1FYEA

Aspartyl dipeptidase (anisotropic b-factor refinement)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
220
Chain Sequence
MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNTREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTYL DIPEPTIDASE
publication title The structure of aspartyl dipeptidase reveals a unique fold with a Ser-His-Glu catalytic triad.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 73
structure length 220
sequence length 229
ec nomenclature ec 3.4.13.21: Dipeptidase E.
pdb deposition date 2000-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03575 Peptidase_S51 Peptidase family S51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fyeA00
5DFAA 3BHNA 4ZDKA 1OY1A 2NV0A 1GGFA 3R75A 3L7NA 3B3AA 4B7AA 1QVVA 4GE0A 1OX5A 1FY2A 4R7GA 3P9SA 3FIJA 3SF8A 1GGEA 4ENTA 1GGKA 3M3PA 4UOQA 1PE0A 3TTTA 3TTVA 2VRNA 5E9AA 3EJ6A 1GG9A 1WL8A 4E08A 2XF2A 4P36A 4N0MA 3N7TA 4B31A 2R1TB 1GGHA 2AB0A 3EZGA 4QYXA 3P9QA 2RK4A 4OGGA 4B40A 2LXNA 1Q2UA 1U9CA 1FYEA 2V4UA 2VDJA 1VHQA 1G2IA 4ADSG 3KKLA 4K2HA 3TTXA 1T0BA 4WXYB 3PQ4A 2ZUTA 3SOZA 2RK6A 4N12A 2A9VA 2ZUWA 3PQ3A 4WINA 5IP5A 3P9RA 4AUMA 1P7ZA 4ENRA 4LGYA 4ZDIA 5JZMA 1JDBC 1IZZA 1CF9A 2D7JA 2R1VA 1I7SB 4OGFA 3EWNA 3F71A 3B38A 4AULA 4Y1RA 3MIIA 5SY6A 3NVAA 4HCJA 3PQ8A 4JQSA 3SF8B 3NOQA 3ZR4B 1GGJA 4ENUA 4ENWA 3ER6A 1ONSA 3L4EA 4L8FA 3CNEA 4ENVA 1P5FA 2YWBA 4D1YA 3CZ9A 2W7TA 2ISSD 3NONA 3TTYA 4B5KA 3P9PA 4QYTA 3UGJA 3R74A 2OR3A 4ENSA 1QDLB 2GHRA 1VCNA 1QVZA 2VXOA 2ZUSA 3UMMA 3L3BA 3PQ5A 4P35A 1M6VB 4MGHA 5JZOA 3FSEA 4Y1EA 4Y0NA 4P5PA 2YWJA 3CZAA 4GUDA 3D54D 3ZJ5A 1CS0B 1P80A 5SYAA 1JVNA 4P34A 5SY9A 4BTEA 1I1QB 3OT1A 2NV2B 4ZGGA 5BV2P 4OJYA 3R76A 3TTSA 4RKYA 1P81A 2R1VB 2FEXA 3UK7A 4AJ9A 3TTWA 4L8YA 4Y1RB 4UOZA 2IUFA 4E5VA 2AD5A 4Y1GA 4ENQA 3UOWA 2YWDA 2GK3A 4BFLA 1KA9H 1L9XA 4UZSA 3TTUA 2RK3A 1GPMA 2VPIA 3EFEA 1A9XB 4RKWA 1UCFA 1C30B 3CYFA 3GRAA 1QF7A 2VKTA 1O1YA 4I2NA 3WFZA 1Q7RA 3EN0A 5LIRA 4S0ZA 4XLLA 4OQ4A 1C3OB 1VCOA 1R9GA 1T36B 1PV2A 3MGKA 2WJZB 3NOOA 4MNTA 4L78A 4AUEA 1CE8B 4OIFA 1OX6A 1KWGA 