK A;  3SEK C;  2JZM A;  3UEY A;  3UFF A;  2J9R A;  3TJQ A;  2V1C A;  2B8T A;  1CT2 I;  1CT0 I;  1SGP I;  2DIP A;  2NU2 I;  2NU0 I;  1IY6 A;  2N71 A;  2A20 A;  4JCV E;  1KMA A;  1VDD A;  5FUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...