1FYCA

Inner lipoyl domain from human pyruvate dehydrogenase (pdh) complex, nmr, 1 structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
106
structure length
106
Chain Sequence
GSNMSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the major autoantigen in primary biliary cirrhosis.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE (E2P)
total genus 6
structure length 106
sequence length 106
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fycA00
2NN6H 2E75C 2EDGA 2KA7A 3A8JE 3FMCA 3KLRA 1GUSA 5KNBA 3N6RA 1IYVA 1OXUA 1VDZA 1YNJC 2EVBA 2JEBI 1YNNC 2K32A 3U9SA 2PPBC 4IFDH 1B9MA 1PMRA 2EJGC 4KKTA 4KKSA 2F1MA 5C0XG 3W3AA 1Y69U 4DNRB 1Q12A 3SDZA 4OO1G 2CW0C 5BN3A 3CRKC 1A6XA 2D5DA 3M7NA 3MXUA 4L8JA 3TZUA 3GD7A 3ND9A 1Q1EA 2Q8IB 4DNTB 1GUTA 1H9JA 4KN7C 3IFTA 1H9SA 2IT1A 3BDOA 3PUYA 4G7ZC 3D4RA 1IW7D 1IW7C 3I4LA 2LMCB 4OO1H 1EWHA 1CFMA 3P20A 2E76C 1Y8PB 1LABA 5K36G 5K36H 4KI0A 4BA1I 4IQZA 1Q1BA 1CI3M 3DXJC 1T5EA 1ZYRC 3CRLC 4KHZA 4RCNA 1K8OA 4LJZC 1GUOA 2NN6I 3A7AB 2BA0A 1Y8NB 1IYUA 2A68D 2DNCA 4JK1C 3L7ZC 2K7VA 4LK1C 3A8IE 2R6GA 2PCFB 3FPPA 4XIGS 2JEAI 4DK1A 4GZYC 4G7OC 1Q90A 2BE5C 2NN6G 3PUZA 2PNRC 1FR3A 1GUNA 1V43A 3MFYA 2D2CC 1B9NA 1O7LA 3QJYA 5JEAG 1H9KA 4KN4C 4KMUC 1GUGA 2V4DA 1H9MA 3GQBA 1ONLA 3H94A 1HTPA 4H13C 3QIAA 1VF7A 3PUXA 3T51B 5C0XH 3QG1A 4HR7B 3M85A 2DN8A 1O78A 3EQLC 4KKUA 3RLFA 3T53B 1HPCA 1E2WA 1K8MA 1Y8OB 5JEAH 1OXXK 5A35A 3PUWA 2A69C 1I6VC 5KNCA 3NE5B 2B8FA 1SMYC 2YYZA 3IKJA 1BDOA 4H44C 1LACA 3AB9A 3PV0A 1DXMA 2L5TA 3I72A 3M4YA 1GHJA 1CTMA 3OPOA 1FYCA 3VR4A 1E2VA 3HGBA 2A6ED 2A6HC 2DNEA 5BN5A 2KCCA 2D62A 2EJFC 2JE6I 4I7ZC 1OXSC 1DCZA 4IFDG 4G7HC 2O5JC 3I73A 4OGQC 2AWOA 1V8QA 3VR5A 2ZT9C 3VR2A 5KNDA 1DD2A 3T56B 2BA1A 1Z6HA 3A8KE 2E74C 1ZKOA 5BN4A 2QF7A 2A69D 1H9SB 3LWUA 2A6HD 4DK0A 1TU2B 3BG3A 3PUVA 3ND8A 1VCIA 1G291 3OOCA 3VR3A 4BA2I 1GHKA 1GJXA 3WDNA 2A6EC 3SE0A 3VA7A 2AUJD 3D31A 1E2ZA 1H9RA 2EJMA 3OW7A 3A7LA 4JBWA 4XTCS 2BDOA 2AUKA 1Z7TA 1HQMC 3LNNA 4TKOB 4H0LC 3VR6A 1OXVA 1OXTA 1VF5C 1HCZA 2BE5D 2K33A 4PV1C 2JXMB 1QJOA 1TKWB 4TQUS 2B8GA 2O5IC 2A68C
chains in the Genus database with same CATH superfamily
4V0BA 2HQLA 2K28A 4J15A 1WTOA 1F9QA 1ASYA 1OXUA 2EVBA 4BBSG 2NBFA 1YNNC 1Q8IA 3LWEA 1TT2A 4ULLA 5GADC 4DR7Q 2NWGA 5LL6S 3DMUA 3DHQA 4R4TA 1RHPA 4JI8L 1U4RA 3SEBA 1LTGD 5C4XG 3BDOA 3MWYW 5JEAJ 2B63B 3D4RA 3HOXG 5GAHC 3PIOA 2JA7H 4JCVE 1ZEQX 1EY9A 4KI0A 4U673 1T5EA 2SEBD 5CC4A 5FJ8H 5G3LD 1KDAA 2A68D 4C3JB 3J80c 4GLXA 2C9OA 5FLXL 3R93A 1PTOD 3ITPA 1EZ8A 1B9NA 4P72A 3QWNA 4YWMA 3TP6A 1WTQA 1K73C 3H09A 1M1KC 3VYTA 2RHSB 3PUXA 2K5QA 4IUNA 5GQOA 3JAMi 3HOXH 1Y1VB 1E2WA 1QE6A 1WFQA 4RCOA 1C0AA 3CC7A 2VB3X 3NQTA 3Q8DA 1JJGA 2PI2E 1RKNA 2B8FA 3C1EA 1STAA 1BDOA 3TP7A 4RKLA 2F0OA 3I72A 1FD7D 1CTMA 1E7ZA 5JVG3 1QNUA 1NY4A 4I7ZC 2KHIA 5FOBB 4AIMA 5IGDA 1WTRA 3J81c 3EVQA 1DJRD 5J39A 4C1NK 3A8KE 1TR5A 1VQEA 2QF7A 1U9RA 1U4MA 1A3VA 4DAPA 4X3TA 5D3DA 2XIWA 1XMOL 3K5LA 5H1SE 4JVZA 2OF1A 3D8GA 4ZKCB 4E6IA 4NDXA 3CCSA 3BZDB 4XYOA 1Y1VH 1T5XD 2E2HB 3A5ZB 3URYA 4APVA 2N8NA 3GTOH 2ZJRA 3LNNA 1HR0L 1VF5C 3OIQA 1UE7A 1HXYD 2CQAA 1AW7A 2A19A 2JXMB 4M8AA 4B9WA 2B63G 1PRTD 1L0XB 4JG2A 1ILQA 1X55A 3HOWH 2BH2A 3JC66 3N52A 1II3A 4JOIA 4OO1I 2IPKD 5IYCH 4XYQA 1TS2A 3HEJA 3BU2A 4WFN3 4C3HB 2Q2HA 3SHLA 2N88A 4XXEA 1B70B 1R4QB 3I4OA 2FMMA 4QMGA 4Y7NH 3GD7A 3ND9A 1Q1EA 1V1PB 2FINB 1I6HH 5G3LF 2I5HA 2B39A 3HFZB 3RZDH 1PTOF 2E2DC 4PMBA 1NCVA 4R4CA 2B2VC 1LABA 1Q46A 4N8FA 3G7LA 1B44D 4B3RL 2N3SA 3CHBD 4LFAL 1W6KA 4RCNA 3T1HL 3GTOB 3I4MB 2F0QA 4FP5D 3L7ZC 5ISRA 4DR6Q 2UXBQ 1R9TB 4XIGS 1SN8A 1WTXA 2CQOA 3NBHB 1FR3A 4A93B 4CKCA 1TXYA 4Q0FA 5LMNW 4HJ8A 3AQQA 1XMQQ 3HOYH 3S24A 1O7ZA 2A1AA 2B2WA 3BJUA 2IHFA 4O42A 1HZ9A 4Y7NB 2K50A 5KNCA 4RGMA 3RN2A 4LFBQ 1G8ZD 1SDFA 4A3CG 1SYEA 1G2TA 4IUTA 2QEJC 2F0UA 3KLSA 5C3WA 5LMUQ 5DAUA 5IE8A 2DNEA 4NXNQ 2D62A 2EJFC 5I6WA 3T1YL 1A15A 5A2QL 3I91A 2ALYB 4C3IH 1XPOA 2Z4HA 5HGQA 1EEID 1G6PA 4ID6A 4PNYA 5I4DA 4DR4L 2WACA 3K59A 2UXDL 1BCPB 1RJTA 3BG3A 4V190 4B3TL 1UE5A 1X3QA 2A6EC 3S1RB 2FFKB 5CV7A 2X6LA 2JQOA 2L4NA 1I94Q 3KJOA 4EVOA 5CMDA 2A5HA 2MO1A 1OXTA 4X3KA 4QUFA 3PMFA 1BUVT 4DR7L 4JI3L 3L3OC 3PQIA 1VQJA 2KEEA 1O7YA 1U4PA 1P16A 3ERQA 3K5MA 3QOLA 4XDXA 2A74C 1SNDA 3M4PA 2F03A 2IX3A 3S2DB 2WB1B 2PO4A 1LTTD 4OONA 1KLUD 1KAAA 4C3JG 1DYQA 1SXTA 4HSVA 2EY1A 1WCMG 4G4KA 4X64Q 4IURA 4N8X1 3OWFA 4MNOA 4KJNA 1STEA 2DY7A 2F0GA 2ZM6L 2EYLA 3CXCA 1ZYRC 3E6ZX 2NZ1D 1X9NA 2R3ZA 2CHBD 1BCPD 4JOIC 2R6GA 1JT8A 3M4QA 3Q23A 2BE5C 2NN6G 5K5PA 2F3VA 5IGGA 2Z8LA 1BQQT 5JPMC 2CCZA 2L9HA 3V05A 2ZXOA 3EA6A 1JICA 3T51B 4LAAA 1SRUA 3CPWA 3EQLC 1KNEA 2ENBA 4KKUA 4QB4A 4B3SL 5D14A 4OELB 1MGSA 4PZ6A 2BDNA 1MHWC 1IYJB 1QOHA 4FVMA 1GHJA 1V1OA 3PF5A 1QG7A 1G51A 3E9IA 4ZUIA 5C4HA 3AU7A 4G7HC 2F3IA 3HKSA 2VQEQ 2DY8A 1EIYB 4QCLA 1D6EC 3T56B 3ONAB 1Z6HA 3EFXD 3GTGB 1S5BD 2EYPA 1I3QB 2RSOA 1H9SB 5M3MB 3I4MG 1PH5A 1KHIA 4U68A 1VCIA 1V1PA 3W1BA 3K58A 3H91A 4GKKL 3J7YW 3G6JB 2XWBB 1S40A 3KJPA 1S72A 1NMGA 1J6QA 4BY1H 2IJ0A 3H3VC 2FMCA 4KHPQ 1LM0A 5LL6X 2EYFA 1BVSA 2RSNA 4HJ5A 1FJGQ 1X32A 2MQHA 3KBXA 3J7ZC 4K5WA 2MHVA 1S5CD 2F0KA 2F0MA 4ZK9B 2WV6D 3FEWX 2UUCL 5E4XA 2CFMA 2RF4A 2PPBC 4A3EB 3HOYG 2XTIA 2OWOA 1ML0D 1VMCA 5M5YH 3WOEA 3T16A 2A73B 2D5DA 3RMHA 4CJ2C 2ICIA 2VUMB 1E1TA 5C44B 5IGCA 5ELOA 1PZKD 3T1HQ 2IT1A 3UE0A 2B2TC 3DWPA 3NENA 3PUYA 3SGIA 1F9SA 3G6EA 1UAPA 3E0EA 1EWHA 3GDEA 4LUOA 4HIMA 1S3OA 1CA6A 4BY1B 1WTWA 1E1OA 4A3BG 2LS01 2ICEC 4JI0Q 1HNWQ 1G91A 1ICFB 3PCOB 4GZYC 1VQMA 4F8MA 2CWAA 1ENCA 3GV6A 4RG1A 1KABA 5JEAG 3CC2A 1RIPA 3I70A 4PZ7A 3SK6A 4A3MG 3STBD 2UU9L 2IW3A 1QZGA 2CH4A 3QIAA 2NTSA 3RR5A 5IYCG 1MJEA 4TSSA 2OEOA 2DN8A 2K1BA 1XNRL 1I4HA 3RLFA 3SK4A 3J80L 1NJIC 4NXNL 1FNWA 4OHJA 5C44H 2EE1A 5I2XA 1NSNS 3AB9A 4KHVA 4NMZA 3IL8A 1QVGA 1MKHA 4L5RC 2MPMA 2ZTEA 3HS0C 2UXDQ 2OXPA 4JV5L 4QJFA 1HRJA 4B3TQ 2ZT9C 2KENA 5J1ZA 5LHY1 3GTLB 1DD2A 2WB1E 3HOUH 3MFGA 4A3KB 2ZTCA 4FF4A 5ELCA 1HA6A 5IY0A 2IX1A 3NQIA 1EOTA 3C1FA 5C0XJ 2JJQA 5E7NA 4LF5L 2NVTH 3GTPH 1F2YA 2WKDA 2G9HD 2E2JH 5JJKA 3G71A 3GV3A 5C4ZA 3DEPA 1J5EQ 1NE3A 3KOJA 2ZXRA 2EOTA 1GD7A 5EKKA 1YJNA 3CCVA 3GTMB 1AEXA 3KBGA 2Q2UA 3QO2A 3MEHA 1KRSA 2HCIA 4GOPA 1I6HB 2EDGA 5ELDA 3NELA 4DV6L 1Y1WH 1GUSA 3N6RA 3C2PA 3DM3A 4DKAC 2EJGC 1BR9A 2JA8B 3F8TA 3FP9A 3W3AA 3CPFA 3Q6SA 4X64L 2AMCB 3GTLH 3CD6A 3HKZE 4PMCA 4A93G 3CRKC 3M7NA 3I55A 2J0TD 3TREA 2F0SA 1WD1A 5ELBA 4DV1L 2C35B 4LF8L 3TQYA 2JK8A 3PO3G 3PO3H 1TQOA 3U4ZA 1H9JA 1STHA 4KY7A 1EUJA 1CQVA 1NR2A 3ULLA 4A93H 4BWGB 1IW7C 1B3AA 1E22A 1KAWA 1GVPA 1J9OA 2E76C 2KOLA 4KLKA 1RCVD 2HIXA 4KHZA 2JA7G 4DUZL 1VQNA 1SBBB 4LK1C 3TS2A 2PCFB 3CCLA 3LX0A 3PUZA 4R1JA 1XTDA 4B3SQ 1SYGA 4DV5Q 4NPSA 4QGUA 2SNSA 1K83H 4JPBW 3UE1A 5I6YA 2PNHA 1HZBA 1JOQA 1VS0A 4BBSH 3I7FA 2Z9HA 1NUCA 1TWAH 3BZKA 1Y8OB 4TRDA 1OXXK 1FGUA 2ZJPA 1B7YB 1F77A 1VQIA 4UPAA 4X62L 3DLLA 4A3IH 1UEBA 4NKLA 1E2VA 3CF5A 5IWAQ 3HOVB 2A6ED 2JA5B 3TRZA 3S1RH 3VR5A 2Q8RE 4GKJL 4R8NA 4JI1L 4GKKQ 5DLQE 5C4XB 2K6AA 1SNPA 4OEMB 4LW1A 3S17B 4CDEC 5C44G 5GAEC 4BBRH 2VUMG 4GOPC 2OQ0A 4R4IA 3SE0A 4PMWA 1F9PA 1HZAA 4JBKA 1D2BA 4TKOB 3IAYA 4WJ4A 1PTOC 4ZRZA 1VQLA 1EIHA 1QNKA 2PMZB 2FXQA 1LTBD 2A68C 4GNXA 3S2DH 2M9VA 5AFWA 1TWFH 2DJFC 1H95A 3A8JE 3IFDA 1JOKA 3I90A 2JEBI 1AP0A 1YNJC 2G9DA 1X3FA 1WD0A 4KKSA 1MSGA 3S1NB 3KDFA 2F0JA 3SDZA 4K5XA 4L8JA 1D5ZC 1EY0A 4DNTB 3FKIH 3O13A 4BBRB 4XQNA 5I2YA 4R4OA 1WJJA 1B50A 1QUQB 3MXGA 2F3WA 1CKNB 2WKCA 1VQKA 1Y8PB 4KY5A 1LV9A 2K03A 4UP9A 2RQXA 2H1EA 5IOCA 1BF4A 2UU9Q 4JK1C 5CYUA 2K7VA 4L5TA 5EPKA 5CGKA 2BCOA 1Q90A 1HH2P 4HTHA 2V4DA 3L0OA 5D65A 3S15H 5C5MA 3L9AX 3QG1A 4HR7B 3M85A 4RKBA 1EL0A 4H7BA 2OCEA 2VQFL 3S2HB 3H6MA 4NP5A 1X3PA 4A75A 4H44C 1DXMA 3CCQA 4DR5L 3H0GG 3BZCA 2EYOA 3OYYA 2YU9B 2R7ZH 3RN5A 1V1QA 3ICEA 4P73A 1IBKQ 4OWTB 2L11A 4HIDA 2R93H 2J4XA 5FLMG 3U58A 1B2TA 2L55A 3W2DA 1KTKA 1UWVA 4KTAA 2VS1A 3ZYYX 1PA6A 2V1CC 2VB2X 2WB1G 3B6YA 5EQ0A 2EY2A 1PRTF 3S15B 1I4GA 4RA8A 4A3DG 1E2ZA 1SNQA 5GAGC 2G5DA 2JP1A 3E3XA 3ERSX 4DV6Q 3S2HH 2VNUD 4M1UB 1EQRA 3R3OA 3S1QB 2N49A 4UAIA 2EYMA 2RKSA 2NN6H 1HJPA 1F9RA 1CK1A 4C3HG 3S16H 3KF8A 4LF6L 1GM5A 2L1BA 3MVVA 1X3GA 1C48A 1K3RA 2B2UA 2MGSA 2R93B 1MJCA 3H0GB 5IGFA 1UE6A 2PZTA 3MXUA 1QVCA 4B3MQ 2KCNA 1K28A 1GUTA 1PTOH 2CH4W 3HKZB 4EGVA 2UXCQ 3IFTA 2PZUA 1BBXC 4A3BB 3I4LA 2LMCB 1ET6A 1VQ5A 5J22A 2EZVA 3VA5A 1YNND 4DV7L 4EQNA 