1PDVA 1PDWA 1IPHA 2H2WA 4GE3A 4L7QA 1SOAA 3OT1B 1K9VF 1OI4A 2ZUUA 2R1UA 3L18A 3NORA 3RHTA 4MTCA 1T3TA 4PXYA 1N57A 4Y1FA 1OX4A 3PQ2A 4L8WB 3TQIA 1OX4B 3VU3A 3NOVA 2R1TA 4I4NA 4UNIA 4AUNA 5SY4A 1GPWB 4I46A 5K4AA 1QVWA 4B2YA 4ZDJA 2YWCA 3PQ7A 4UCFA 1QWSA 3UJNA 3CY6A 1BXRB 3BWEA 3PQ6A 4P2GA 2ABWA 4ENPA 1I7QB 1KWKA 3ZJ4A 1SY7A 1KEEB 1VCMA 1J42A 1KXJA 3B36A 1S1MA 3F5DA 4LRUA 1P7YA 2ZUVA 4OFWA 4BIMA 4L95C 1IZYA
chains in the Genus database with same CATH superfamily
2HJSA 5C18A 1T3SA 3QVGB 2OFFA 1GUAA 2QMQA 4L8VA 3DVAB 3LLUA 1ULHA 4CFSA 1VYVA 1EFTA 2ORVA 2ZAMA 1FSGA 5TF0A 1QO0D 4P08A 2VDKB 4I1OA 1J1IA 4MIEA 5CGQB 3SBEA 3W90A 1GGKA 3GOQA 3G0DA 3TEMA 3TTTA 1Q0PA 2ERCA 1K6JA 2G67A 2G1UA 4QL3A 5AXCA 3TKLA 4PLWA 4RIFA 4F5WA 3IH5A 3J7AC 2O3QA 5JWHA 3NC0C 3LF1A 1NR1A 1V7QA 2Q0XA 4JCOA 4QOHA 3ILYA 2V3VA 4V0MA 2EXXA 2XMCA 2AG0A 4NYMQ 1ORHA 1EVYA 3AZOA 1AS2A 3BEDA 3COVA 4NMXB 5A9TA 2AFRA 3D0QA 3SJUA 3N7UA 2J07A 1B43A 5IC6A 4Z1MA 1K2WA 1QX3A 2YXDA 5LPNA 1E63A 4XYBA 5H9WA 1CQIA 1KEPA 5G41A 1UMKA 3WJAA 4HVAA 1A9TA 1VBMA 4LG1A 4Q4JA 5E2BA 4B3XA 1Z73A 3FOCA 3JWGA 3KIPA 4N6NA 3LA6A 3F3SA 1XMIA 2ZEJA 2FRXA 1E18A 2SCUB 3MIIA 4ARSA 1G3QA 3D02A 3LOQA 3NOQA 1R3UA 2VP4A 1AQUA 2BMFA 4FDAA 4PSCA 5A7FA 1U2PA 2ZTUA 4Z9BA 1QUFA 5KUTA 3AINA 3B6ZA 3EGEA 5HF8A 3H1PA 3M5WA 5FBWB 3AB7A 1K06A 2PMFA 4RM2A 1CUFA 1JHDA 3QJGA 2QAGC 4OA8A 1ZHHA 1BWQA 1VE6A 1YMUA 1ACMA 4F45A 4LDQA 4KFCA 4DLVA 3JSXA 1DBIA 1WS6A 2C7VA 2QL5A 3AKYA 3DKRA 2R6DA 4WPGA 1ZMRA 3IKMB 4PLTA 3NFRA 4Y6PA 5BQFA 2MIIA 1VIMA 3CR7A 5BURA 1AGXA 1WF3A 1Y9AA 2PGJA 3UBTA 4WZBA 1DRVA 1VPDA 3DXXA 3OKFA 3SSAA 1GEEA 4XVQA 1NI4B 4W9NC 3W6ZA 5JXHA 5KJ1A 2AFHB 4WNCA 3TUZC 3ZTTA 3TQOA 2FH5B 4YRDA 4F97A 3BMNB 4TV9B 1HY3A 4CIVA 3SIPA 3IJ5A 1RMTA 2HX1A 1BEEA 1J2UA 1PTJA 4ECEA 3GZJA 4F85A 5B1HA 5J5VA 1OIWA 5EGSA 4IQ8A 1DARA 1WIWA 3O9MA 4WDQA 1TM5E 3WHIA 3ZGOA 5KOIA 2BOVA 2YCBA 2G09A 3HMQA 4L0MA 2Y6VA 3AI3A 1ZN8A 5CNMA 2XHEA 1GYRA 2B35A 4GMXA 3WQRA 3WTBA 3ZGNA 4E31A 3PPIA 1XVAA 2Q8PA 3TOXA 2EGHA 4P93A 4KOEC 1G20E 2WSYB 1DL5A 4DXHA 2J46A 1JPNA 2I2CA 4L4XA 5TS3A 3PZRA 1NV8A 2BW0A 2QX7A 4TS9A 2FU5C 3WS7A 3WMEA 1P1RA 2O20A 3PQCA 5LZ4A 3EEOA 2A0FA 2RHRA 5KYUA 3T9DA 4INPA 1ODCA 2PG3A 2PX2A 4TTQA 2O2ZA 4G4JA 3WWCA 4EFMA 1QOQB 4JUCA 2HWUA 4V39A 1EI9A 3OZRA 1RI1A 3A6JA 2R6FA 1EWVA 4K40A 4LJ5A 3NHSA 4AUNA 1ZU5A 2HK9A 2P9QA 4FOLA 3QPCA 1SKBA 1DAGA 1Z82A 2FPPA 1YL5A 2XE6A 2VDOB 3PQ6A 2M6KA 3PCTA 3T94A 2AOXA 3OPYA 3PR3A 1BQEA 4IDCA 4TLDA 4LDPA 1NPTO 1QF9A 2GRUA 2XA2A 1HNXB 1YULA 2H4WA 4ROTA 1Z4PX 4OUKX 4RU1A 3V8PA 4QGSA 5EXTA 3UHJA 2UYCA 3AUKA 3LC1O 5FBRB 5IFKA 2R4QA 3ITKA 1EP3B 1OX5A 2DUMA 1KGDA 3AX6A 3HHPA 3PRKE 4FD2A 4GT1A 4KGDA 4L6CA 4Z86A 3S8EA 3I9JA 5FOVA 2G63A 3AHGA 2Q3BA 1LNZA 5J1SB 4K0KB 3AT1A 4XEUA 4ACAA 4Q01A 2ZSFA 4K6MA 4YDHB 1AV6A 4XM0A 2V55B 1VTKA 5EJ4A 2E4UA 1RXYA 4K9RA 4KQCA 2AMFA 4MI1A 4WLVA 2KM1A 3LX4A 5I9LA 3NHAA 2FW6A 1A9ZA 4DIEA 1HK7A 2CLSA 2VN8A 3HU3A 3KXDA 5HZMA 2VHUA 3CKLA 3IPXA 2IXBA 1EB9A 2VRCA 3GD7A 4RH1A 5HA5A 4D9JA 3V8MA 1ODKA 4LHWA 5AI6A 3OF3A 3T7KA 4C1BA 5KOHA 2GF0A 5KTOA 4MS4A 4BKPA 3UCEA 1SKYB 1PLJA 2JLAA 3DYBA 2J0UB 3F71A 3GIWA 3L7OA 3WQQA 4C89A 3L0SA 4AN1A 4ZOQI 1IOVA 4GOLD 2WZDA 5DSZA 3QNUA 2CFIA 4A16A 2GXQA 1EZZA 3WX0A 4IYJA 4RAQA 4B45A 2BJWA 3CR3C 2ZWPA 5LC1A 3EG9A 1SEPA 2GPBA 4Q7MB 4D1YA 4EUFA 3G9XA 1E0KA 2C5GA 4TMVA 2DEUA 3C3BA 3AFNA 3LM8A 3OY7A 4PAMA 5DI3B 3WWDA 5LIPA 1E9CA 1LNSA 4HADA 5AOAA 2VDNB 2DT8A 4D8UA 3L1IA 5BN4A 3HU2A 4KXFB 1T9BA 3AFHA 2ZQYA 4A73A 1NVXQ 3J7TA 3IDFA 5B3LA 1GFIA 2HMUA 2IS6A 3IR7A 1DINA 2HSZA 2R8XA 4UXJA 4L16A 3GOHA 1Q7CA 4BTEA 1YQGA 1ZQ1A 2C31A 4DMFA 4W5RA 5J63A 2FQYA 4XGQA 3K4PA 3I3OA 1P81A 4KPEC 5FH9A 1TK3A 2H1OA 1TFRA 4OU5A 3UZUA 4QOIA 1EQ2A 3KDSE 2D5IA 5A6VA 4PFQA 1WMBA 1Z4NA 3INGA 3CEJA 5TPZA 1ONPA 5B1YA 2PVPA 3LCJA 4CMJA 2WC1A 3JQBC 3OKAA 1KZYC 2OK7A 1MV8A 4XOUA 3NNNA 4F06A 4FLFA 2AE1A 4CMHA 1NVKA 2QN7A 1EG2A 1Z4LA 1N9KA 2A88A 3HXTA 3N2KA 2I3AA 3DE2X 5JS8A 3H11B 4PQRA 3T4XA 1JLLB 2H31A 2PX3A 3RUIA 5BPHA 2HW8A 2I1LA 5B3JA 1HFWA 3QELA 5ILGA 3PU6A 1Z2EA 1NSYA 4TWZA 5KYWA 2NSHA 2G77B 3RJTA 1FDUA 3HCDA 4FEEA 2YOGA 1XQYA 4BMOB 3QWIA 3EUFA 4XIYA 1NNEA 3MTDA 4TLLB 4CDGA 1FXWA 1CZUA 