3NSWA 2YTYA 3PF4A 3I3CA 2JEAI 1YNXA 4GS3A 3OTOL 3S9WA 4KMUC 4DUYQ 2RDHA 4DNIA 1WI5A 1OO9B 4A3JB 4ZCKA 4X62Q 1L2FA 4NW2A 3BYYB 3AFPA 2HCCA 1CSPA 5M3FG 4OWWB 1O78A 3OMGA 4DV2L 2QW7A 4XQQA 2A69C 1VQBA 1GO3E 1ZYRD 3NE5B 5CV9A 2NVXH 3K57A 2QILA 3HOUB 2D0OA 4GKJQ 5JJLA 4IZ8A 2F52A 1BCPC 3MXNA 5M5XH 4A3LH 4JI1Q 2E8GA 4DXFA 3CQZH 5KYLA 2MO0A 2IHEA 1TY2A 1TWHB 1AFPA 3C3LA 3EJIA 1HNZL 1SFOB 4OWXB 3PIO3 1DCZA 1EYCA 1K8GA 4XQJA 4I7AA 2E2JB 3TP5A 1YI2A 1N34Q 1EU4A 1I50H 2KBNA 1EQTA 5A2QE 1BNZA 4IJHA 4N9PA 4MTKA 4GLAC 2XWJB 3KF8B 5M3MG 3MAQA 4AYBG 2PW5A 2I5MX 2F0NA 1H9RA 2K01A 4BY1G 4YIJA 3CCRA 1J8IA 1YHQA 4EQOA 3U4VA 4OIJA 4A3FH 2UUAL 1K0SA 2RCFA 1U0LA 3BVGA 1IL2A 1YHBA 4HMJA 2LXJA 1LTID 2F0DA 2M2LA 1D7QA 5C0XG 2E2IB 2JYOA 2XSCA 2CW0C 2Y0SG 4YWLA 5JVH3 1ENFA 4B9XA 1X56A 4KN7C 5JOBA 1H9SA 3K7UC 3F2UA 2B2VA 4DV0Q 1PH7A 2R93G 5EGTA 1IW7D 1BBUA 3U50C 3VDYA 1CFMA 2R7ZG 5K36G 5K36H 2L15A 3HG9A 3MTSA 4IQZA 3Q0AA 1PYWD 5NUCA 2E2HH 3H3VH 1A0IA 2PZWA 1EEFD 3CRLC 5JPNC 3PO2G 2NN6I 4LFCL 4JI7L 1YZ6A 4BBSB 4A3FB 4IALA 3M7GA 4AYBB 5HGTA 3E9HA 1QWYA 1EOVA 4JI5Q 4YWKA 2JA7B 3HOWB 2VQFQ 2K5DA 3VYRA 1H9MA 3FPUB 1TS3A 1HTPA 5C0XH 3D0FA 3OSOA 3F2CA 1RODA 4A3GB 4R9WA 4IO9A 2NTTA 2Z6BA 1W2BA 1JJCB 1IXRA 1W6JA 1N9WA 1XX8A 4P2CB 1KXLA 1IBKL 1TVXA 4X65L 1VQPA 4L63B 1JB7A 3X3NA 3HOZH 1VQOA 1L0YB 2B2TA 5M5WH 1HFNA 2VW9A 3VR2A 3TZDA 4A3JG 3MXNB 3M3YH 3TN2A 4DXGA 1TWCB 3PGZA 4A3LG 3V2TA 4O1NA 3E5SA 4KHPL 2D9UA 3KF6A 1L0WA 3CU7A 4FXKC 2B29A 1IBLL 1FJGL 2BH8A 1CHPD 1TWFB 1SE3A 1FNUA 4OIKA 5KRUA 4LF6Q 4RGOS 1MD2D 3DM1A 2UUCQ 1F2MA 2K05A 4PV1C 3UDIA 4O2DA 1PRTC 2DJGC 3W5OA 3OMCA 1S5DD 4ZLTF 1SJED 2X6GA 5IYBG 3D4WA 1IHZA 5T1GA 5IP7H 3K5OA 3P7JA 5C6AA 3NPPA 1PRTB 3NUCA 4YHHL 1XTCD 1XPRA 2E5LL 4EQ5A 5M5WB 2F1MA 4C3IB 1TS4A 4N9TA 3M3YB 2IWHA 1C8CA 3DWQA 1VQ4A 5IIFA 2HHHL 1A2TA 3TZUA 1O80A 1KRTA 2F0TA 3I4NB 4RWSC 1IZ6A 1SE4A 5TSSA 1Q86C 1DONA 3CCUA 1LT4D 4JI0L 1HNWL 5EJWA 5IP9H 3SXHA 4L5QA 1O7IA 3TEHB 3OHXC 1B1ZA 4ZAIA 1JORA 4J8QA 4DUYL 1PLFA 3GTQH 4OL7A 4AH6A 3SK5A 1LT3D 2KQ3A 2AQ1B 3G4SA 4O0AA 1X65A 5E1FA 1H9KA 4HSPA 2WFWA 2IY5B 1AH9A 2KHSA 1ONLA 1Q81C 3NWTA 3GTJH 1CHQD 1UUPA 5CV4A 3LGJA 3A55A 2PQEA 2TSSA 3BVZA 2R7ZB 1R9TH 4C1NI 4XT1B 2L0CA 1HNZQ 1RTOA 4JV5Q 1EY7A 3I4NH 1M4VA 3BDCA 3PV0A 5ELNA 1STYA 4FXDA 1X3EA 4LUVA 2QGQA 5AJ3Q 2JA5G 4IFDG 4A3EG 1B4OA 1V8QA 4X3SA 1KLGD 4C2MB 4LF5Q 2VL6A 2CW0D 5T1IA 4GOPB 1MSHA 3S14H 2E74C 1XJVA 1LUZA 4IPDA 1J5EL 1TU2B 1VMPA 4R4QA 4YCVA 1LTRD 4FXGC 1JWUD 3S16B 4ILWA 3GTJB 3HZXA 4IUUA 3D31A 4LMQD 3A7LA 3EBEA 5DM63 1GOZA 2PMZE 5J3BA 4AYBE 3P1HA 3L2PA 2DUDA 1SLJA 4IUQA 1HCZA 1K9MC 1BKBA 2B8GA 3QR8A 2O5IC 4A3FG 4JBJA 1JWMD 2I07B 3KDFB 1KD1C 1AZQA 4GN4B 1PTOB 2KA7A 4QUCA 3KLRA 5C5LA 2ES2A 3OWEB 4DV1Q 2SOBA 4LF8Q 1VDZA 1L1OC 4KKTA 3CCJA 2EYHA 3R8BA 3S1MH 1WYDA 4DV0L 1JR0D 3FRPB 4DR3L 3U9OA 3J7AF 5FO9B 1G2SA 1EZ6A 3RNUA 4P71A 4KY6A 4FO2A 1ESRA 4C3JH 3FKIG 1FVIA 2VXWA 4LFCQ 2C5CA 4JI7Q 2RDGA 4B08A 2YV5A 3J80E 4OO1H 5KGUA 1SEBD 1JWSD 4BY7B 4BA1I 3EN2A 3MHBA 2EYJA 4DV5L 1YEZA 4EQPA 1U5KA 3D6CA 1HZCA 2MUYA 3HOXB 4NXML 4DR1L 1PZJD 3UDFA 1SNCA 4CJ0B 4IN3A 2JA6B 3QJYA 2NVXB 2FHTA 2B2WC 1JCKB 5FJ8G 5M5XB 1SNMA 4UP8A 3CQZB 4H13C 1LTLA 4DV3L 1EY8A 3J81E 4UP7A 3GO5A 2KVMA 5JEAH 4HMIA 4LF9L 4JI2Q 4BBRG 2VUMH 4K2KA 1D1IA 1X54A 1HQRD 3K0XA 2RDFA 4X6AH 2LXKA 3OPOA 4L6TB 4R8IA 3RLOA 3ULJA 1KNAA 2B2YC 3VYUA 4RHSA 1HR0W 3MC0B 4ZQ3A 4K6DA 3MZ5A 1EWIA 2ID0A 5IT9c 2R92G 5EAYA 5IYDH 3JAML 1A2UA 1EWCA 2K5VA 3TP8A 3IRBA 1DOMA 3ND8A 2WAQG 1GJXA 5F2DA 4ME5A 4CGYB 4DF7A 1A8VA 1LLRD 2CWPA 1DZ1A 2EJMA 1NNXA 4DAYA 3OW2A 1PVOA 3FVQA 1YIJA 3GTGH 3G48A 4H0LC 2NUCA 2K33A 4C3HH 5M3MH 3I56A 1VQCA 2H4OA 2E5LQ 4LF7Q 4JI6Q 3RLNA 1N33Q 4TQUS 2ATWA 1VQAA 3RZOH 3D4DA 1Z9FA 1PH6A 3KLSX 1EY6A 4JI4L 1XNQQ 1KIXA 4CHTB 4BS9A 2EY6A 1IYVA 4FF1A 2ZJQA 3RZDB 4RHRA 1B9MA 2L12A 1YITA 5I9OA 3MEFA 1NMFA 4KK7A 4DNRB 1K3BC 2EXZA 1TY0A 3I4MH 1SROA 3K8AA 3Q24A 1EU3A 5ELEA 3NBHA 5LMNL 2EY5A 2F0LA 2F4VQ 4A4IA 4X66L 2F0HA 1U4LA 1ZXTA 5M5YB 1V9PA 4HJ7A 2KHJA 3AFQA 3P20A 1N32Q 3ULPA 1QZHA 5EPLA 3PSIA 2DNCA 2XRSD 3F1ZA 4A3GH 3GTMH 5COYA 4DK1A 3RZOB 2JSOA 1GUNA 2LKVA 2PW7A 4GN3B 4HJAA 4KN4C 1BXTA 3M4OH 3DWAA 1ESFA 4IUPA 2A8VA 4DV4Q 1STBA 2B2YA 1VF7A 2MP1A 4DPGA 2NYZD 4DR5Q 4ZUJA 3V96A 1HPCA 3HOWG 1K8MA 5FLXc 4MIUA 5AJ3L 1BBWA 4X3UA 4IOCA 3PO3B 4K8JA 2UUBQ 1RTNA 2MJ8A 3GTKB 5HY6A 1HFGA 3R2TA 1Y1VG 4Y52H 2R7DA 1I4PA 1KDBA 2R61A 1A3UA 2CKZB 1Z47A 1EYGA 1S5ED 2Z4IA 2X69A 3ZJYC 4H02A 4UHVA 4ODGA 4F88A 4LWCA 1IBML 1RD9D 3AYHB 5EBDA 2A6HD 4CDDC 4DK0A 2ASBA 1G291 4J1MA 4BA2I 2PQAB 4LF4L 4JYAL 2B2UC 1SYCA 2KCTA 4GLVB 2AUJD 1XPUA 4ABNA 3AEVA 1CZWA 2BDOA 1E24A 4A3KH 4GNXC 2BE5D 5FO7B 5FO8B 1I4RA 3NTIA 4IFDJ 5FLXE 3KF6B 2E75C 5FLMH 2TMPA 4B3ML 5KNBA 2XRQD 1EIFA 1NTGA 2O4XA 4DA2A 4DR2Q 2HDLA 4IFDH 4DU9A 2Q2TA 1AE2A 2J7ZA 3F2DA 3HOYB 5IT9L 2UXCL 1Y69U 2GVAA 3CAMA 1MBYA 2K5HA 2AHOB 3QB3A 3J7A5 2Q8TA 2K4KA 3K5NA 4F87A 4DV7Q 4CBVA 4FF3A 4KV6A 1SMXA 2I5LX 2PI2A 1CSQA 4PQXA 4NXMQ 4DR1Q 1VQ9A 1GKHA 1TS5A 1Q7YC 1C7YA 2LFNA 1MIUA 5DEHA 3OTOQ 4JBMA 1EY5A 1K8OA 1GUOA 2SNMA 3I2ZA 4GN5A 1JJ2A 4DV3Q 4G7OC 4A3IG 3J81L 2N78A 3BYTB 4DFAA 4CDCC 4K0KQ 5FK9C 1AE3A 3KLWA 4DV2Q 1F2ZA 3NP8A 1CQFA 1M8AA 4JI2L 1OTCA 1ET9A 2F0PA 2ZXPA 4POFA 2HDMA 3A5UA 1N36L 4YY3L 5L37A 1CM9A 3K81C 3RD4A 4OX9L 5M9OA 1EYDA 2K14A 5IP9G 3KUPA 5C3EG 2HD3A 1LO5D 1I6VC 3W1GA 2YYZA 4DGZA 1QB5D 1YVCA 3K6OA 1LACA 1LT5D 3M4YA 1QVFA 1NAPA 3T13A 1I3QH 1PV4A 1N34L 2HT1A 2NVQB 3TMEA 4OGQC 2F0WA 5CV5A 4P74A 1P8LA 1SYDA 1N8RC 2VZAA 1F2LA 3DUZA 4TVAB 4A3IB 4YCUA 2K52A 4K6LA 4A76A 2K5NA 3WWVA 4HCSA 4IPHA 4MN3A 4QF4A 3HOVH 3VR3A 4WRDA 4LF7L 2UUAQ 3VA7A 1N33L 1I4QA 5CR3A 1A62A 3I8ZA 2Z6KC 4QL5A 4XTCS 4CKEA 3KYHC 3NTHA 1XMOQ 1DOLA 2EXDA 3S17H 1E3PA 2NB0A 2F0EA 3NBIA 2KECA 2O2LD 1HTLD 1A3TA 3FMCA 4WJWA 4QY7A 1HR0Q 2K32A 2NZHA 1Q8KA 2VY3A 4X66Q 2OTLA 4OO1G 2JA6G 3HOZG 5C0XI 1WCMH 3K7AH 1NBWA 1WTHA 1N32L 1JOOA 2Q8IB 3TBIB 1DOKA 2FJ2A 5DM73 2JA6H 2Y0SB 3NTKA 4L5SA 2MFIA 2JA9A 4J6HA 2K5WA 1I4XA 4JI5L 2Y0SE 4LJZC 2BA0A 1Y8NB 1IYUA 4DV4L 1T9HA 1PFMA 3CC4A 3K80C 3K0YA 5E4WC 2K75A 2PNRC 1V43A 5IGBA 2GVBA 4B3RQ 1IKMA 1S4ZA 3FDTA 4K5VA 1UEAB 3GQBA 5C3EB 1EIGA 4ZKBB 4BXXG 2UUBL 3BVMA 4AQYQ 1KDCA 4X65Q 3VYSA 5EKIA 1GUWA 4IPGA 4EX5A 2NVYB 4RAUC 1IL8A 5A35A 5IYBH 3RUZA 2SDFA 5E3FA 1XMQL 2L5TA 1Y14B 4A3BH 1CKMA 1FYCA 3VR4A 2EQSA 1C4QA 4CDFC 3PIP3 3BDLA 1IBMQ 4DN4M 4UDUC 5BR8Q 3GTPB 2NVTB 4LFBL 4A3EH 4QQBX 1YJ9A 1IBLQ 4POGA 4LF4Q 1Y1WG 4JYAQ 2BA1A 1HUNA 2QDLA 4DAMA 1VQDA 1PHJA 1ZKOA 4K2LA 4LNQA 2A69D 3JAME 3T1YQ 3PUVA 4F7XA 2RVLA 1HUMA 2YU9H 5C3EH 2JA8G 4JW0A 1SAPA 5CV6A 4A3JH 4C3IG 1Y1WB 1HHVA 1C9OA 2NVYH 1K0RA 4K8IA 5C3XA 3MA2B 2AUKA 1STGA 4A3MB 5KYIA 2JA8H 3A0JA 4YHHQ 1QJOA 4HIKA 3NK9A 1LTSD 3J81j 1PYSB 2R92H 1K8AC 2OTJA 1I94L 3F2BA 1TWHH 3CW2C 1L1OA 2HHHQ 4ALPA 1RL2A 2M00A 1PZID 1WOCA 1PMRA 2WINB 2KCMA 3KK7A 3EIVA 4JI3Q 4PG3A 4KD3A 3CMAA 1RDPD 2B3GA 2F0IA 1EY4A 1L1OB 4P75A 2AWNA 1B8AA 2D0PA 5KEEA 3WOFA 1STNA 2WIIB 2Z1CA 2Z6KA 3SK8A 4RMFA 2QCPX 3BS1A 2RA4A 3M4OB 4BY7G 4K0KL 4FDBA 5IT9E 2NZOA 3CMEA 2WAQB 1Q1BA 1ICWA 4LUZA 3CKIB 3X3MA 4BXXH 4A3MH 3A7AB 1SE2A 2I0QA 5JJIA 4RH6A 1UNSA 1TWAB 4OXPA 3H15A 4HAEA 4G57A 4YY3Q 1N36Q 4OX9Q 3NWSA 2R92B 2ZM6Q 2AQ2B 1O7LA 2B63H 2R7FA 4MHEA 1W3SA 4K14A 1LYLA 3GTKH 2IX0A 2E2IH 3CCEA 1QILA 3T53B 3D6WA 2RCNA 3J80i 3C46A 1SYBA 2EIFA 2GA4B 1EQVA 4HEDA 4MZ9A 4PZ8A 4C56C 1ASZA 1EFID 4IFDI 2MNAA 1PXUA 3CP0A 3FHWA 2KCCA 2QDBA 1OXSC 4I65A 2HQEA 3I73A 2F0VA 3PO2B 1A63A 3KFUA 1PH9A 1QUQA 1UE1A 5KNDA 1B3QA 1CZGA 2DGYA 4FF2A 3CCMA 4WJ3M 1PH2A 2JN4A 1HNXQ 1TIID 2AQ3B 4QIWB 3HOUG 2VQEL 3OOCA 4HN7A 3TS0A 1PFNA 3AMUA 1EQQA 2YTXA 1D5MC 4FNFA 1SNOA 5FKAC 3OW7A 4RFBA 3HP3A 4JBWA 5EPJA 1XWEA 1SR3A 1CUKA 1SMYD 2KEDA 1YNJD 3VR6A 4MTNA 4Z9CB 1LT6D 3MXPA 4XT3B 1TKWB 1BCPF 1FGBD 1CKOA 4WORA 3HOZB 2ZTDA 4DR3Q 4A3GG 1DGSA 1ILPA 2CVRA 1AZPA 4CKBA 1KC8C 3A54A 1X6OA 3TSSA 3UDXA 2Q2IA 5CV8A 3U9SA 3PO2H 1K83B 5ELFA 2PQAA 4IOAA 1TWCH 2QEXA 3HRZC 3T4AC 2RHQB 1G6ZA 4JC0A 1YBYA 3HKZG 1TWGH 2XNAC 1EFWA 5C4JB 4G7ZC 2WP8J 1VQ7A 2OT2A 1S5FD 2K04A 1XYIA 2JA5H 3NXWA 1FNVA 4FYDA 1JB3A 4JI8Q 5GROA 5C4XH 4IUVA 5IGEA 2HUGA 3SVMA 1YHAA 4AQYL 1FL0A 1CKNA 1Q3LA 2P5ZX 3MFYA 1D5XC 1PYBA 1I5FA 5CORA 1PFSA 1JQYD 3TDQA 1MI2A 1JMCA 1SSOA 1GUGA 4LF9Q 1XXGA 4KD4A 1GXDC 4RGNA 3H94A 4RGTA 3A56A 5M3FB 4KJOA 3E0JA 2NVQH 1AN8A 1LTAD 5HURA 2XVSA 1WVLA 3A74A 3PUWA 2YTVA 5BR8L 2N55A 1WTVA 1SMYC 3EROA 1TWGB 5IYDG 1XNRQ 3NHHA 5C4JH 4HIOA 3J7AV 2O5JC 1D1KA 4DAYB 2AWOA 2I46A 1EYAA 1Q82C 3S1NH 5IP7G 1CA5A 4YCWA 1WTPA 3LWUA 3S1QH 3FKIB 3WDNA 4JI6L 1KL9A 1QCBD 1JC7A 5M3FH 3STBC 5CBEE 5D3IB 2LY7A 4JI4Q 1XNQL 2HIVA 5JJZA 1R4PB 1OXVA 3JAMc 1WCMB 3K7AB 1VQGA 1SYFA 4GNXB 1RF2D 4A3KG 2OQKA 2BOSA 5LMNQ 1D8LA 4HCEA 2F4VL 4C2MH 2Z0SA 2PYKA 1Q12A 3H3VI 4A3DB 5BN3A 5IODA 1A6XA 3S14B 3OIPA 4A3CH 3ER0A 4DAVA 1PH1A 2AKWB 1NR4A 4IJLA 2F4IA 3QOJA 5I9PA 5CBAE 1YJWA 3SR1A 5DNFA 3UI2A 3Q22A 1CI3M 3DXJC 1PH3A 1E0BA 3P75A 4Q5VA 4ZYSA 2QA4A 1PDQA 3A8IE 3FPPA 4QIWE 2D2CC 2KUMA 5EKLA 1VQ6A 4LFAQ 2RBMA 4DUZQ 1JE5A 2QKIC 3PIPA 4DK3C 4NB3A 4DR6L 2UXBL 4ME3A 3S1MB 1BOSA 1SJHD 3GTQB 1SFOH 4A3DH 3D3RA 1ENAA 1M90C 1I50B 2GN5A 2LSSA 1B53A 3IKJA 2KJXA 1BO0A 2XN9C 3HGBA 2A6HC 5BN5A 5EBCA 3NEMA 1HNXL 1VQ8A 2JE6I 4BY7H 2IL8A 2F0FA 3J81i 1KQSA 5KIXA 2WAQE 2H5XA 4IPCA 1DM0B 5LMUL 3H0GH 5IWAL 3HOVG 5BN4A 4UY8C 4S3SA 3DEOA 4CJ1B 1CT1D 1VQHA 3I4NG 1GHKA 4HJ9A 2EPBA 1IKLA 1PH4A 5JAVA 3M9BA 3UDGA 4DR4Q 1VQFA 1JE4A 1PH8A 1HA5A 1SE8A 3R2IA 4DK6C 1Z7TA 1PFBA 1HQMC 3GP7A 4DR2L 2XGTA