1FP2A 1T15A 1YVRA 2GH1A 3TTVA 4TKVA 2YYYA 2ZJ3A 5C7OO 5HHTA 5L95A 2X6TA 4G41A 1GYQA 1TNDA 3O2QB 3MCVA 2IYSA 4Q1CA 3EZYA 4KZPA 4UBIA 4EFDA 4ERNA 1XZMA 3GVPA 1MOPA 3GJRA 1EGAA 2AFIA 3DVQX 1QU2A 5EESA 5P21A 3DF7A 1F3LA 2YR0A 1KO7A 5B64A 1JEQB 1KZ7B 1Z7YA 2W43A 4HB2A 5EAIA 4BQNA 3AGQA 1KO8A 1AX9A 2OG1A 4X1IA 5B4TA 2VJBA 3P19A 3PGJA 1ZI6A 3KHKA 1GV1A 2C1XA 2O07A 2OO7A 4G0OA 5CT4A 5JXIA 1PNQA 3GVXA 4BECA 1N9ZA 4M8SA 1RE1A 1F6DA 1SNYA 3LQQA 4INAA 1DTWB 1U7XA 3E1GA 3T9EA 3P9SA 2C94A 1LB1B 1PAUA 5THKA 1KDZA 2DUJA 2QDXA 1EK6A 2HRZA 4HQNA 1NYQA 1KIAA 2Q45A 1S2GA 2DR2A 2Q5HA 4WK0B 1AUXA 1KHTA 3FHCB 4A6EA 5JPDA 4F4FA 2X19A 4QECA 4P36A 1WSAA 2R1TB 2OV4A 1VCHA 4OUDB 4EBBA 3OQ6A 1LRKA 2YNMC 4HWOA 4LYJA 3ZDXB 1U0TA 1BW9A 2DMRA 5KVQA 2ZGVA 3K0AB 4DLPA 1TMYA 4LRXA 3QEBZ 1TCUA 3GWZA 4Y9DA 4Z7QB 4LSMA 4LHZA 1F3OA 2RGUA 1CP2A 5GZ6A 2QTMA 3OPYI 1TYBE 3D8NA 2IITA 3KR0A 3NTLA 1JX6A 4BNMA 3FNGA 4MWZA 4LECA 5L9AA 1N0IA 1QIMA 1L5WA 5AVOA 4QOEA 4JOQA 4YI3A 1IG0A 5JU6A 3ORRA 1QORA 4QPDA 3R23A 1N6HA 1CB0A 4JLPA 5DBIA 4DYVA 1X8JA 1GCUA 1B8OA 2JRLA 3DMFA 3EE6A 1MA3A 3JYHA 4ZZ0A 3KV3O 1V1RB 2ZE7A 4JD5A 2ZSAA 5JV5A 3DE7X 1U3DA 1NC1A 3PEUA 1XT6A 5WRFA 1WPXA 4XRRA 3ZQ4A 4B4VA 3FZYA 1U9JA 4G56A 7MDHA 3HVIA 1IZ9A 3FGOA 4PHFA 3OCUA 2DQ4A 1RHRA 4KQJA 4P82A 5INTA 5LJIA 1G5PA 2QTRA 3I9NA 3FYUB 4LW8A 2I3ZA 2QOEA 4A2PA 2E7ZA 2OHOA 4L51A 2GZ1A 1QYXA 1DHRA 1YL7A 2BFFB 3O4IA 3AOEA 4HTAA 3T0GA 5I7SA 1E3DA 2IXTA 4NK4A 1R5BA 5AUNB 2FGKA 2P6RA 2HMSA 1H05A 1L1QA 5FR1A 3MWDB 5K7SA 3WVNA 2WHQA 1S7CA 3IMEA 4IGEA 2FMKA 2VJNA 2Y6UA 1OZAA 4WLFA 5DHAA 4OHXA 1EDEA 2Y4NA 1UKAA 1K4KA 2IWHA 2X77A 1QXSA 4Q7KA 1OWNA 3DPIA 1U63A 3V6MA 3MJCA 4GXRA 1R8JA 5F21A 1R4MA 2VCYA 3E22A 4YAOA 3VDNB 1BH6A 1TVMA 3VJMA 1JDSA 1LGYA 2IIBA 3GBVA 4YRSA 1D03A 4KWCA 4EVRA 2INGX 3MTGA 3DZBA 2KSQA 4QPCA 4ZMBA 3VYVA 2GKOA 1NNLA 5AKZA 3R9WA 1GTZA 1V39A 2HHLA 1OI4A 2F3RA 1I6WA 3KVNA 4UHBA 3GNLA 2H18A 1CIPA 1BCRA 3EA5A 4A5SA 2ZYVX 5JD4A 1VPLA 3MQFA 1YHNA 3DMPA 4CLOA 4MVJD 3NIFB 4OHMA 3LFHA 1SC4A 1L5QA 3ZVMA 1Y5LA 5BVGB 2IHKA 1VRWA 3RSHA 1MJGA 3BWEA 1G21A 1EK2A 