chains in the Genus database with same CATH topology
4V0BA 2K28A 1WTOA 1F9QA 1OXUA 2EVBA 2NBFA 1YNNC 1Q8IA 3LWEA 1TT2A 4ULLA 2NWGA 5LL6S 3DMUA 3DHQA 1RHPA 1U4RA 3SEBA 1LTGD 3BDOA 3MWYW 5JEAJ 2B63B 3D4RA 1ZEQX 1EY9A 4KI0A 4U673 1T5EA 2SEBD 5CC4A 5G3LD 1KDAA 2A68D 4C3JB 2C9OA 5FLXL 3R93A 1PTOD 3ITPA 1EZ8A 1B9NA 3QWNA 3TP6A 1WTQA 3H09A 3VYTA 3PUXA 2K5QA 4IUNA 1Y1VB 1E2WA 1QE6A 4RCOA 2VB3X 3NQTA 1RKNA 2B8FA 3C1EA 1STAA 1BDOA 3TP7A 4RKLA 2F0OA 3I72A 1FD7D 1CTMA 5JVG3 1QNUA 4I7ZC 5FOBB 5IGDA 1WTRA 3EVQA 1DJRD 5J39A 4C1NK 3A8KE 1TR5A 2QF7A 1U9RA 1U4MA 1A3VA 4DAPA 4X3TA 5D3DA 2XIWA 3K5LA 2OF1A 3D8GA 4ZKCB 4E6IA 4NDXA 3BZDB 4XYOA 1T5XD 2E2HB 3URYA 3LNNA 1VF5C 3OIQA 1HXYD 2CQAA 1AW7A 2JXMB 4M8AA 4B9WA 1PRTD 1L0XB 1ILQA 3N52A 1II3A 4OO1I 2IPKD 4XYQA 1TS2A 3HEJA 4WFN3 4C3HB 3SHLA 2N88A 4XXEA 1R4QB 2FMMA 4QMGA 3GD7A 3ND9A 1Q1EA 1V1PB 2FINB 5G3LF 2B39A 1PTOF 2E2DC 4PMBA 1NCVA 2B2VC 1LABA 3G7LA 1B44D 3CHBD 3I4MB 1W6KA 4RCNA 3GTOB 2F0QA 4FP5D 3L7ZC 5ISRA 1R9TB 4XIGS 1WTXA 1FR3A 4A93B 4CKCA 4Q0FA 1O7ZA 2B2WA 4O42A 4Y7NB 5KNCA 4RGMA 1G8ZD 1SDFA 1SYEA 1G2TA 4IUTA 2QEJC 2F0UA 3KLSA 5C3WA 5DAUA 2DNEA 5I6WA 2D62A 2EJFC 1A15A 5A2QL 3I91A 2Z4HA 1EEID 4ID6A 4PNYA 5I4DA 2WACA 3K59A 1BCPB 1RJTA 3BG3A 4V190 1X3QA 2A6EC 3S1RB 2FFKB 5CV7A 2X6LA 2L4NA 4EVOA 5CMDA 2A5HA 4X3KA 1OXTA 4QUFA 3PMFA 1BUVT 3L3OC 2KEEA 1O7YA 1U4PA 3ERQA 3K5MA 3QOLA 4XDXA 2A74C 1SNDA 2F03A 2IX3A 3S2DB 2WB1B 2PO4A 1LTTD 1KLUD 1KAAA 4C3JG 1DYQA 1SXTA 4HSVA 2EY1A 4G4KA 4IURA 3OWFA 4KJNA 1STEA 2DY7A 2F0GA 2EYLA 1ZYRC 3E6ZX 2NZ1D 2R3ZA 2CHBD 1BCPD 2R6GA 3Q23A 2BE5C 2NN6G 5K5PA 2F3VA 5IGGA 2Z8LA 1BQQT 5JPMC 2L9HA 3V05A 2ZXOA 3EA6A 1JICA 3T51B 4LAAA 3EQLC 1KNEA 2ENBA 4KKUA 4QB4A 5D14A 1MGSA 2BDNA 1QOHA 4FVMA 1GHJA 1V1OA 1QG7A 4ZUIA 5C4HA 3AU7A 4G7HC 2DY8A 4QCLA 1D6EC 3T56B 3ONAB 1Z6HA 3EFXD 3GTGB 1S5BD 2EYPA 1I3QB 2RSOA 1H9SB 5M3MB 4U68A 1VCIA 1V1PA 3K58A 3H91A 3J7YW 3G6JB 2XWBB 2IJ0A 3H3VC 2FMCA 5LL6X 2EYFA 2RSNA 1X32A 3KBXA 4K5WA 2MHVA 1S5CD 2F0KA 2F0MA 4ZK9B 2WV6D 3FEWX 5E4XA 2PPBC 4A3EB 1ML0D 1VMCA 3WOEA 3T16A 2A73B 2D5DA 3RMHA 4CJ2C 2ICIA 2VUMB 5C44B 5IGCA 1PZKD 2IT1A 2B2TC 3DWPA 3PUYA 1F9SA 1UAPA 1CA6A 1EWHA 4BY1B 1WTWA 2LS01 2ICEC 1G91A 4GZYC 4F8MA 1ENCA 3GV6A 1KABA 5JEAG 3I70A 3SK6A 2IW3A 3QIAA 2NTSA 4TSSA 2OEOA 2DN8A 2K1BA 1I4HA 3RLFA 3SK4A 3J80L 1FNWA 4OHJA 2EE1A 5I2XA 1NSNS 3AB9A 4KHVA 4NMZA 3IL8A 2MPMA 3HS0C 2OXPA 1HRJA 2ZT9C 5J1ZA 5LHY1 3GTLB 1DD2A 3MFGA 4A3KB 4FF4A 5ELCA 1HA6A 2IX1A 3NQIA 1EOTA 3C1FA 5C0XJ 1F2YA 2WKDA 2G9HD 3GV3A 5C4ZA 3DEPA 2ZXRA 2EOTA 5EKKA 3GTMB 1AEXA 3KBGA 3QO2A 3MEHA 2HCIA 1I6HB 2EDGA 5ELDA 1GUSA 3N6RA 3C2PA 2EJGC 1BR9A 2JA8B 3W3AA 3Q6SA 4PMCA 3CRKC 3M7NA 2J0TD 2F0SA 1WD1A 5ELBA 1TQOA 1H9JA 1STHA 4KY7A 1CQVA 1NR2A 4BWGB 1IW7C 1B3AA 1J9OA 2E76C 2KOLA 1RCVD 4KHZA 1SBBB 4LK1C 2PCFB 3LX0A 3PUZA 1SYGA 2SNSA 5I6YA 1JOQA 1NUCA 1Y8OB 4TRDA 1OXXK 1F77A 4NKLA 1E2VA 3HOVB 2A6ED 2JA5B 3VR5A 2Q8RE 4R8NA 5C4XB 2K6AA 1SNPA 3S17B 3SE0A 4PMWA 1F9PA 1D2BA 4TKOB 3IAYA 1PTOC 4ZRZA 1EIHA 1QNKA 2PMZB 1LTBD 2A68C 2M9VA 5AFWA 3A8JE 3IFDA 1JOKA 3I90A 2JEBI 1AP0A 1YNJC 2G9DA 1WD0A 4KKSA 1MSGA 3S1NB 2F0JA 3SDZA 4K5XA 4L8JA 1D5ZC 1EY0A 4DNTB 3O13A 4BBRB 4XQNA 5I2YA 1B50A 3MXGA 2F3WA 2WKCA 1Y8PB 4KY5A 1LV9A 2K03A 2RQXA 2H1EA 5IOCA 1BF4A 4JK1C 5CYUA 2K7VA 5EPKA 5CGKA 2BCOA 1Q90A 4HTHA 2V4DA 5D65A 5C5MA 3L9AX 3QG1A 4HR7B 3M85A 4RKBA 1EL0A 4H7BA 3S2HB 3H6MA 4NP5A 1X3PA 4H44C 1DXMA 2EYOA 2YU9B 2L11A 2J4XA 1B2TA 2L55A 3W2DA 1KTKA 4KTAA 3ZYYX 2VB2X 5EQ0A 2EY2A 1PRTF 3S15B 1I4GA 4RA8A 1E2ZA 1SNQA 2JP1A 2VNUD 4M1UB 3R3OA 3S1QB 4UAIA 2EYMA 2RKSA 2NN6H 4C3HG 1F9RA 1CK1A 3KF8A 2L1BA 3MVVA 1C48A 2B2UA 2MGSA 2R93B 3H0GB 5IGFA 2PZTA 3MXUA 2KCNA 1GUTA 1PTOH 3HKZB 4EGVA 3IFTA 2PZUA 1BBXC 4A3BB 3I4LA 2LMCB 1ET6A 5J22A 2EZVA 3VA5A 1YNND 4EQNA 3NSWA 3I3CA 2JEAI 3S9WA 4KMUC 2RDHA 1OO9B 4A3JB 4NW2A 3BYYB 2HCCA 1O78A 3OMGA 4XQQA 2A69C 1ZYRD 3NE5B 5CV9A 3K57A 2QILA 3HOUB 4IZ8A 1BCPC 3MXNA 4DXFA 5KYLA 1TY2A 1TWHB 1AFPA 3C3LA 3EJIA 1SFOB 3PIO3 1DCZA 1EYCA 4XQJA 2E2JB 3TP5A 1EU4A 1EQTA 5A2QE 1BNZA 4N9PA 2XWJB 3MAQA 2PW5A 2F0NA 1H9RA 2K01A 4YIJA 1J8IA 4EQOA 4OIJA 3BVGA 4HMJA 2M2LA 1LTID 2F0DA 5C0XG 2E2IB 2JYOA 2XSCA 2CW0C 5JVH3 1ENFA 4B9XA 4KN7C 5JOBA 1H9SA 3F2UA 2B2VA 5EGTA 1IW7D 1CFMA 5K36G 5K36H 3MTSA 3HG9A 4IQZA 3Q0AA 1PYWD 5NUCA 2PZWA 1EEFD 3CRLC 5JPNC 2NN6I 4BBSB 4A3FB 4IALA 3M7GA 4AYBB 5HGTA 1QWYA 2JA7B 3HOWB 2K5DA 3VYRA 1H9MA 3FPUB 1TS3A 1HTPA 5C0XH 3OSOA 1RODA 4A3GB 4R9WA 2NTTA 1W6JA 1XX8A 4P2CB 1TVXA 4L63B 3X3NA 1L0YB 2B2TA 1HFNA 3VR2A 3TZDA 3TN2A 4DXGA 1TWCB 3V2TA 4O1NA 3E5SA 2D9UA 3CU7A 4FXKC 1CHPD 1TWFB 1SE3A 1FNUA 4OIKA 5KRUA 4RGOS 1MD2D 3DM1A 1F2MA 2K05A 4PV1C 1PRTC 3OMCA 1S5DD 4ZLTF 1SJED 2X6GA 3D4WA 1IHZA 5T1GA 3K5OA 3P7JA 5C6AA 3NPPA 1PRTB 3NUCA 1XTCD 5M5WB 2F1MA 4C3IB 1TS4A 4N9TA 3M3YB 2IWHA 1C8CA 3DWQA 5IIFA 1A2TA 3TZUA 1O80A 2F0TA 3I4NB 4RWSC 1SE4A 5TSSA 1DONA 1LT4D 5EJWA 3SXHA 3OHXC 1B1ZA 4ZAIA 1JORA 4J8QA 1PLFA 4OL7A 3SK5A 1LT3D 2KQ3A 2AQ1B 5E1FA 1H9KA 4HSPA 2KHSA 1ONLA 3NWTA 1CHQD 1UUPA 3A55A 2PQEA 2TSSA 3BVZA 2R7ZB 4C1NI 4XT1B 2L0CA 1RTOA 1EY7A 1M4VA 3BDCA 3PV0A 1STYA 4FXDA 4IFDG 1B4OA 1V8QA 4X3SA 1KLGD 4C2MB 2CW0D 5T1IA 1MSHA 2E74C 1TU2B 1VMPA 1LTRD 4FXGC 1JWUD 3S16B 4ILWA 3GTJB 3HZXA 4IUUA 3D31A 4LMQD 3A7LA 5DM63 1GOZA 3P1HA 4IUQA 1HCZA 2B8GA 2O5IC 1JWMD 2I07B 1AZQA 1PTOB 2KA7A 4QUCA 3KLRA 5C5LA 3OWEB 2SOBA 1VDZA 4KKTA 2EYHA 3R8BA 1JR0D 3FRPB 3U9OA 3J7AF 5FO9B 1G2SA 1EZ6A 4KY6A 4FO2A 1ESRA 2VXWA 2C5CA 2RDGA 4B08A 3J80E 4OO1H 5KGUA 1SEBD 1JWSD 4BY7B 4BA1I 3MHBA 2EYJA 4EQPA 3D6CA 2MUYA 3HOXB 1PZJD 1SNCA 4CJ0B 4IN3A 2JA6B 3QJYA 2NVXB 2FHTA 2B2WC 1JCKB 5M5XB 1SNMA 3CQZB 4H13C 1EY8A 3J81E 3GO5A 2KVMA 5JEAH 4HMIA 4K2KA 1D1IA 1HQRD 2RDFA 3OPOA 4L6TB 4R8IA 1KNAA 2B2YC 3VYUA 4RHSA 3MC0B 4ZQ3A 4K6DA 3MZ5A 2ID0A 3JAML 1A2UA 1EWCA 3TP8A 1DOMA 3ND8A 1GJXA 5F2DA 4ME5A 4CGYB 4DF7A 1LLRD 1DZ1A 2EJMA 4DAYA 3FVQA 4H0LC 2NUCA 2K33A 2H4OA 4TQUS 3D4DA 3KLSX 1EY6A 4CHTB 4BS9A 2EY6A 1IYVA 4FF1A 3RZDB 4RHRA 1B9MA 2L12A 5I9OA 4KK7A 4DNRB 2EXZA 1TY0A 3Q24A 1EU3A 5ELEA 3NBHA 2EY5A 2F0LA 2F0HA 1U4LA 1ZXTA 5M5YB 3P20A 5EPLA 2DNCA 2XRSD 5COYA 4DK1A 3RZOB 2JSOA 1GUNA 2LKVA 2PW7A 4KN4C 1BXTA 3DWAA 1ESFA 4IUPA 1STBA 2B2YA 1VF7A 2MP1A 2NYZD 4ZUJA 3V96A 1HPCA 1K8MA 4MIUA 4X3UA 3PO3B 4K8JA 1RTNA 2MJ8A 3GTKB 1HFGA 3R2TA 1I4PA 1KDBA 2R61A 1A3UA 1Z47A 1S5ED 2Z4IA 2X69A 4ODGA 4F88A 1RD9D 5EBDA 2A6HD 4DK0A 1G291 4J1MA 4BA2I 2B2UC 1SYCA 2AUJD 4ABNA 1CZWA 2BDOA 2BE5D 5FO7B 5FO8B 1I4RA 3NTIA 4IFDJ 5FLXE 2E75C 2TMPA 5KNBA 2XRQD 2O4XA 4DA2A 2HDLA 4IFDH 4DU9A 2J7ZA 3HOYB 5IT9L 1Y69U 1MBYA 3QB3A 2Q8TA 3K5NA 4F87A 4CBVA 4FF3A 4KV6A 4PQXA 1TS5A 2LFNA 5DEHA 1EY5A 1K8OA 1GUOA 2SNMA 4G7OC 3J81L 3BYTB 4DFAA 5FK9C 1F2ZA 3NP8A 1CQFA 1M8AA 1ET9A 2F0PA 2ZXPA 2HDMA 1CM9A 3RD4A 5M9OA 1EYDA 3KUPA 1LO5D 1I6VC 2YYZA 4DGZA 1QB5D 3K6OA 1LACA 1LT5D 3M4YA 1NAPA 3T13A 2NVQB 3TMEA 4OGQC 2F0WA 5CV5A 1SYDA 1F2LA 3DUZA 4A3IB 4K6LA 4HCSA 4MN3A 4QF4A 3VR3A 4WRDA 3VA7A 1I4QA 5CR3A 3I8ZA 4XTCS 4CKEA 3NTHA 1DOLA 2NB0A 2F0EA 3NBIA 2KECA 2O2LD 1HTLD 1A3TA 3FMCA 4WJWA 2K32A 4OO1G 5C0XI 1JOOA 2Q8IB 3TBIB 1DOKA 2FJ2A 5DM73 2Y0SB 3NTKA 4J6HA 2K5WA 1I4XA 4LJZC 2BA0A 1Y8NB 1IYUA 1PFMA 3K0YA 5E4WC 2PNRC 1V43A 5IGBA 1IKMA 1S4ZA 3FDTA 4K5VA 1UEAB 3GQBA 5C3EB 1EIGA 4ZKBB 3BVMA 1KDCA 3VYSA 5EKIA 1GUWA 2NVYB 4RAUC 1IL8A 5A35A 3RUZA 2SDFA 5E3FA 2L5TA 1FYCA 3VR4A 1C4QA 3PIP3 3BDLA 4DN4M 4UDUC 3GTPB 2NVTB 2BA1A 1HUNA 1ZKOA 4K2LA 2A69D 3JAME 3PUVA 4F7XA 2RVLA 1HUMA 1SAPA 5CV6A 4C3IG 1Y1WB 1HHVA 4K8IA 5C3XA 3MA2B 2AUKA 1STGA 4A3MB 5KYIA 1QJOA 3NK9A 1LTSD 2M00A 1PZID 1PMRA 2WINB 3KK7A 4KD3A 1RDPD 2F0IA 1EY4A 2AWNA 5KEEA 3WOFA 1STNA 2WIIB 2Z1CA 3SK8A 2QCPX 3BS1A 2RA4A 3M4OB 5IT9E 2WAQB 1Q1BA 1ICWA 3CKIB 3X3MA 3A7AB 1SE2A 4RH6A 1UNSA 1TWAB 4HAEA 4G57A 3NWSA 2R92B 2AQ2B 1O7LA 4MHEA 4K14A 2IX0A 1QILA 3T53B 3D6WA 3C46A 1SYBA 2GA4B 1EQVA 4HEDA 4C56C 1EFID 4IFDI 1PXUA 2KCCA 2QDBA 1OXSC 4I65A 2HQEA 3I73A 2F0VA 3PO2B 5KNDA 1CZGA 4FF2A 1TIID 2AQ3B 4QIWB 3OOCA 4HN7A 1PFNA 3AMUA 4FNFA 1D5MC 1SNOA 5FKAC 3OW7A 4RFBA 3HP3A 4JBWA 5EPJA 1XWEA 2KEDA 1SMYD 1YNJD 3VR6A 4Z9CB 1LT6D 3MXPA 4XT3B 1TKWB 1BCPF 1FGBD 4WORA 3HOZB 1ILPA 2CVRA 1AZPA 4CKBA 3A54A 3TSSA 5CV8A 3U9SA 1K83B 5ELFA 3HRZC 3T4AC 1G6ZA 2XNAC 5C4JB 4G7ZC 2WP8J 2OT2A 1S5FD 2K04A 1XYIA 3NXWA 1FNVA 4FYDA 1JB3A 4IUVA 5IGEA 2HUGA 3SVMA 1Q3LA 3MFYA 1D5XC 5CORA 3TDQA 1JQYD 1MI2A 1SSOA 1GUGA 1XXGA 4KD4A 1GXDC 4RGNA 3H94A 4RGTA 3A56A 5M3FB 4KJOA 3E0JA 1AN8A 1LTAD 5HURA 2XVSA 1WVLA 3PUWA 2N55A 1WTVA 1SMYC 3EROA 1TWGB 3NHHA 3J7AV 2O5JC 1D1KA 2AWOA 2I46A 1EYAA 1CA5A 1WTPA 3LWUA 3FKIB 3WDNA 1QCBD 1JC7A 5CBEE 5D3IB 2LY7A 5JJZA 1R4PB 1OXVA 1WCMB 3K7AB 1SYFA 1RF2D 2BOSA 4HCEA 2PYKA 1Q12A 4A3DB 5BN3A 5IODA 1A6XA 3S14B 3OIPA 4DAVA 1NR4A 2F4IA 3QOJA 5I9PA 5CBAE 3SR1A 5DNFA 3UI2A 3Q22A 1CI3M 3DXJC 1E0BA 3P75A 4Q5VA 4ZYSA 1PDQA 3A8IE 3FPPA 2D2CC 2KUMA 5EKLA 2RBMA 2QKIC 3S1MB 1BOSA 3GTQB 1SJHD 3D3RA 1ENAA 1I50B 3IKJA 1B53A 2KJXA 1BO0A 2XN9C 3HGBA 2A6HC 5BN5A 5EBCA 2JE6I 2IL8A 2F0FA 5KIXA 1DM0B 5BN4A 4S3SA 3DEOA 4CJ1B 1CT1D 1GHKA 2EPBA 1IKLA 5JAVA 1JE4A 1HA5A 3R2IA 1Z7TA 1PFBA 1HQMC 3GP7A 5CV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 H;  2E75 C;  2EDG A;  2KA7 A;  3A8J E;  3FMC A;  3KLR A;  1GUS A;  5KNB A;  3N6R A;  1IYV A;  1OXU A;  1VDZ A;  1YNJ C;  2EVB A;  2JEB I;  1YNN C;  2K32 A;  3U9S A;  2PPB C;  4IFD H;  1B9M A;  1PMR A;  2EJG C;  4KKT A;  4KKS A;  2F1M A;  5C0X G;  3W3A A;  1Y69 U;  4DNR B;  1Q12 A;  3SDZ A;  4OO1 G;  2CW0 C;  5BN3 A;  3CRK C;  1A6X A;  2D5D A;  3M7N A;  3MXU A;  4L8J A;  3TZU A;  3GD7 A;  3ND9 A;  1Q1E A;  2Q8I B;  4DNT B;  1GUT A;  1H9J A;  4KN7 C;  3IFT A;  1H9S A;  2IT1 A;  3BDO A;  3PUY A;  4G7Z C;  3D4R A;  1IW7 D;  1IW7 C;  3I4L A;  2LMC B;  4OO1 H;  1EWH A;  1CFM A;  3P20 A;  2E76 C;  1Y8P B;  1LAB A;  5K36 G;  5K36 H;  4KI0 A;  4BA1 I;  4IQZ A;  1Q1B A;  1CI3 M;  3DXJ C;  1T5E A;  1ZYR C;  3CRL C;  4KHZ A;  4RCN A;  1K8O A;  4LJZ C;  1GUO A;  2NN6 I;  3A7A B;  2BA0 A;  1Y8N B;  1IYU A;  2A68 D;  2DNC A;  4JK1 C;  3L7Z C;  2K7V A;  4LK1 C;  3A8I E;  2R6G A;  2PCF B;  3FPP A;  4XIG S;  2JEA I;  4DK1 A;  4GZY C;  4G7O C;  1Q90 A;  2BE5 C;  2NN6 G;  3PUZ A;  2PNR C;  1FR3 A;  1GUN A;  1V43 A;  3MFY A;  2D2C C;  1B9N A;  1O7L A;  3QJY A;  5JEA G;  1H9K A;  4KN4 C;  4KMU C;  1GUG A;  2V4D A;  1H9M A;  3GQB A;  1ONL A;  3H94 A;  1HTP A;  4H13 C;  3QIA A;  1VF7 A;  3PUX A;  3T51 B;  5C0X H;  3QG1 A;  4HR7 B;  3M85 A;  2DN8 A;  1O78 A;  3EQL C;  4KKU A;  3RLF A;  3T53 B;  1HPC A;  1E2W A;  1K8M A;  1Y8O B;  5JEA H;  1OXX K;  5A35 A;  3PUW A;  2A69 C;  1I6V C;  5KNC A;  3NE5 B;  2B8F A;  1SMY C;  2YYZ A;  3IKJ A;  1BDO A;  4H44 C;  1LAC A;  3AB9 A;  3PV0 A;  1DXM A;  2L5T A;  3I72 A;  3M4Y A;  1GHJ A;  1CTM A;  3OPO A;  1FYC A;  3VR4 A;  1E2V A;  3HGB A;  2A6E D;  2A6H C;  2DNE A;  5BN5 A;  2KCC A;  2D62 A;  2EJF C;  2JE6 I;  4I7Z C;  1OXS C;  1DCZ A;  4IFD G;  4G7H C;  2O5J C;  3I73 A;  4OGQ C;  2AWO A;  1V8Q A;  3VR5 A;  2ZT9 C;  3VR2 A;  5KND A;  1DD2 A;  3T56 B;  2BA1 A;  1Z6H A;  3A8K E;  2E74 C;  1ZKO A;  5BN4 A;  2QF7 A;  2A69 D;  1H9S B;  3LWU A;  2A6H D;  4DK0 A;  1TU2 B;  3BG3 A;  3PUV A;  3ND8 A;  1VCI A;  1G29 1;  3OOC A;  3VR3 A;  4BA2 I;  1GHK A;  1GJX A;  3WDN A;  2A6E C;  3SE0 A;  3VA7 A;  2AUJ D;  3D31 A;  1E2Z A;  1H9R A;  2EJM A;  3OW7 A;  3A7L A;  4JBW A;  4XTC S;  2BDO A;  2AUK A;  1Z7T A;  1HQM C;  3LNN A;  4TKO B;  4H0L C;  3VR6 A;  1OXV A;  1OXT A;  1VF5 C;  1HCZ A;  2BE5 D;  2K33 A;  4PV1 C;  2JXM B;  1QJO A;  1TKW B;  4TQU S;  2B8G A;  2O5I C;  2A68 C; 
#chains in the Genus database with same CATH topology
 4V0B A;  2HQL A;  2K28 A;  4J15 A;  1WTO A;  1F9Q A;  1ASY A;  1OXU A;  2EVB A;  4BBS G;  2NBF A;  1YNN C;  1Q8I A;  3LWE A;  1TT2 A;  4ULL A;  5GAD C;  4DR7 Q;  2NWG A;  5LL6 S;  3DMU A;  3DHQ A;  4R4T A;  1RHP A;  4JI8 L;  1U4R A;  3SEB A;  1LTG D;  5C4X G;  3BDO A;  3MWY W;  5JEA J;  2B63 B;  3D4R A;  3HOX G;  5GAH C;  3PIO A;  2JA7 H;  4JCV E;  1ZEQ X;  1EY9 A;  4KI0 A;  4U67 3;  1T5E A;  2SEB D;  5CC4 A;  5FJ8 H;  5G3L D;  1KDA A;  2A68 D;  4C3J B;  3J80 c;  4GLX A;  2C9O A;  5FLX L;  3R93 A;  1PTO D;  3ITP A;  1EZ8 A;  1B9N A;  4P72 A;  3QWN A;  4YWM A;  3TP6 A;  1WTQ A;  1K73 C;  3H09 A;  1M1K C;  3VYT A;  2RHS B;  3PUX A;  2K5Q A;  4IUN A;  5GQO A;  3JAM i;  3HOX H;  1Y1V B;  1E2W A;  1QE6 A;  1WFQ A;  4RCO A;  1C0A A;  3CC7 A;  2VB3 X;  3NQT A;  3Q8D A;  1JJG A;  2PI2 E;  1RKN A;  2B8F A;  3C1E A;  1STA A;  1BDO A;  3TP7 A;  4RKL A;  2F0O A;  3I72 A;  1FD7 D;  1CTM A;  1E7Z A;  5JVG 3;  1QNU A;  1NY4 A;  4I7Z C;  2KHI A;  5FOB B;  4AIM A;  5IGD A;  1WTR A;  3J81 c;  3EVQ A;  1DJR D;  5J39 A;  4C1N K;  3A8K E;  1TR5 A;  1VQE A;  2QF7 A;  1U9R A;  1U4M A;  1A3V A;  4DAP A;  4X3T A;  5D3D A;  2XIW A;  1XMO L;  3K5L A;  5H1S E;  4JVZ A;  2OF1 A;  3D8G A;  4ZKC B;  4E6I A;  4NDX A;  3CCS A;  3BZD B;  4XYO A;  1Y1V H;  1T5X D;  2E2H B;  3A5Z B;  3URY A;  4APV A;  2N8N A;  3GTO H;  2ZJR A;  3LNN A;  1HR0 L;  1VF5 C;  3OIQ A;  1UE7 A;  1HXY D;  2CQA A;  1AW7 A;  2A19 A;  2JXM B;  4M8A A;  4B9W A;  2B63 G;  1PRT D;  1L0X B;  4JG2 A;  1ILQ A;  1X55 A;  3HOW H;  2BH2 A;  3JC6 6;  3N52 A;  1II3 A;  4JOI A;  4OO1 I;  2IPK D;  5IYC H;  4XYQ A;  1TS2 A;  3HEJ A;  3BU2 A;  4WFN 3;  4C3H B;  2Q2H A;  3SHL A;  2N88 A;  4XXE A;  1B70 B;  1R4Q B;  3I4O A;  2FMM A;  4QMG A;  4Y7N H;  3GD7 A;  3ND9 A;  1Q1E A;  1V1P B;  2FIN B;  1I6H H;  5G3L F;  2I5H A;  2B39 A;  3HFZ B;  3RZD H;  1PTO F;  2E2D C;  4PMB A;  1NCV A;  4R4C A;  2B2V C;  1LAB A;  1Q46 A;  4N8F A;  3G7L A;  1B44 D;  4B3R L;  2N3S A;  3CHB D;  4LFA L;  1W6K A;  4RCN A;  3T1H L;  3GTO B;  3I4M B;  2F0Q A;  4FP5 D;  3L7Z C;  5ISR A;  4DR6 Q;  2UXB Q;  1R9T B;  4XIG S;  1SN8 A;  1WTX A;  2CQO A;  3NBH B;  1FR3 A;  4A93 B;  4CKC A;  1TXY A;  4Q0F A;  5LMN W;  4HJ8 A;  3AQQ A;  1XMQ Q;  3HOY H;  3S24 A;  1O7Z A;  2A1A A;  2B2W A;  3BJU A;  2IHF A;  4O42 A;  1HZ9 A;  4Y7N B;  2K50 A;  5KNC A;  4RGM A;  3RN2 A;  4LFB Q;  1G8Z D;  1SDF A;  4A3C G;  1SYE A;  1G2T A;  4IUT A;  2QEJ C;  2F0U A;  3KLS A;  5C3W A;  5LMU Q;  5DAU A;  5IE8 A;  2DNE A;  4NXN Q;  2D62 A;  2EJF C;  5I6W A;  3T1Y L;  1A15 A;  5A2Q L;  3I91 A;  2ALY B;  4C3I H;  1XPO A;  2Z4H A;  5HGQ A;  1EEI D;  1G6P A;  4ID6 A;  4PNY A;  5I4D A;  4DR4 L;  2WAC A;  3K59 A;  2UXD L;  1BCP B;  1RJT A;  3BG3 A;  4V19 0;  4B3T L;  1UE5 A;  1X3Q A;  2A6E C;  3S1R B;  2FFK B;  5CV7 A;  2X6L A;  2JQO A;  2L4N A;  1I94 Q;  3KJO A;  4EVO A;  5CMD A;  2A5H A;  2MO1 A;  1OXT A;  4X3K A;  4QUF A;  3PMF A;  1BUV T;  4DR7 L;  4JI3 L;  3L3O C;  3PQI A;  1VQJ A;  2KEE A;  1O7Y A;  1U4P A;  1P16 A;  3ERQ A;  3K5M A;  3QOL A;  4XDX A;  2A74 C;  1SND A;  3M4P A;  2F03 A;  2IX3 A;  3S2D B;  2WB1 B;  2PO4 A;  1LTT D;  4OON A;  1KLU D;  1KAA A;  4C3J G;  1DYQ A;  1SXT A;  4HSV A;  2EY1 A;  1WCM G;  4G4K A;  4X64 Q;  4IUR A;  4N8X 1;  3OWF A;  4MNO A;  4KJN A;  1STE A;  2DY7 A;  2F0G A;  2ZM6 L;  2EYL A;  3CXC A;  1ZYR C;  3E6Z X;  2NZ1 D;  1X9N A;  2R3Z A;  2CHB D;  1BCP D;  4JOI C;  2R6G A;  1JT8 A;  3M4Q A;  3Q23 A;  2BE5 C;  2NN6 G;  5K5P A;  2F3V A;  5IGG A;  2Z8L A;  1BQQ T;  5JPM C;  2CCZ A;  2L9H A;  3V05 A;  2ZXO A;  3EA6 A;  1JIC A;  3T51 B;  4LAA A;  1SRU A;  3CPW A;  3EQL C;  1KNE A;  2ENB A;  4KKU A;  4QB4 A;  4B3S L;  5D14 A;  4OEL B;  1MGS A;  4PZ6 A;  2BDN A;  1MHW C;  1IYJ B;  1QOH A;  4FVM A;  1GHJ A;  1V1O A;  3PF5 A;  1QG7 A;  1G51 A;  