3IJRA 3DMYA 1G3IA 1CD5A 1VGQA 2O2IA 3WQHA 4P4TA 2XADA 5GJWC 3UMRA 2PHZA 3ZY6A 2FN8A 1R0XA 2PKQO 1PN3A 2I9PA 1Y98A 1E3IA 3EYWA 3GIDA 2GWHA 4I8XA 5ICFA 4INZA 4C4YA 4D8WA 1EH5A 4ILKA 1QH8B 3TQHA 4WBNF 1JJBA 1WXGA 3PUHA 4DRYA 2BHSA 2QI9F 3E8SA 2VP9A 4LYDA 3TWOA 4QNRA 3PNMA 5IDQA 3KCQA 4J3FA 5J43A 1EFAA 2OG2A 3HFJA 4WI1A 2FRVA 4UEWA 4KAJA 4GMHA 1KAGA 2QL9A 1Q2XA 3BN3A 3QVWA 4LOKA 4HGPA 3WNCA 2ZRCA 4M83A 3ZKWB 1QG4A 2O4CA 1CW2B 3KHSA 5B2FA 1WLSA 4HWKA 2XXAB 1GSOA 3GLIE 1DWOA 3PFNA 1YZKA 3TMYA 6LDHA 4UKDA 1CY0A 4LYHA 2Y1GA 3N8GA 4Q4AA 3K5WA 4P7GA 1E4EA 1E77A 4PVDA 3HR8A 5LYYA 1FFYA 2OLKA 2RAVA 4KIGA 3G85A 3WAJA 1INLA 4PLYA 3DV9A 2H4HA 4FS3A 2WK1A 2OVBA 3HVHA 3QLJA 4AS1A 4OH1A 2OM6A 2RHGB 2ZYHA 3WBFA 1A4XA 1GFZA 2R8PA 2WHPB 3DKVA 2OMEA 4QPZA 1M5UA 4C0KA 1ST3A 3ICPA 5ADUS 5C5EA 1FFXA 1QNLA 2ZWIA 3OCZA 4AQ7A 1YUMA 2YY7A 3C6YA 2GEKA 2FF5A 1HG0A 1AS0A 4MHSA 4M1SA 2B21A 3UANA 1Z0JA 4IHJB 2H7YA 3RBAA 3SU8A 1F7VA 3O4GA 4FR2A 4JHXA 3L04A 3D7LA 4TRJA 1W2HA 3WOVA 3LCMA 4TSFD 1DDIA 2ZB2A 3G0HA 1Z8NA 4MP8A 4MW0A 2Q3HA 4E4YA 3PE4A 4FYKA 3IPRA 4MR8B 5T5QA 2SHKA 4DG5A 1YDEA 3BD9A 4Q9HA 4FFSA 5HKBA 1LK0A 2EF0A 5KX5B 1I0LA 1UMDA 2FW8A 2G06A 1Q57A 4EHLA 3OJFA 4PVCA 1MHTA 3JD1A 5EPUA 3SC2A 4OOEA 2W2XA 1H8ED 3WYCA 1EKXA 4R7TA 1ZSYA 5E7MA 1VG1A 4DWVA 3J81A 2XMQA 3NVDA 4X8HA 3AESA 4B7XA 4HTFB 3GRAA 3NHFA 4QO8A 3VH3A 1F48A 4V1CA 1DU4A 4KFSA 4JY7A 5CBKA 3RADC 5KWJA 3ZWVA 4RTOA 1GAXA 1V48A 4J29A 4IX1A 1ZX1A 4AUEA 5CLFA 4YJDA 3X1KA 3BBLA 1RAHA 2CL7X 3FNQA 3QFSA 3P2IA 4QSHA 2OOSA 3FYUC 5DM1A 1GXSA 2R7NA 1D6MA 4ZRNA 4AZ3B 1ZNZA 3GUHA 5GTDA 2HREA 4Y1FA 3U61B 2RJOA 4ZKEA 2AC2A 3BGDA 2PZKA 4MGEA 3KO8A 4LIPD 2JD2A 3DZ8A 3GA5A 1LJUA 1JWAB 2CHQA 5JADA 4AXBA 2OV3A 4ZOEA 4JOCA 2HRQA 3LWDA 1RQPA 4D97A 4GKJB 5TIIA 1V26A 5FPTA 4KR3A 1T4CB 1JALA 3DTVB 3EVFA 4FQ7A 4KGVA 2HT6A 4UDNA 5IANA 1WCWA 1QCZA 2AK3A 2BPOA 2J41A 3A70A 3EGDA 4GFDA 3MIZA 4LYFA 4N7MA 3R3SA 4DQDA 1E6KA 3ILSA 3G9UA 3UTDA 1G7SA 1YDWA 2CUTA 1TJ5A 3L7IA 3W2TA 5IT9A 1GFWA 3B2QA 1R6DA 3QVXA 1VPWA 3B3AA 3GDWA 3NXSA 4EABA 4N82A 5FT9A 4GE0A 4EHKA 1FY2A 2I33A 1E8DA 1X70A 4EFLA 5KQRA 1MRNA 1GDTA 4NFHA 1VC2A 1OHHD 4BO7A 2OQVA 1Q74A 1QE3A 4CIDA 1R0RE 1M8FA 2HA3A 3DWGA 3DBLA 3V55A 4C2AA 2XRYA 2Z8XA 1QRSA 5JFOA 3BL5A 4CUKA 5LUAA 2JJYA 1QP8A 4JT4A 2EQ5A 3JQGB 2V4UA 3KHUA 1X80A 1G2IA 5B6IA 5J4KA 3R7SA 3GY0A 3T5AA 4DC9A 4GI3A 4RLSA 1WG8A 1ZXXA 4HJXA 3LW8A 3LK6A 2D1FA 3GRPA 4AF7A 5F7OA 1E98A 1XQWA 2VDMB 3Q8KA 5D1HA 2C2BA 3EGXB 3EXFA 1JMKC 5L7TA 3K0CC 3WNZA 5FTWA 1XXHE 4Q1BA 4HQOA 4MYHA 2PGAA 4XCQA 4E2XA 3EVGA 2ZM6B 4R2IA 3L2OB 3OUZA 4JFRA 4KDEA 2X5NA 2EYUA 4M6WB 4NU6A 3SWWA 2NQTA 1NMQA 2C7RA 4XX0B 4Q34A 1ONBA 2VP0A 2A84A 2CNWD 3FVWA 1VL2A 3W8NA 1FMTA 3BF8A 4DC0A 5TX7A 2FLKA 4ZCQA 2QPOA 2CJWA 1CY6A 4HDNB 2VYFA 2JD0A 2R8BA 2VWGA 3BCHA 3ESAA 2YKGA 5IDYA 1XWIA 3F7NA 4G07A 1KAEA 2XSZD 2PUDA 3KLOA 3M6LA 4DYHA 3IEKA 5EWMA 3W6PA 3SS8A 4ZO9A 3TZHA 4FE3A 1YQ9A 1FJ2A 2VZLA 2NZ8A 4A1OA 3G6WA 4LSWA 1IQUA 1B15A 3Q7TA 4HY3A 4TMFA 4ZVLA 2ZSEA 3ZUGA 1HDRA 2AOUB 5JSHA 2D5LA 4BZZA 4CV3A 3TLAA 2JDID 1Y0BA 1QAQA 1HQKA 4KO3S 3TTSA 2YHBA 2QN1A 3CGGA 5BSRA 4AJOA 1XA4A 2D5CA 4AJ9A 1IZ0A 3IB6A 2Z2YA 2WJVA 3N8KA 4TN5A 2VWPA 3ZZNA 4ER0A 3AVXA 3AL3A 2UZIR 5C32A 4NU5A 5A4AA 2VDRB 2ZTHA 3DEAA 4UBJA 4JI3B 2FSGA 4CM9A 1Y33E 1XQXA 2EJWA 1E1NA 2A94A 2WWXA 2R96A 2OQIA 4A36A 4EYSA 1ZH4A 1HURA 4EYEA 3EIUA 3MB8A 4V0RA 3WGHA 2NU6B 4YLEA 4OFZA 4AICA 1P7PA 4L4SA 4LCEA 2JFZA 3EQ8A 2WFLA 1LDNA 1QFXA 2IDMA 3ENQA 1CE8B 1XRNA 2J7PA 3A6DA 2ZJFA 1RAAA 1SCKA 1YE5A 2Q6OA 4TTAA 4CF5A 3OWXA 4I6JA 3DZKA 5HFNA 4YX9A 3HBJA 4H7FA 5A5DA 3FNBA 4LFBB 1ORDA 1JHUA 3QE3A 3NOVA 4AWXA 4LKOA 2H8GA 2ZYAA 2C3MA 2N75A 3HHEA 3ASVA 3P71T 2B8EA 2WKWA 5GQSA 1YIDA 4HK4A 2YWCA 4LJ7A 3FHLA 5JW6A 4JXXA 4ARCA 3D8UA 4IDDA 1HFEL 3TFOA 2X3UA 5HIKA 2VQFB 4P2GA 4UM5A 1PK7A 4N3NA 5BRJA 5IRCD 4TLMB 4L95C 4V1CI 3KETA 1XLTA 5C8ZA 3PNYA 1P7CA 2VYVA 5DFAA 1TK9A 3IUEA 4BNGA 4EDHA 5IUJC 3TEJA 1N0WA 1X2BA 2I2DA 3LYAA 5E7IA 4QHTA 1DC7A 3WIVA 4GC5A 3ZWAA 1Y80A 3QHQA 4YMIA 4YAEA 4MUXA 1N0VC 2RCYA 4KC0A 1ZAYA 1S3FA 1V8OA 5B7GA 2R62A 3WWOA 3MK31 4FHZA 3CVWA 3NUZA 5KTTA 3NP7A 4HMPA 4KR2A 3OJOA 2JGKA 2DTDA 4LQDA 2BEUA 2P2LA 4DSUA 