3E9I A;  4ZUI A;  5C4H A;  3AU7 A;  4G7H C;  2F3I A;  3HKS A;  2VQE Q;  2DY8 A;  1EIY B;  4QCL A;  1D6E C;  3T56 B;  3ONA B;  1Z6H A;  3EFX D;  3GTG B;  1S5B D;  2EYP A;  1I3Q B;  2RSO A;  1H9S B;  5M3M B;  3I4M G;  1PH5 A;  1KHI A;  4U68 A;  1VCI A;  1V1P A;  3W1B A;  3K58 A;  3H91 A;  4GKK L;  3J7Y W;  3G6J B;  2XWB B;  1S40 A;  3KJP A;  1S72 A;  1NMG A;  1J6Q A;  4BY1 H;  2IJ0 A;  3H3V C;  2FMC A;  4KHP Q;  1LM0 A;  5LL6 X;  2EYF A;  1BVS A;  2RSN A;  4HJ5 A;  1FJG Q;  1X32 A;  2MQH A;  3KBX A;  3J7Z C;  4K5W A;  2MHV A;  1S5C D;  2F0K A;  2F0M A;  4ZK9 B;  2WV6 D;  3FEW X;  2UUC L;  5E4X A;  2CFM A;  2RF4 A;  2PPB C;  4A3E B;  3HOY G;  2XTI A;  2OWO A;  1ML0 D;  1VMC A;  5M5Y H;  3WOE A;  3T16 A;  2A73 B;  2D5D A;  3RMH A;  4CJ2 C;  2ICI A;  2VUM B;  1E1T A;  5C44 B;  5IGC A;  5ELO A;  1PZK D;  3T1H Q;  2IT1 A;  3UE0 A;  2B2T C;  3DWP A;  3NEN A;  3PUY A;  3SGI A;  1F9S A;  3G6E A;  1UAP A;  3E0E A;  1EWH A;  3GDE A;  4LUO A;  4HIM A;  1S3O A;  1CA6 A;  4BY1 B;  1WTW A;  1E1O A;  4A3B G;  2LS0 1;  2ICE C;  4JI0 Q;  1HNW Q;  1G91 A;  1ICF B;  3PCO B;  4GZY C;  1VQM A;  4F8M A;  2CWA A;  1ENC A;  3GV6 A;  4RG1 A;  1KAB A;  5JEA G;  3CC2 A;  1RIP A;  3I70 A;  4PZ7 A;  3SK6 A;  4A3M G;  3STB D;  2UU9 L;  2IW3 A;  1QZG A;  2CH4 A;  3QIA A;  2NTS A;  3RR5 A;  5IYC G;  1MJE A;  4TSS A;  2OEO A;  2DN8 A;  2K1B A;  1XNR L;  1I4H A;  3RLF A;  3SK4 A;  3J80 L;  1NJI C;  4NXN L;  1FNW A;  4OHJ A;  5C44 H;  2EE1 A;  5I2X A;  1NSN S;  3AB9 A;  4KHV A;  4NMZ A;  3IL8 A;  1QVG A;  1MKH A;  4L5R C;  2MPM A;  2ZTE A;  3HS0 C;  2UXD Q;  2OXP A;  4JV5 L;  4QJF A;  1HRJ A;  4B3T Q;  2ZT9 C;  2KEN A;  5J1Z A;  5LHY 1;  3GTL B;  1DD2 A;  2WB1 E;  3HOU H;  3MFG A;  4A3K B;  2ZTC A;  4FF4 A;  5ELC A;  1HA6 A;  5IY0 A;  2IX1 A;  3NQI A;  1EOT A;  3C1F A;  5C0X J;  2JJQ A;  5E7N A;  4LF5 L;  2NVT H;  3GTP H;  1F2Y A;  2WKD A;  2G9H D;  2E2J H;  5JJK A;  3G71 A;  3GV3 A;  5C4Z A;  3DEP A;  1J5E Q;  1NE3 A;  3KOJ A;  2ZXR A;  2EOT A;  1GD7 A;  5EKK A;  1YJN A;  3CCV A;  3GTM B;  1AEX A;  3KBG A;  2Q2U A;  3QO2 A;  3MEH A;  1KRS A;  2HCI A;  4GOP A;  1I6H B;  2EDG A;  5ELD A;  3NEL A;  4DV6 L;  1Y1W H;  1GUS A;  3N6R A;  3C2P A;  3DM3 A;  4DKA C;  2EJG C;  1BR9 A;  2JA8 B;  3F8T A;  3FP9 A;  3W3A A;  3CPF A;  3Q6S A;  4X64 L;  2AMC B;  3GTL H;  3CD6 A;  3HKZ E;  4PMC A;  4A93 G;  3CRK C;  3M7N A;  3I55 A;  2J0T D;  3TRE A;  2F0S A;  1WD1 A;  5ELB A;  4DV1 L;  2C35 B;  4LF8 L;  3TQY A;  2JK8 A;  3PO3 G;  3PO3 H;  1TQO A;  3U4Z A;  1H9J A;  1STH A;  4KY7 A;  1EUJ A;  1CQV A;  1NR2 A;  3ULL A;  4A93 H;  4BWG B;  1IW7 C;  1B3A A;  1E22 A;  1KAW A;  1GVP A;  1J9O A;  2E76 C;  2KOL A;  4KLK A;  1RCV D;  2HIX A;  4KHZ A;  2JA7 G;  4DUZ L;  1VQN A;  1SBB B;  4LK1 C;  3TS2 A;  2PCF B;  3CCL A;  3LX0 A;  3PUZ A;  4R1J A;  1XTD A;  4B3S Q;  1SYG A;  4DV5 Q;  4NPS A;  4QGU A;  2SNS A;  1K83 H;  4JPB W;  3UE1 A;  5I6Y A;  2PNH A;  1HZB A;  1JOQ A;  1VS0 A;  4BBS H;  3I7F A;  2Z9H A;  1NUC A;  1TWA H;  3BZK A;  1Y8O B;  4TRD A;  1OXX K;  1FGU A;  2ZJP A;  1B7Y B;  1F77 A;  1VQI A;  4UPA A;  4X62 L;  3DLL A;  4A3I H;  1UEB A;  4NKL A;  1E2V A;  3CF5 A;  5IWA Q;  3HOV B;  2A6E D;  2JA5 B;  3TRZ A;  3S1R H;  3VR5 A;  2Q8R E;  4GKJ L;  4R8N A;  4JI1 L;  4GKK Q;  5DLQ E;  5C4X B;  2K6A A;  1SNP A;  4OEM B;  4LW1 A;  3S17 B;  4CDE C;  5C44 G;  5GAE C;  4BBR H;  2VUM G;  4GOP C;  2OQ0 A;  4R4I A;  3SE0 A;  4PMW A;  1F9P A;  1HZA A;  4JBK A;  1D2B A;  4TKO B;  3IAY A;  4WJ4 A;  1PTO C;  4ZRZ A;  1VQL A;  1EIH A;  1QNK A;  2PMZ B;  2FXQ A;  1LTB D;  2A68 C;  4GNX A;  3S2D H;  2M9V A;  5AFW A;  1TWF H;  2DJF C;  1H95 A;  3A8J E;  3IFD A;  1JOK A;  3I90 A;  2JEB I;  1AP0 A;  1YNJ C;  2G9D A;  1X3F A;  1WD0 A;  4KKS A;  1MSG A;  3S1N B;  3KDF A;  2F0J A;  3SDZ A;  4K5X A;  4L8J A;  1D5Z C;  1EY0 A;  4DNT B;  3FKI H;  3O13 A;  4BBR B;  4XQN A;  5I2Y A;  4R4O A;  1WJJ A;  1B50 A;  1QUQ B;  3MXG A;  2F3W A;  1CKN B;  2WKC A;  1VQK A;  1Y8P B;  4KY5 A;  1LV9 A;  2K03 A;  4UP9 A;  2RQX A;  2H1E A;  5IOC A;  1BF4 A;  2UU9 Q;  4JK1 C;  5CYU A;  2K7V A;  4L5T A;  5EPK A;  5CGK A;  2BCO A;  1Q90 A;  1HH2 P;  4HTH A;  2V4D A;  3L0O A;  5D65 A;  3S15 H;  5C5M A;  3L9A X;  3QG1 A;  4HR7 B;  3M85 A;  4RKB A;  1EL0 A;  4H7B A;  2OCE A;  2VQF L;  3S2H B;  3H6M A;  4NP5 A;  1X3P A;  4A75 A;  4H44 C;  1DXM A;  3CCQ A;  4DR5 L;  3H0G G;  3BZC A;  2EYO A;  3OYY A;  2YU9 B;  2R7Z H;  3RN5 A;  1V1Q A;  3ICE A;  4P73 A;  1IBK Q;  4OWT B;  2L11 A;  4HID A;  2R93 H;  2J4X A;  5FLM G;  3U58 A;  1B2T A;  2L55 A;  3W2D A;  1KTK A;  1UWV A;  4KTA A;  2VS1 A;  3ZYY X;  1PA6 A;  2V1C C;  2VB2 X;  2WB1 G;  3B6Y A;  5EQ0 A;  2EY2 A;  1PRT F;  3S15 B;  1I4G A;  4RA8 A;  4A3D G;  1E2Z A;  1SNQ A;  5GAG C;  2G5D A;  2JP1 A;  3E3X A;  3ERS X;  4DV6 Q;  3S2H H;  2VNU D;  4M1U B;  1EQR A;  3R3O A;  3S1Q B;  2N49 A;  4UAI A;  2EYM A;  2RKS A;  2NN6 H;  1HJP A;  1F9R A;  1CK1 A;  4C3H G;  3S16 H;  3KF8 A;  4LF6 L;  1GM5 A;  2L1B A;  3MVV A;  1X3G A;  1C48 A;  1K3R A;  2B2U A;  2MGS A;  2R93 B;  1MJC A;  3H0G B;  5IGF A;  1UE6 A;  2PZT A;  3MXU A;  1QVC A;  4B3M Q;  2KCN A;  1K28 A;  1GUT A;  1PTO H;  2CH4 W;  3HKZ B;  4EGV A;  2UXC Q;  3IFT A;  2PZU A;  1BBX C;  4A3B B;  3I4L A;  2LMC B;  1ET6 A;  1VQ5 A;  5J22 A;  2EZV A;  3VA5 A;  1YNN D;  4DV7 L;  4EQN A;  3NSW A;  2YTY A;  3PF4 A;  3I3C A;  2JEA I;  1YNX A;  4GS3 A;  3OTO L;  3S9W A;  4KMU C;  4DUY Q;  2RDH A;  4DNI A;  1WI5 A;  1OO9 B;  4A3J B;  4ZCK A;  4X62 Q;  1L2F A;  4NW2 A;  3BYY B;  3AFP A;  2HCC A;  1CSP A;  5M3F G;  4OWW B;  1O78 A;  3OMG A;  4DV2 L;  2QW7 A;  4XQQ A;  2A69 C;  1VQB A;  1GO3 E;  1ZYR D;  3NE5 B;  5CV9 A;  2NVX H;  3K57 A;  2QIL A;  3HOU B;  2D0O A;  4GKJ Q;  5JJL A;  4IZ8 A;  2F52 A;  1BCP C;  3MXN A;  5M5X H;  4A3L H;  4JI1 Q;  2E8G A;  4DXF A;  3CQZ H;  5KYL A;  2MO0 A;  2IHE A;  1TY2 A;  1TWH B;  1AFP A;  3C3L A;  3EJI A;  1HNZ L;  1SFO B;  4OWX B;  3PIO 3;  1DCZ A;  1EYC A;  1K8G A;  4XQJ A;  4I7A A;  2E2J B;  3TP5 A;  1YI2 A;  1N34 Q;  1EU4 A;  1I50 H;  2KBN A;  1EQT A;  5A2Q E;  1BNZ A;  4IJH A;  4N9P A;  4MTK A;  4GLA C;  2XWJ B;  3KF8 B;  5M3M G;  3MAQ A;  4AYB G;  2PW5 A;  2I5M X;  2F0N A;  1H9R A;  2K01 A;  4BY1 G;  4YIJ A;  3CCR A;  1J8I A;  1YHQ A;  4EQO A;  3U4V A;  4OIJ A;  4A3F H;  2UUA L;  1K0S A;  2RCF A;  1U0L A;  3BVG A;  1IL2 A;  1YHB A;  4HMJ A;  2LXJ A;  1LTI D;  2F0D A;  2M2L A;  1D7Q A;  5C0X G;  2E2I B;  2JYO A;  2XSC A;  2CW0 C;  2Y0S G;  4YWL A;  5JVH 3;  1ENF A;  4B9X A;  1X56 A;  4KN7 C;  5JOB A;  1H9S A;  3K7U C;  3F2U A;  2B2V A;  4DV0 Q;  1PH7 A;  2R93 G;  5EGT A;  1IW7 D;  1BBU A;  3U50 C;  3VDY A;  1CFM A;  2R7Z G;  5K36 G;  5K36 H;  2L15 A;  3HG9 A;  3MTS A;  4IQZ A;  3Q0A A;  1PYW D;  5NUC A;  2E2H H;  3H3V H;  1A0I A;  2PZW A;  1EEF D;  3CRL C;  5JPN C;  3PO2 G;  2NN6 I;  4LFC L;  4JI7 L;  1YZ6 A;  4BBS B;  4A3F B;  4IAL A;  3M7G A;  4AYB B;  5HGT A;  3E9H A;  1QWY A;  1EOV A;  4JI5 Q;  4YWK A;  2JA7 B;  3HOW B;  2VQF Q;  2K5D A;  3VYR A;  1H9M A;  3FPU B;  1TS3 A;  1HTP A;  5C0X H;  3D0F A;  3OSO A;  3F2C A;  1ROD A;  4A3G B;  4R9W A;  4IO9 A;  2NTT A;  2Z6B A;  1W2B A;  1JJC B;  1IXR A;  1W6J A;  1N9W A;  1XX8 A;  4P2C B;  1KXL A;  1IBK L;  1TVX A;  4X65 L;  1VQP A;  4L63 B;  1JB7 A;  3X3N A;  3HOZ H;  1VQO A;  1L0Y B;  2B2T A;  5M5W H;  1HFN A;  2VW9 A;  3VR2 A;  3TZD A;  4A3J G;  3MXN B;  3M3Y H;  3TN2 A;  4DXG A;  1TWC B;  3PGZ A;  4A3L G;  3V2T A;  4O1N A;  3E5S A;  4KHP L;  2D9U A;  3KF6 A;  1L0W A;  3CU7 A;  4FXK C;  2B29 A;  1IBL L;  1FJG L;  2BH8 A;  1CHP D;  1TWF B;  1SE3 A;  1FNU A;  4OIK A;  5KRU A;  4LF6 Q;  4RGO S;  1MD2 D;  3DM1 A;  2UUC Q;  1F2M A;  2K05 A;  4PV1 C;  3UDI A;  4O2D A;  1PRT C;  2DJG C;  3W5O A;  3OMC A;  1S5D D;  4ZLT F;  1SJE D;  2X6G A;  5IYB G;  3D4W A;  1IHZ A;  5T1G A;  5IP7 H;  3K5O A;  3P7J A;  5C6A A;  3NPP A;  1PRT B;  3NUC A;  4YHH L;  1XTC D;  1XPR A;  2E5L L;  4EQ5 A;  5M5W B;  2F1M A;  4C3I B;  1TS4 A;  4N9T A;  3M3Y B;  2IWH A;  1C8C A;  3DWQ A;  1VQ4 A;  5IIF A;  2HHH L;  1A2T A;  3TZU A;  1O80 A;  1KRT A;  2F0T A;  3I4N B;  4RWS C;  1IZ6 A;  1SE4 A;  5TSS A;  1Q86 C;  1DON A;  3CCU A;  1LT4 D;  4JI0 L;  1HNW L;  5EJW A;  5IP9 H;  3SXH A;  4L5Q A;  1O7I A;  3TEH B;  3OHX C;  1B1Z A;  4ZAI A;  1JOR A;  4J8Q A;  4DUY L;  1PLF A;  3GTQ H;  4OL7 A;  4AH6 A;  3SK5 A;  1LT3 D;  2KQ3 A;  2AQ1 B;  3G4S A;  4O0A A;  1X65 A;  5E1F A;  1H9K A;  4HSP A;  2WFW A;  2IY5 B;  1AH9 A;  2KHS A;  1ONL A;  1Q81 C;  3NWT A;  3GTJ H;  1CHQ D;  1UUP A;  5CV4 A;  3LGJ A;  3A55 A;  2PQE A;  2TSS A;  3BVZ A;  2R7Z B;  1R9T H;  4C1N I;  4XT1 B;  2L0C A;  1HNZ Q;  1RTO A;  4JV5 Q;  1EY7 A;  3I4N H;  1M4V A;  3BDC A;  3PV0 A;  5ELN A;  1STY A;  4FXD A;  1X3E A;  4LUV A;  2QGQ A;  5AJ3 Q;  2JA5 G;  4IFD G;  4A3E G;  1B4O A;  1V8Q A;  4X3S A;  1KLG D;  4C2M B;  4LF5 Q;  2VL6 A;  2CW0 D;  5T1I A;  4GOP B;  1MSH A;  3S14 H;  2E74 C;  1XJV A;  1LUZ A;  4IPD A;  1J5E L;  1TU2 B;  1VMP A;  4R4Q A;  4YCV A;  1LTR D;  4FXG C;  1JWU D;  3S16 B;  4ILW A;  3GTJ B;  3HZX A;  4IUU A;  3D31 A;  4LMQ D;  3A7L A;  3EBE A;  5DM6 3;  1GOZ A;  2PMZ E;  5J3B A;  4AYB E;  3P1H A;  3L2P A;  2DUD A;  1SLJ A;  4IUQ A;  1HCZ A;  1K9M C;  1BKB A;  2B8G A;  3QR8 A;  2O5I C;  4A3F G;  4JBJ A;  1JWM D;  2I07 B;  3KDF B;  1KD1 C;  1AZQ A;  4GN4 B;  1PTO B;  2KA7 A;  4QUC A;  3KLR A;  5C5L A;  2ES2 A;  3OWE B;  4DV1 Q;  2SOB A;  4LF8 Q;  1VDZ A;  1L1O C;  4KKT A;  3CCJ A;  2EYH A;  3R8B A;  3S1M H;  1WYD A;  4DV0 L;  1JR0 D;  3FRP B;  4DR3 L;  3U9O A;  3J7A F;  5FO9 B;  1G2S A;  1EZ6 A;  3RNU A;  4P71 A;  4KY6 A;  4FO2 A;  1ESR A;  4C3J H;  3FKI G;  1FVI A;  2VXW A;  4LFC Q;  2C5C A;  4JI7 Q;  2RDG A;  4B08 A;  2YV5 A;  3J80 E;  4OO1 H;  5KGU A;  1SEB D;  1JWS D;  4BY7 B;  4BA1 I;  3EN2 A;  3MHB A;  2EYJ A;  4DV5 L;  1YEZ A;  4EQP A;  1U5K A;  3D6C A;  1HZC A;  2MUY A;  3HOX B;  4NXM L;  4DR1 L;  1PZJ D;  3UDF A;  1SNC A;  4CJ0 B;  4IN3 A;  2JA6 B;  3QJY A;  2NVX B;  2FHT A;  2B2W C;  1JCK B;  5FJ8 G;  5M5X B;  1SNM A;  4UP8 A;  3CQZ B;  4H13 C;  1LTL A;  4DV3 L;  1EY8 A;  3J81 E;  4UP7 A;  3GO5 A;  2KVM A;  5JEA H;  4HMI A;  4LF9 L;  4JI2 Q;  4BBR G;  2VUM H;  4K2K A;  1D1I A;  1X54 A;  1HQR D;  3K0X A;  2RDF A;  4X6A H;  2LXK A;  3OPO A;  4L6T B;  4R8I A;  3RLO A;  3ULJ A;  1KNA A;  2B2Y C;  3VYU A;  4RHS A;  1HR0 W;  3MC0 B;  4ZQ3 A;  4K6D A;  3MZ5 A;  1EWI A;  2ID0 A;  5IT9 c;  2R92 G;  5EAY A;  5IYD H;  3JAM L;  1A2U A;  1EWC A;  2K5V A;  3TP8 A;  3IRB A;  1DOM A;  3ND8 A;  2WAQ G;  1GJX A;  5F2D A;  4ME5 A;  4CGY B;  4DF7 A;  1A8V A;  1LLR D;  2CWP A;  1DZ1 A;  2EJM A;  1NNX A;  4DAY A;  3OW2 A;  1PVO A;  3FVQ A;  1YIJ A;  3GTG H;  3G48 A;  4H0L C;  2NUC A;  2K33 A;  4C3H H;  5M3M H;  3I56 A;  1VQC A;  2H4O A;  2E5L Q;  4LF7 Q;  4JI6 Q;  3RLN A;  1N33 Q;  4TQU S;  2ATW A;  1VQA A;  3RZO H;  3D4D A;  1Z9F A;  1PH6 A;  3KLS X;  1EY6 A;  4JI4 L;  1XNQ Q;  1KIX A;  4CHT B;  4BS9 A;  2EY6 A;  1IYV A;  4FF1 A;  2ZJQ A;  3RZD B;  4RHR A;  1B9M A;  2L12 A;  1YIT A;  5I9O A;  3MEF A;  1NMF A;  4KK7 A;  4DNR B;  1K3B C;  2EXZ A;  1TY0 A;  3I4M H;  1SRO A;  3K8A A;  3Q24 A;  1EU3 A;  5ELE A;  3NBH A;  5LMN L;  2EY5 A;  2F0L A;  2F4V Q;  4A4I A;  4X66 L;  2F0H A;  1U4L A;  1ZXT A;  5M5Y B;  1V9P A;  4HJ7 A;  2KHJ A;  3AFQ A;  3P20 A;  1N32 Q;  3ULP A;  1QZH A;  5EPL A;  3PSI A;  2DNC A;  2XRS D;  3F1Z A;  4A3G H;  3GTM H;  5COY A;  4DK1 A;  3RZO B;  2JSO A;  1GUN A;  2LKV A;  2PW7 A;  4GN3 B;  4HJA A;  4KN4 C;  1BXT A;  3M4O H;  3DWA A;  1ESF A;  4IUP A;  2A8V A;  4DV4 Q;  1STB A;  2B2Y A;  1VF7 A;  2MP1 A;  4DPG A;  2NYZ D;  4DR5 Q;  4ZUJ A;  3V96 A;  1HPC A;  3HOW G;  1K8M A;  5FLX c;  4MIU A;  5AJ3 L;  1BBW A;  4X3U A;  4IOC A;  3PO3 B;  4K8J A;  2UUB Q;  1RTN A;  2MJ8 A;  3GTK B;  5HY6 A;  1HFG A;  3R2T A;  1Y1V G;  4Y52 H;  2R7D A;  1I4P A;  1KDB A;  2R61 A;  1A3U A;  2CKZ B;  1Z47 A;  1EYG A;  1S5E D;  2Z4I A;  2X69 A;  3ZJY C;  4H02 A;  4UHV A;  4ODG A;  4F88 A;  4LWC A;  1IBM L;  1RD9 D;  3AYH B;  5EBD A;  2A6H D;  4CDD C;  4DK0 A;  2ASB A;  1G29 1;  4J1M A;  4BA2 I;  2PQA B;  4LF4 L;  4JYA L;  2B2U C;  1SYC A;  2KCT A;  4GLV B;  2AUJ D;  1XPU A;  4ABN A;  3AEV A;  1CZW A;  2BDO A;  1E24 A;  4A3K H;  4GNX C;  2BE5 D;  5FO7 B;  5FO8 B;  1I4R A;  3NTI A;  4IFD J;  5FLX E;  3KF6 B;  2E75 C;  5FLM H;  2TMP A;  4B3M L;  5KNB A;  2XRQ D;  1EIF A;  1NTG A;  2O4X A;  4DA2 A;  4DR2 Q;  2HDL A;  4IFD H;  4DU9 A;  2Q2T A;  1AE2 A;  2J7Z A;  3F2D A;  3HOY B;  5IT9 L;  2UXC L;  1Y69 U;  2GVA A;  3CAM A;  1MBY A;  2K5H A;  2AHO B;  3QB3 A;  3J7A 5;  2Q8T A;  2K4K A;  3K5N A;  4F87 A;  4DV7 Q;  4CBV A;  4FF3 A;  4KV6 A;  1SMX A;  2I5L X;  2PI2 A;  1CSQ A;  4PQX A;  4NXM Q;  4DR1 Q;  1VQ9 A;  1GKH A;  1TS5 A;  1Q7Y C;  1C7Y A;  2LFN A;  1MIU A;  5DEH A;  3OTO Q;  4JBM A;  1EY5 A;  1K8O A;  1GUO A;  2SNM A;  3I2Z A;  4GN5 A;  1JJ2 A;  4DV3 Q;  4G7O C;  4A3I G;  3J81 L;  2N78 A;  3BYT B;  4DFA A;  4CDC C;  4K0K Q;  5FK9 C;  1AE3 A;  3KLW A;  4DV2 Q;  1F2Z A;  3NP8 A;  1CQF A;  1M8A A;  4JI2 L;  1OTC A;  1ET9 A;  2F0P A;  2ZXP A;  4POF A;  2HDM A;  3A5U A;  1N36 L;  4YY3 L;  5L37 A;  1CM9 A;  3K81 C;  3RD4 A;  4OX9 L;  5M9O A;  1EYD A;  2K14 A;  5IP9 G;  3KUP A;  5C3E G;  2HD3 A;  1LO5 D;  1I6V C;  3W1G A;  2YYZ A;  4DGZ A;  1QB5 D;  1YVC A;  3K6O A;  1LAC A;  1LT5 D;  3M4Y A;  1QVF A;  1NAP A;  3T13 A;  1I3Q H;  1PV4 A;  1N34 L;  2HT1 A;  2NVQ B;  3TME A;  4OGQ C;  2F0W A;  5CV5 A;  4P74 A;  1P8L A;  1SYD A;  1N8R C;  2VZA A;  1F2L A;  3DUZ A;  4TVA B;  4A3I B;  4YCU A;  2K52 A;  4K6L A;  4A76 A;  2K5N A;  3WWV A;  4HCS A;  4IPH A;  4MN3 A;  4QF4 A;  3HOV H;  3VR3 A;  4WRD A;  4LF7 L;  2UUA Q;  3VA7 A;  1N33 L;  1I4Q A;  5CR3 A;  1A62 A;  3I8Z A;  2Z6K C;  4QL5 A;  4XTC S;  4CKE A;  3KYH C;  3NTH A;  1XMO Q;  1DOL A;  2EXD A;  3S17 H;  1E3P A;  2NB0 A;  2F0E A;  3NBI A;  2KEC A;  2O2L D;  1HTL D;  1A3T A;  3FMC A;  4WJW A;  4QY7 A;  1HR0 Q;  2K32 A;  2NZH A;  1Q8K A;  2VY3 A;  4X66 Q;  2OTL A;  4OO1 G;  2JA6 G;  3HOZ G;  5C0X I;  1WCM H;  3K7A H;  1NBW A;  1WTH A;  1N32 L;  1JOO A;  2Q8I B;  3TBI B;  1DOK A;  2FJ2 A;  5DM7 3;  2JA6 H;  2Y0S B;  3NTK A;  4L5S A;  2MFI A;  2JA9 A;  4J6H A;  2K5W A;  1I4X A;  4JI5 L;  2Y0S E;  4LJZ C;  2BA0 A;  1Y8N B;  1IYU A;  4DV4 L;  1T9H A;  1PFM A;  3CC4 A;  3K80 C;  3K0Y A;  5E4W C;  2K75 A;  2PNR C;  1V43 A;  5IGB A;  2GVB A;  4B3R Q;  1IKM A;  1S4Z A;  3FDT A;  4K5V A;  1UEA B;  3GQB A;  5C3E B;  1EIG A;  4ZKB B;  4BXX G;  2UUB L;  3BVM A;  4AQY Q;  1KDC A;  4X65 Q;  3VYS A;  5EKI A;  1GUW A;  4IPG A;  4EX5 A;  2NVY B;  4RAU C;  1IL8 A;  5A35 A;  5IYB H;  3RUZ A;  2SDF A;  5E3F A;  1XMQ L;  2L5T A;  1Y14 B;  4A3B H;  1CKM A;  1FYC A;  3VR4 A;  2EQS A;  1C4Q A;  4CDF C;  3PIP 3;  3BDL A;  1IBM Q;  4DN4 M;  4UDU C;  5BR8 Q;  3GTP B;  2NVT B;  4LFB L;  4A3E H;  4QQB X;  1YJ9 A;  1IBL Q;  4POG A;  4LF4 Q;  1Y1W G;  4JYA Q;  2BA1 A;  1HUN A;  2QDL A;  4DAM A;  1VQD A;  1PHJ A;  1ZKO A;  4K2L A;  4LNQ A;  2A69 D;  3JAM E;  3T1Y Q;  3PUV A;  4F7X A;  2RVL A;  1HUM A;  2YU9 H;  5C3E H;  2JA8 G;  4JW0 A;  1SAP A;  5CV6 A;  4A3J H;  4C3I G;  1Y1W B;  1HHV A;  1C9O A;  2NVY H;  1K0R A;  4K8I A;  5C3X A;  3MA2 B;  2AUK A;  1STG A;  4A3M B;  5KYI A;  2JA8 H;  3A0J A;  4YHH Q;  1QJO A;  4HIK A;  3NK9 A;  1LTS D;  3J81 j;  1PYS B;  2R92 H;  1K8A C;  2OTJ A;  1I94 L;  3F2B A;  1TWH H;  3CW2 C;  1L1O A;  2HHH Q;  4ALP A;  1RL2 A;  2M00 A;  1PZI D;  1WOC A;  1PMR A;  2WIN B;  2KCM A;  3KK7 A;  3EIV A;  4JI3 Q;  4PG3 A;  4KD3 A;  3CMA A;  1RDP D;  2B3G A;  2F0I A;  1EY4 A;  1L1O B;  4P75 A;  2AWN A;  1B8A A;  2D0P A;  5KEE A;  3WOF A;  1STN A;  2WII B;  2Z1C A;  2Z6K A;  3SK8 A;  4RMF A;  2QCP X;  3BS1 A;  2RA4 A;  3M4O B;  4BY7 G;  4K0K L;  4FDB A;  5IT9 E;  2NZO A;  3CME A;  2WAQ B;  1Q1B A;  1ICW A;  4LUZ A;  3CKI B;  3X3M A;  4BXX H;  4A3M H;  3A7A B;  1SE2 A;  2I0Q A;  5JJI A;  4RH6 A;  1UNS A;  1TWA B;  4OXP A;  3H15 A;  4HAE A;  4G57 A;  4YY3 Q;  1N36 Q;  4OX9 Q;  3NWS A;  2R92 B;  2ZM6 Q;  2AQ2 B;  1O7L A;  2B63 H;  2R7F A;  4MHE A;  1W3S A;  4K14 A;  1LYL A;  3GTK H;  2IX0 A;  2E2I H;  3CCE A;  1QIL A;  3T53 B;  3D6W A;  2RCN A;  3J80 i;  3C46 A;  1SYB A;  2EIF A;  2GA4 B;  1EQV A;  4HED A;  4MZ9 A;  4PZ8 A;  4C56 C;  1ASZ A;  1EFI D;  4IFD I;  2MNA A;  1PXU A;  3CP0 A;  3FHW A;  2KCC A;  2QDB A;  1OXS C;  4I65 A;  2HQE A;  3I73 A;  2F0V A;  3PO2 B;  1A63 A;  3KFU A;  1PH9 A;  1QUQ A;  1UE1 A;  5KND A;  1B3Q A;  1CZG A;  2DGY A;  