4WACA 3KSRA 1CUBA 3HB1A 3KYDA 3DTTA 2HGZA 3K31A 3DBHA 1DIBA 5BR4A 2H17A 2XYGA 3EXHC 3V4FA 5DYGA 4NC9A 4CLRB 1H2HA 5JCJD 3BORA 2FMIA 3D8SA 3N59A 2QUBA 4ZDIA 2A9FA 2FEPA 2B1JA 3HKBA 2WTNA 3CTMA 2PBZA 3O8LA 3BHIA 4ZICA 4J49A 4WK2B 1P9OA 1ZJJA 1TJYA 1XZLA 1GVHA 3JY6A 2YUTA 4IRXA 4C4RA 5IT0A 2R47A 4P31A 1XD2B 2FPKA 3V9AA 4DZRA 1RZVA 4DNFA 2PL5A 1XJQA 1RXCA 3URMA 4KQKA 4ND2A 4I08A 4NZZA 1X1SA 2O48X 5ALKA 4M1KA 4NMMA 4DCCA 5F2NA 3L8CA 1DOAA 1B14A 3P9PA 5IC5A 3ZLBA 4PN3A 4GYYA 4U63A 1RWBA 4M0CA 5ALTA 3BD8A 3NHUA 5D3ZA 2Q0HA 4BC1A 2V9CA 1GPLA 1NLUA 1YIAA 2F9MA 3DONA 3IAS1 3O4HA 4QICA 3EJWA 4HJRA 4GNKA 3DHEA 3IIEA 4PRYA 3WYFA 1B26A 3TSAA 2NP7A 4LHEA 1NP7A 1OGJA 1P8JA 2W6QA 3GDHA 3FYHA 3OU2A 4JLVA 1TYCA 3FAZA 2GNOA 1SCQA 3OOYA 4DWOA 4PV7A 2IYUA 1WNFA 3E9YA 1UBRS 2F3UA 2WTBA 3A10A 3HCRA 3NFYA 2IYAA 4FSHA 4X90A 3QOXA 4AJPA 6PFKA 2A9RA 1I3LA 1T5DX 2RHCA 1G63A 4YVFA 4D8YA 5H3LA 4I0WB 4HPJB 4IVNA 5CP8A 5KVVA 4BV3A 4CKWA 4ZI7F 2OK8A 2PM8A 2LIPA 1GPMA 1NIPA 3AF0A 1TCAA 3SM3A 1L5FA 3N28A 2HFJA 4TQGA 4MQ4A 5DTIA 3EF1A 4URHA 2X13A 3JQQA 3A6ZA 2V7EA 3KQYA 1GTRA 3KSUA 3PPVA 3HBLA 4FWIB 3E53A 3GV0A 4R31A 3USCS 3G3EA 3L1JA 4PAQA 5H81A 3ZNNA 1D8AA 3HO6A 5HFJA 2PDAA 3X2FA 2PPVA 3M6AA 1OPXA 3BGOS 3ISVA 2XJ9A 3RTDA 1IXZA 3VKVA 3OP4A 2Z58A 3KXIA 5EWJB 3WLFA 4G24A 1K2VN 2JLZA 3HKDB 3I5MA 3U6KA 5E9QA 3TXAA 4BJ5A 1NVBA 5JNTA 2F3SA 2CXRA 4H6XA 5K4AA 4E14A 4I9HA 1N77A 2DM6A 2C5AA 1QB7A 4KMRA 1DKLA 2BKVA 5A04A 2Q2QA 3IUNA 1CKEA 3TW6A 4PS0A 2OZKA 3FFBA 4RMJA 3O7MA 3OUTA 2RG1A 5E6SB 1R3DA 1X14A 4A0GA 1HDOA 5E4YA 1K63A 1XF9A 2ZT8A 3EC2A 4LY3A 4MSUA 2XXJA 2V7BA 5MDHA 2JFUA 1ZCAA 4E2WA 3AIKA 1CUXA 3Q85A 2YX1A 3W8EA 1QVVA 2QM3A 3ZJUA 1AURA 4BXOA 1Z38A 1RZ3A 2BVNA 1P73A 3V5NA 1Y9EA 3RYCB 2RCNA 4NX2A 3BDIA 4DWJA 1QV9A 5AFSA 2B1GA 1L7BA 1N1EA 3P5BA 4ND7A 5EUCA 1PGPA 5CDHA 3I8OA 1PFKA 5LP6F 1BOFA 1L8LA 3CPHA 4F4IA 1UK6A 1E3SA 1Z0KA 3B5JA 4TXHA 5AJWA 3RAPR 5K05A 4K7JA 1TKCA 2HZ7A 3UICA 4B4WA 3M8KA 1K7XB 1VMKA 1E3WB 3I5YA 1C80A 4JR1A 4TVSA 2XCUA 2R7AA 3PC8C 2YN0A 2HA7A 1T4GA 2PTGA 3PFKA 4DQ0A 4IFIA 1Z8DA 3HUDA 4ZD6A 