4FF2 A;  3CCM A;  4WJ3 M;  1PH2 A;  2JN4 A;  1HNX Q;  1TII D;  2AQ3 B;  4QIW B;  3HOU G;  2VQE L;  3OOC A;  4HN7 A;  3TS0 A;  1PFN A;  3AMU A;  1EQQ A;  2YTX A;  1D5M C;  4FNF A;  1SNO A;  5FKA C;  3OW7 A;  4RFB A;  3HP3 A;  4JBW A;  5EPJ A;  1XWE A;  1SR3 A;  1CUK A;  1SMY D;  2KED A;  1YNJ D;  3VR6 A;  4MTN A;  4Z9C B;  1LT6 D;  3MXP A;  4XT3 B;  1TKW B;  1BCP F;  1FGB D;  1CKO A;  4WOR A;  3HOZ B;  2ZTD A;  4DR3 Q;  4A3G G;  1DGS A;  1ILP A;  2CVR A;  1AZP A;  4CKB A;  1KC8 C;  3A54 A;  1X6O A;  3TSS A;  3UDX A;  2Q2I A;  5CV8 A;  3U9S A;  3PO2 H;  1K83 B;  5ELF A;  2PQA A;  4IOA A;  1TWC H;  2QEX A;  3HRZ C;  3T4A C;  2RHQ B;  1G6Z A;  4JC0 A;  1YBY A;  3HKZ G;  1TWG H;  2XNA C;  1EFW A;  5C4J B;  4G7Z C;  2WP8 J;  1VQ7 A;  2OT2 A;  1S5F D;  2K04 A;  1XYI A;  2JA5 H;  3NXW A;  1FNV A;  4FYD A;  1JB3 A;  4JI8 Q;  5GRO A;  5C4X H;  4IUV A;  5IGE A;  2HUG A;  3SVM A;  1YHA A;  4AQY L;  1FL0 A;  1CKN A;  1Q3L A;  2P5Z X;  3MFY A;  1D5X C;  1PYB A;  1I5F A;  5COR A;  1PFS A;  1JQY D;  3TDQ A;  1MI2 A;  1JMC A;  1SSO A;  1GUG A;  4LF9 Q;  1XXG A;  4KD4 A;  1GXD C;  4RGN A;  3H94 A;  4RGT A;  3A56 A;  5M3F B;  4KJO A;  3E0J A;  2NVQ H;  1AN8 A;  1LTA D;  5HUR A;  2XVS A;  1WVL A;  3A74 A;  3PUW A;  2YTV A;  5BR8 L;  2N55 A;  1WTV A;  1SMY C;  3ERO A;  1TWG B;  5IYD G;  1XNR Q;  3NHH A;  5C4J H;  4HIO A;  3J7A V;  2O5J C;  1D1K A;  4DAY B;  2AWO A;  2I46 A;  1EYA A;  1Q82 C;  3S1N H;  5IP7 G;  1CA5 A;  4YCW A;  1WTP A;  3LWU A;  3S1Q H;  3FKI B;  3WDN A;  4JI6 L;  1KL9 A;  1QCB D;  1JC7 A;  5M3F H;  3STB C;  5CBE E;  5D3I B;  2LY7 A;  4JI4 Q;  1XNQ L;  2HIV A;  5JJZ A;  1R4P B;  1OXV A;  3JAM c;  1WCM B;  3K7A B;  1VQG A;  1SYF A;  4GNX B;  1RF2 D;  4A3K G;  2OQK A;  2BOS A;  5LMN Q;  1D8L A;  4HCE A;  2F4V L;  4C2M H;  2Z0S A;  2PYK A;  1Q12 A;  3H3V I;  4A3D B;  5BN3 A;  5IOD A;  1A6X A;  3S14 B;  3OIP A;  4A3C H;  3ER0 A;  4DAV A;  1PH1 A;  2AKW B;  1NR4 A;  4IJL A;  2F4I A;  3QOJ A;  5I9P A;  5CBA E;  1YJW A;  3SR1 A;  5DNF A;  3UI2 A;  3Q22 A;  1CI3 M;  3DXJ C;  1PH3 A;  1E0B A;  3P75 A;  4Q5V A;  4ZYS A;  2QA4 A;  1PDQ A;  3A8I E;  3FPP A;  4QIW E;  2D2C C;  2KUM A;  5EKL A;  1VQ6 A;  4LFA Q;  2RBM A;  4DUZ Q;  1JE5 A;  2QKI C;  3PIP A;  4DK3 C;  4NB3 A;  4DR6 L;  2UXB L;  4ME3 A;  3S1M B;  1BOS A;  1SJH D;  3GTQ B;  1SFO H;  4A3D H;  3D3R A;  1ENA A;  1M90 C;  1I50 B;  2GN5 A;  2LSS A;  1B53 A;  3IKJ A;  2KJX A;  1BO0 A;  2XN9 C;  3HGB A;  2A6H C;  5BN5 A;  5EBC A;  3NEM A;  1HNX L;  1VQ8 A;  2JE6 I;  4BY7 H;  2IL8 A;  2F0F A;  3J81 i;  1KQS A;  5KIX A;  2WAQ E;  2H5X A;  4IPC A;  1DM0 B;  5LMU L;  3H0G H;  5IWA L;  3HOV G;  5BN4 A;  4UY8 C;  4S3S A;  3DEO A;  4CJ1 B;  1CT1 D;  1VQH A;  3I4N G;  1GHK A;  4HJ9 A;  2EPB A;  1IKL A;  1PH4 A;  5JAV A;  3M9B A;  3UDG A;  4DR4 Q;  1VQF A;  1JE4 A;  1PH8 A;  1HA5 A;  1SE8 A;  3R2I A;  4DK6 C;  1Z7T A;  1PFB A;  1HQM C;  3GP7 A;  4DR2 L;  2XGT A; 
#chains in the Genus database with same CATH homology
 4V0B A;  2K28 A;  1WTO A;  1F9Q A;  1OXU A;  2EVB A;  2NBF A;  1YNN C;  1Q8I A;  3LWE A;  1TT2 A;  4ULL A;  2NWG A;  5LL6 S;  3DMU A;  3DHQ A;  1RHP A;  1U4R A;  3SEB A;  1LTG D;  3BDO A;  3MWY W;  5JEA J;  2B63 B;  3D4R A;  1ZEQ X;  1EY9 A;  4KI0 A;  4U67 3;  1T5E A;  2SEB D;  5CC4 A;  5G3L D;  1KDA A;  2A68 D;  4C3J B;  2C9O A;  5FLX L;  3R93 A;  1PTO D;  3ITP A;  1EZ8 A;  1B9N A;  3QWN A;  3TP6 A;  1WTQ A;  3H09 A;  3VYT A;  3PUX A;  2K5Q A;  4IUN A;  1Y1V B;  1E2W A;  1QE6 A;  4RCO A;  2VB3 X;  3NQT A;  1RKN A;  2B8F A;  3C1E A;  1STA A;  1BDO A;  3TP7 A;  4RKL A;  2F0O A;  3I72 A;  1FD7 D;  1CTM A;  5JVG 3;  1QNU A;  4I7Z C;  5FOB B;  5IGD A;  1WTR A;  3EVQ A;  1DJR D;  5J39 A;  4C1N K;  3A8K E;  1TR5 A;  2QF7 A;  1U9R A;  1U4M A;  1A3V A;  4DAP A;  4X3T A;  5D3D A;  2XIW A;  3K5L A;  2OF1 A;  3D8G A;  4ZKC B;  4E6I A;  4NDX A;  3BZD B;  4XYO A;  1T5X D;  2E2H B;  3URY A;  3LNN A;  1VF5 C;  3OIQ A;  1HXY D;  2CQA A;  1AW7 A;  2JXM B;  4M8A A;  4B9W A;  1PRT D;  1L0X B;  1ILQ A;  3N52 A;  1II3 A;  4OO1 I;  2IPK D;  4XYQ A;  1TS2 A;  3HEJ A;  4WFN 3;  4C3H B;  3SHL A;  2N88 A;  4XXE A;  1R4Q B;  2FMM A;  4QMG A;  3GD7 A;  3ND9 A;  1Q1E A;  1V1P B;  2FIN B;  5G3L F;  2B39 A;  1PTO F;  2E2D C;  4PMB A;  1NCV A;  2B2V C;  1LAB A;  3G7L A;  1B44 D;  3CHB D;  3I4M B;  1W6K A;  4RCN A;  3GTO B;  2F0Q A;  4FP5 D;  3L7Z C;  5ISR A;  1R9T B;  4XIG S;  1WTX A;  1FR3 A;  4A93 B;  4CKC A;  4Q0F A;  1O7Z A;  2B2W A;  4O42 A;  4Y7N B;  5KNC A;  4RGM A;  1G8Z D;  1SDF A;  1SYE A;  1G2T A;  4IUT A;  2QEJ C;  2F0U A;  3KLS A;  5C3W A;  5DAU A;  2DNE A;  5I6W A;  2D62 A;  2EJF C;  1A15 A;  5A2Q L;  3I91 A;  2Z4H A;  1EEI D;  4ID6 A;  4PNY A;  5I4D A;  2WAC A;  3K59 A;  1BCP B;  1RJT A;  3BG3 A;  4V19 0;  1X3Q A;  2A6E C;  3S1R B;  2FFK B;  5CV7 A;  2X6L A;  2L4N A;  4EVO A;  5CMD A;  2A5H A;  4X3K A;  1OXT A;  4QUF A;  3PMF A;  1BUV T;  3L3O C;  2KEE A;  1O7Y A;  1U4P A;  3ERQ A;  3K5M A;  3QOL A;  4XDX A;  2A74 C;  1SND A;  2F03 A;  2IX3 A;  3S2D B;  2WB1 B;  2PO4 A;  1LTT D;  1KLU D;  1KAA A;  4C3J G;  1DYQ A;  1SXT A;  4HSV A;  2EY1 A;  4G4K A;  4IUR A;  3OWF A;  4KJN A;  1STE A;  2DY7 A;  2F0G A;  2EYL A;  1ZYR C;  3E6Z X;  2NZ1 D;  2R3Z A;  2CHB D;  1BCP D;  2R6G A;  3Q23 A;  2BE5 C;  2NN6 G;  5K5P A;  2F3V A;  5IGG A;  2Z8L A;  1BQQ T;  5JPM C;  2L9H A;  3V05 A;  2ZXO A;  3EA6 A;  1JIC A;  3T51 B;  4LAA A;  3EQL C;  1KNE A;  2ENB A;  4KKU A;  4QB4 A;  5D14 A;  1MGS A;  2BDN A;  1QOH A;  4FVM A;  1GHJ A;  1V1O A;  1QG7 A;  4ZUI A;  5C4H A;  3AU7 A;  4G7H C;  2DY8 A;  4QCL A;  1D6E C;  3T56 B;  3ONA B;  1Z6H A;  3EFX D;  3GTG B;  1S5B D;  2EYP A;  1I3Q B;  2RSO A;  1H9S B;  5M3M B;  4U68 A;  1VCI A;  1V1P A;  3K58 A;  3H91 A;  3J7Y W;  3G6J B;  2XWB B;  2IJ0 A;  3H3V C;  2FMC A;  5LL6 X;  2EYF A;  2RSN A;  1X32 A;  3KBX A;  4K5W A;  2MHV A;  1S5C D;  2F0K A;  2F0M A;  4ZK9 B;  2WV6 D;  3FEW X;  5E4X A;  2PPB C;  4A3E B;  1ML0 D;  1VMC A;  3WOE A;  3T16 A;  2A73 B;  2D5D A;  3RMH A;  4CJ2 C;  2ICI A;  2VUM B;  5C44 B;  5IGC A;  1PZK D;  2IT1 A;  2B2T C;  3DWP A;  3PUY A;  1F9S A;  1UAP A;  1CA6 A;  1EWH A;  4BY1 B;  1WTW A;  2LS0 1;  2ICE C;  1G91 A;  4GZY C;  4F8M A;  1ENC A;  3GV6 A;  1KAB A;  5JEA G;  3I70 A;  3SK6 A;  2IW3 A;  3QIA A;  2NTS A;  4TSS A;  2OEO A;  2DN8 A;  2K1B A;  1I4H A;  3RLF A;  3SK4 A;  3J80 L;  1FNW A;  4OHJ A;  2EE1 A;  5I2X A;  1NSN S;  3AB9 A;  4KHV A;  4NMZ A;  3IL8 A;  2MPM A;  3HS0 C;  2OXP A;  1HRJ A;  2ZT9 C;  5J1Z A;  5LHY 1;  3GTL B;  1DD2 A;  3MFG A;  4A3K B;  4FF4 A;  5ELC A;  1HA6 A;  2IX1 A;  3NQI A;  1EOT A;  3C1F A;  5C0X J;  1F2Y A;  2WKD A;  2G9H D;  3GV3 A;  5C4Z A;  3DEP A;  2ZXR A;  2EOT A;  5EKK A;  3GTM B;  1AEX A;  3KBG A;  3QO2 A;  3MEH A;  2HCI A;  1I6H B;  2EDG A;  5ELD A;  1GUS A;  3N6R A;  3C2P A;  2EJG C;  1BR9 A;  2JA8 B;  3W3A A;  3Q6S A;  4PMC A;  3CRK C;  3M7N A;  2J0T D;  2F0S A;  1WD1 A;  5ELB A;  1TQO A;  1H9J A;  1STH A;  4KY7 A;  1CQV A;  1NR2 A;  4BWG B;  1IW7 C;  1B3A A;  1J9O A;  2E76 C;  2KOL A;  1RCV D;  4KHZ A;  1SBB B;  4LK1 C;  2PCF B;  3LX0 A;  3PUZ A;  1SYG A;  2SNS A;  5I6Y A;  1JOQ A;  1NUC A;  1Y8O B;  4TRD A;  1OXX K;  1F77 A;  4NKL A;  1E2V A;  3HOV B;  2A6E D;  2JA5 B;  3VR5 A;  2Q8R E;  4R8N A;  5C4X B;  2K6A A;  1SNP A;  3S17 B;  3SE0 A;  4PMW A;  1F9P A;  1D2B A;  4TKO B;  3IAY A;  1PTO C;  4ZRZ A;  1EIH A;  1QNK A;  2PMZ B;  1LTB D;  2A68 C;  2M9V A;  5AFW A;  3A8J E;  3IFD A;  1JOK A;  3I90 A;  2JEB I;  1AP0 A;  1YNJ C;  2G9D A;  1WD0 A;  4KKS A;  1MSG A;  3S1N B;  2F0J A;  3SDZ A;  4K5X A;  4L8J A;  1D5Z C;  1EY0 A;  4DNT B;  3O13 A;  4BBR B;  4XQN A;  5I2Y A;  1B50 A;  3MXG A;  2F3W A;  2WKC A;  1Y8P B;  4KY5 A;  1LV9 A;  2K03 A;  2RQX A;  2H1E A;  5IOC A;  1BF4 A;  4JK1 C;  5CYU A;  2K7V A;  5EPK A;  5CGK A;  2BCO A;  1Q90 A;  4HTH A;  2V4D A;  5D65 A;  5C5M A;  3L9A X;  3QG1 A;  4HR7 B;  3M85 A;  4RKB A;  1EL0 A;  4H7B A;  3S2H B;  3H6M A;  4NP5 A;  1X3P A;  4H44 C;  1DXM A;  2EYO A;  2YU9 B;  2L11 A;  2J4X A;  1B2T A;  2L55 A;  3W2D A;  1KTK A;  4KTA A;  3ZYY X;  2VB2 X;  5EQ0 A;  2EY2 A;  1PRT F;  3S15 B;  1I4G A;  4RA8 A;  1E2Z A;  1SNQ A;  2JP1 A;  2VNU D;  4M1U B;  3R3O A;  3S1Q B;  4UAI A;  2EYM A;  2RKS A;  2NN6 H;  4C3H G;  1F9R A;  1CK1 A;  3KF8 A;  2L1B A;  3MVV A;  1C48 A;  2B2U A;  2MGS A;  2R93 B;  3H0G B;  5IGF A;  2PZT A;  3MXU A;  2KCN A;  1GUT A;  1PTO H;  3HKZ B;  4EGV A;  3IFT A;  2PZU A;  1BBX C;  4A3B B;  3I4L A;  2LMC B;  1ET6 A;  5J22 A;  2EZV A;  3VA5 A;  1YNN D;  4EQN A;  3NSW A;  3I3C A;  2JEA I;  3S9W A;  4KMU C;  2RDH A;  1OO9 B;  4A3J B;  4NW2 A;  3BYY B;  2HCC A;  1O78 A;  3OMG A;  4XQQ A;  2A69 C;  1ZYR D;  3NE5 B;  5CV9 A;  3K57 A;  2QIL A;  3HOU B;  4IZ8 A;  1BCP C;  3MXN A;  4DXF A;  5KYL A;  1TY2 A;  1TWH B;  1AFP A;  3C3L A;  3EJI A;  1SFO B;  3PIO 3;  1DCZ A;  1EYC A;  4XQJ A;  2E2J B;  3TP5 A;  1EU4 A;  1EQT A;  5A2Q E;  1BNZ A;  4N9P A;  2XWJ B;  3MAQ A;  2PW5 A;  2F0N A;  1H9R A;  2K01 A;  4YIJ A;  1J8I A;  4EQO A;  4OIJ A;  3BVG A;  4HMJ A;  2M2L A;  1LTI D;  2F0D A;  5C0X G;  2E2I B;  2JYO A;  2XSC A;  2CW0 C;  5JVH 3;  1ENF A;  4B9X A;  4KN7 C;  5JOB A;  1H9S A;  3F2U A;  2B2V A;  5EGT A;  1IW7 D;  1CFM A;  5K36 G;  5K36 H;  3MTS A;  3HG9 A;  4IQZ A;  3Q0A A;  1PYW D;  5NUC A;  2PZW A;  1EEF D;  3CRL C;  5JPN C;  2NN6 I;  4BBS B;  4A3F B;  4IAL A;  3M7G A;  4AYB B;  5HGT A;  1QWY A;  2JA7 B;  3HOW B;  2K5D A;  3VYR A;  1H9M A;  3FPU B;  1TS3 A;  1HTP A;  5C0X H;  3OSO A;  1ROD A;  4A3G B;  4R9W A;  2NTT A;  1W6J A;  1XX8 A;  4P2C B;  1TVX A;  4L63 B;  3X3N A;  1L0Y B;  2B2T A;  1HFN A;  3VR2 A;  3TZD A;  3TN2 A;  4DXG A;  1TWC B;  3V2T A;  4O1N A;  3E5S A;  2D9U A;  3CU7 A;  4FXK C;  1CHP D;  1TWF B;  1SE3 A;  1FNU A;  4OIK A;  5KRU A;  4RGO S;  1MD2 D;  3DM1 A;  1F2M A;  2K05 A;  4PV1 C;  1PRT C;  3OMC A;  1S5D D;  4ZLT F;  1SJE D;  2X6G A;  3D4W A;  1IHZ A;  5T1G A;  3K5O A;  3P7J A;  5C6A A;  3NPP A;  1PRT B;  3NUC A;  1XTC D;  5M5W B;  2F1M A;  4C3I B;  1TS4 A;  4N9T A;  3M3Y B;  2IWH A;  1C8C A;  3DWQ A;  5IIF A;  1A2T A;  3TZU A;  1O80 A;  2F0T A;  3I4N B;  4RWS C;  1SE4 A;  5TSS A;  1DON A;  1LT4 D;  5EJW A;  3SXH A;  3OHX C;  1B1Z A;  4ZAI A;  1JOR A;  4J8Q A;  1PLF A;  4OL7 A;  3SK5 A;  1LT3 D;  2KQ3 A;  2AQ1 B;  5E1F A;  1H9K A;  4HSP A;  2KHS A;  1ONL A;  3NWT A;  1CHQ D;  1UUP A;  3A55 A;  2PQE A;  2TSS A;  3BVZ A;  2R7Z B;  4C1N I;  4XT1 B;  2L0C A;  1RTO A;  1EY7 A;  1M4V A;  3BDC A;  3PV0 A;  1STY A;  4FXD A;  4IFD G;  1B4O A;  1V8Q A;  4X3S A;  1KLG D;  4C2M B;  2CW0 D;  5T1I A;  1MSH A;  2E74 C;  1TU2 B;  1VMP A;  1LTR D;  4FXG C;  1JWU D;  3S16 B;  4ILW A;  3GTJ B;  3HZX A;  4IUU A;  3D31 A;  4LMQ D;  3A7L A;  5DM6 3;  1GOZ A;  3P1H A;  4IUQ A;  1HCZ A;  2B8G A;  2O5I C;  1JWM D;  2I07 B;  1AZQ A;  1PTO B;  2KA7 A;  4QUC A;  3KLR A;  5C5L A;  3OWE B;  2SOB A;  1VDZ A;  4KKT A;  2EYH A;  3R8B A;  1JR0 D;  3FRP B;  3U9O A;  3J7A F;  5FO9 B;  1G2S A;  1EZ6 A;  4KY6 A;  4FO2 A;  1ESR A;  2VXW A;  2C5C A;  2RDG A;  4B08 A;  3J80 E;  4OO1 H;  5KGU A;  1SEB D;  1JWS D;  4BY7 B;  4BA1 I;  3MHB A;  2EYJ A;  4EQP A;  3D6C A;  2MUY A;  3HOX B;  1PZJ D;  1SNC A;  4CJ0 B;  4IN3 A;  2JA6 B;  3QJY A;  2NVX B;  2FHT A;  2B2W C;  1JCK B;  5M5X B;  1SNM A;  3CQZ B;  4H13 C;  1EY8 A;  3J81 E;  3GO5 A;  2KVM A;  5JEA H;  4HMI A;  4K2K A;  1D1I A;  1HQR D;  2RDF A;  3OPO A;  4L6T B;  4R8I A;  1KNA A;  2B2Y C;  3VYU A;  4RHS A;  3MC0 B;  4ZQ3 A;  4K6D A;  3MZ5 A;  2ID0 A;  3JAM L;  1A2U A;  1EWC A;  3TP8 A;  1DOM A;  3ND8 A;  1GJX A;  5F2D A;  4ME5 A;  4CGY B;  4DF7 A;  1LLR D;  1DZ1 A;  2EJM A;  4DAY A;  3FVQ A;  4H0L C;  2NUC A;  2K33 A;  2H4O A;  4TQU S;  3D4D A;  3KLS X;  1EY6 A;  4CHT B;  4BS9 A;  2EY6 A;  1IYV A;  4FF1 A;  3RZD B;  4RHR A;  1B9M A;  2L12 A;  5I9O A;  4KK7 A;  4DNR B;  2EXZ A;  1TY0 A;  3Q24 A;  1EU3 A;  5ELE A;  3NBH A;  2EY5 A;  2F0L A;  2F0H A;  1U4L A;  1ZXT A;  5M5Y B;  3P20 A;  5EPL A;  2DNC A;  2XRS D;  5COY A;  4DK1 A;  3RZO B;  2JSO A;  1GUN A;  2LKV A;  2PW7 A;  4KN4 C;  1BXT A;  3DWA A;  1ESF A;  4IUP A;  1STB A;  2B2Y A;  1VF7 A;  2MP1 A;  2NYZ D;  4ZUJ A;  3V96 A;  1HPC A;  1K8M A;  4MIU A;  4X3U A;  3PO3 B;  4K8J A;  1RTN A;  2MJ8 A;  3GTK B;  1HFG A;  3R2T A;  1I4P A;  1KDB A;  2R61 A;  1A3U A;  1Z47 A;  1S5E D;  2Z4I A;  2X69 A;  4ODG A;  4F88 A;  1RD9 D;  5EBD A;  2A6H D;  4DK0 A;  1G29 1;  4J1M A;  4BA2 I;  2B2U C;  1SYC A;  2AUJ D;  4ABN A;  1CZW A;  2BDO A;  2BE5 D;  5FO7 B;  5FO8 B;  1I4R A;  3NTI A;  4IFD J;  5FLX E;  2E75 C;  2TMP A;  5KNB A;  2XRQ D;  2O4X A;  4DA2 A;  2HDL A;  4IFD H;  4DU9 A;  2J7Z A;  3HOY B;  5IT9 L;  1Y69 U;  1MBY A;  3QB3 A;  2Q8T A;  3K5N A;  4F87 A;  4CBV A;  4FF3 A;  4KV6 A;  4PQX A;  1TS5 A;  2LFN A;  5DEH A;  1EY5 A;  1K8O A;  1GUO A;  2SNM A;  4G7O C;  3J81 L;  3BYT B;  4DFA A;  5FK9 C;  1F2Z A;  3NP8 A;  1CQF A;  1M8A A;  1ET9 A;  2F0P A;  2ZXP A;  2HDM A;  1CM9 A;  3RD4 A;  5M9O A;  1EYD A;  3KUP A;  1LO5 D;  1I6V C;  2YYZ A;  4DGZ A;  1QB5 D;  3K6O A;  1LAC A;  1LT5 D;  3M4Y A;  1NAP A;  3T13 A;  2NVQ B;  3TME A;  4OGQ C;  2F0W A;  5CV5 A;  1SYD A;  1F2L A;  3DUZ A;  4A3I B;  4K6L A;  4HCS A;  4MN3 A;  4QF4 A;  3VR3 A;  4WRD A;  3VA7 A;  1I4Q A;  5CR3 A;  3I8Z A;  4XTC S;  4CKE A;  3NTH A;  1DOL A;  2NB0 A;  2F0E A;  3NBI A;  2KEC A;  2O2L D;  1HTL D;  1A3T A;  3FMC A;  4WJW A;  2K32 A;  4OO1 G;  5C0X I;  1JOO A;  2Q8I B;  3TBI B;  1DOK A;  2FJ2 A;  5DM7 3;  2Y0S B;  3NTK A;  4J6H A;  2K5W A;  1I4X A;  4LJZ C;  2BA0 A;  1Y8N B;  1IYU A;  1PFM A;  3K0Y A;  5E4W C;  2PNR C;  1V43 A;  5IGB A;  1IKM A;  1S4Z A;  3FDT A;  4K5V A;  1UEA B;  3GQB A;  5C3E B;  1EIG A;  4ZKB B;  3BVM A;  1KDC A;  3VYS A;  5EKI A;  1GUW A;  2NVY B;  4RAU C;  1IL8 A;  5A35 A;  3RUZ A;  2SDF A;  5E3F A;  2L5T A;  1FYC A;  3VR4 A;  1C4Q A;  3PIP 3;  3BDL A;  4DN4 M;  4UDU C;  3GTP B;  2NVT B;  2BA1 A;  1HUN A;  1ZKO A;  4K2L A;  2A69 D;  3JAM E;  3PUV A;  4F7X A;  2RVL A;  1HUM A;  1SAP A;  5CV6 A;  4C3I G;  1Y1W B;  1HHV A;  4K8I A;  5C3X A;  3MA2 B;  2AUK A;  1STG A;  4A3M B;  5KYI A;  1QJO A;  3NK9 A;  1LTS D;  2M00 A;  1PZI D;  1PMR A;  2WIN B;  3KK7 A;  4KD3 A;  1RDP D;  2F0I A;  1EY4 A;  2AWN A;  5KEE A;  3WOF A;  1STN A;  2WII B;  2Z1C A;  3SK8 A;  2QCP X;  3BS1 A;  2RA4 A;  3M4O B;  5IT9 E;  2WAQ B;  1Q1B A;  1ICW A;  3CKI B;  3X3M A;  3A7A B;  1SE2 A;  4RH6 A;  1UNS A;  1TWA B;  4HAE A;  4G57 A;  3NWS A;  2R92 B;  2AQ2 B;  1O7L A;  4MHE A;  4K14 A;  2IX0 A;  1QIL A;  3T53 B;  3D6W A;  3C46 A;  1SYB A;  2GA4 B;  1EQV A;  4HED A;  4C56 C;  1EFI D;  4IFD I;  1PXU A;  2KCC A;  2QDB A;  1OXS C;  4I65 A;  2HQE A;  3I73 A;  2F0V A;  3PO2 B;  5KND A;  1CZG A;  4FF2 A;  1TII D;  2AQ3 B;  4QIW B;  3OOC A;  4HN7 A;  1PFN A;  3AMU A;  4FNF A;  1D5M C;  1SNO A;  5FKA C;  3OW7 A;  4RFB A;  3HP3 A;  4JBW A;  5EPJ A;  1XWE A;  2KED A;  1SMY D;  1YNJ D;  3VR6 A;  4Z9C B;  1LT6 D;  3MXP A;  4XT3 B;  1TKW B;  1BCP F;  1FGB D;  4WOR A;  3HOZ B;  1ILP A;  2CVR A;  1AZP A;  4CKB A;  3A54 A;  3TSS A;  5CV8 A;  3U9S A;  1K83 B;  5ELF A;  3HRZ C;  3T4A C;  1G6Z A;  2XNA C;  5C4J B;  4G7Z C;  2WP8 J;  2OT2 A;  1S5F D;  2K04 A;  1XYI A;  3NXW A;  1FNV A;  4FYD A;  1JB3 A;  4IUV A;  5IGE A;  2HUG A;  3SVM A;  1Q3L A;  3MFY A;  1D5X C;  5COR A;  3TDQ A;  1JQY D;  1MI2 A;  1SSO A;  1GUG A;  1XXG A;  4KD4 A;  1GXD C;  4RGN A;  3H94 A;  4RGT A;  3A56 A;  5M3F B;  4KJO A;  3E0J A;  1AN8 A;  1LTA D;  5HUR A;  2XVS A;  1WVL A;  3PUW A;  2N55 A;  1WTV A;  1SMY C;  3ERO A;  1TWG B;  3NHH A;  3J7A V;  2O5J C;  1D1K A;  2AWO A;  2I46 A;  1EYA A;  1CA5 A;  1WTP A;  3LWU A;  3FKI B;  3WDN A;  1QCB D;  1JC7 A;  5CBE E;  5D3I B;  2LY7 A;  5JJZ A;  1R4P B;  1OXV A;  1WCM B;  3K7A B;  1SYF A;  1RF2 D;  2BOS A;  4HCE A;  2PYK A;  1Q12 A;  4A3D B;  5BN3 A;  5IOD A;  1A6X A;  3S14 B;  3OIP A;  4DAV A;  1NR4 A;  2F4I A;  3QOJ A;  5I9P A;  5CBA E;  3SR1 A;  5DNF A;  3UI2 A;  3Q22 A;  1CI3 M;  3DXJ C;  1E0B A;  3P75 A;  4Q5V A;  4ZYS A;  1PDQ A;  3A8I E;  3FPP A;  2D2C C;  2KUM A;  5EKL A;  2RBM A;  2QKI C;  3S1M B;  1BOS A;  3GTQ B;  1SJH D;  3D3R A;  1ENA A;  1I50 B;  3IKJ A;  1B53 A;  2KJX A;  1BO0 A;  2XN9 C;  3HGB A;  2A6H C;  5BN5 A;  5EBC A;  2JE6 I;  2IL8 A;  2F0F A;  5KIX A;  1DM0 B;  5BN4 A;  4S3S A;  3DEO A;  4CJ1 B;  1CT1 D;  1GHK A;  2EPB A;  1IKL A;  5JAV A;  1JE4 A;  1HA5 A;  3R2I A;  1Z7T A;  1PFB A;  1HQM C;  3GP7 A;  5CV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...