5AWFC 2AFHE 4E15A 1HE4A 3BL6A 3ZK8A 3M33A 1Y3CE 1U8XX 1A97A 2HSEA 1KNQA 5CUQA 3B48A 3I6QA 1UEXC 4JHLA 1R0KA 2O0KA 3SYMA 1PSZA 1SRRA 4LZAA 4X85A 4ENUA 1JWLA 4B83A 1Z83A 4JC8A 4ARAA 4L8FA 2PU7A 3EXEA 4MV4A 1AF7A 2IH2A 3D5EA 5E9WA 3RG2A 3BT7A 3CH6A 4ZVOA 2WT8A 4O2AF 3ABRB 4TWBA 2IGTA 1OWLA 2HB6A 4ZJPA 1M6VB 1XZAA 1YKSA 4RYLA 4TRRA 5AHXA 2UXDB 1W85B 1YZQA 1AN0A 2AJDA 4RV5A 5E3JA 1L7MA 5FWAA 2OXTA 3U4QB 5F2OA 2VS1A 3U3MA 2WLSA 4P4NA 1CDOA 3GK3A 1JHQA 2QU8A 2IYWA 1X7YB 3IAHA 3I04M 3NJRA 3BMCB 2HDOA 4PGFA 4UTOA 3KQHA 1JQDA 3CURA 3WIUA 9LDBA 3CFYA 3UK2A 1QOPB 5IULC 2IP2A 4DR6B 5JJIA 1ZOOA 2ZYTX 3N8IA 3AUFA 1JKXA 1UF9A 4DLLA 4KO8A 1HF3A 3Q11A 2WD9A 3PI6A 1LBHA 3VKUA 1GA1A 2ZITA 5KNCD 1KOJA 1NJ1A 4BKOA 1QF7A 2GXUA 2HIMA 2ZRIA 5T4HA 3DKPA 2DERA 4DDTA 4XIJA 1Z8HA 2SKEA 3PQFA 2EC5A 3CNOA 4U7TB 2ZT7A 3UC9A 2VUTA 2Z2IA 2P7IA 3AHEA 1GQFA 1ZU4A 4M9ZA 2O06A 3KTFA 4HN2A 3V34A 4FYMA 2KLBA 1LBTA 5ELMA 4C3UA 1LFAA 5CYPA 4D6XA 4RJTA 1RBYA 2VNKA 4KUGA 2R1UA 4JEHA 3RLIA 3SEFA 3KYIB 3LCUA 4XUEA 1BS2A 3K9HA 3PQ2A 4EMSA 3CNNA 4AJIA 1QIDA 1K75A 1TEHA 3W9YA 3JYPA 4OP1A 3TK1A 5KNBH 1E1CA 3B20A 1LBSA 5AVTA 3T3IA 1W5FA 4LZZA 3UNXA 3AW9A 1CUAA 3AG5A 2H7XA 5DJ5A 2HJRA 4I5GA 5GWXA 3SIRA 5T3UA 1DRJA 3N53A 1ZA2A 1E9BA 4R6WA 2VXBA 3KJQA 2QQ5A 4MW6A 4BMYA 4B3RB 4UEJA 4GM0A 1P2TA 1M54A 1IMOA 1QH0A 2WILA 3U09A 4FHEA 4EPVA 4HNTA 2JFOA 3MWEA 5JIBA 4R7GA 4GOKA 4K8OA 1R9MA 2REQB 3DMNA 4QJIA 4ZAWA 6AT1A 3AVWA 4DJAA 5IABA 1L5HB 3D3NA 5EPEA 4EQ6A 1S2NA 1XV5A 2CLEB 1K5HA 3VO9A 3B5IA 3IBGA 3B3JA 1NOIA 2GAIA 4G5GA 5E9AA 3UO8B 5FTNA 1PVOA 4EUSA 3T9FA 4HV4A 4OGGA 4R8VA 3IL2A 1WSDA 4QU5A 4QBKA 1NXOA 4ZT3A 1RAFA 4TYMA 1ZM7A 3R4CA 5G0SA 1U0NA 3FBGA 3GDGA 5EC8A 5ICSA 4UULA 4TV9F 2C4WA 1F51E 3NDJA 2J9FB 3CG4A 1X1AA 3NYQA 4KBYA 3OUUA 4ER5A 2Y0DA 1MENA 4PYIA 3C74A 2PRYA 3JAWA 3NEPX 3LHSA 3PGMA 4REMA 1S01A 5JVDF 2JLXA 4M1TA 2GNPA 2I1QA 4IXWA 5E6UA 5FL3A 4BIIA 3M7IA 3O8RA 3JVEA 1KY2A 1N2EA 2EX4A 3CSUA 5CJPA 1YA4A 3ZXUB 3G68A 4DM7A 4YT2A 1E99A 5AR1A 4CCYA 3LKBA 1D5CA 2DULA 2WQ7A 1N92A 5IUKC 4UXHA 1WMAA 3T7AA 3CZRA 1VSUA 2GTPA 4MQEB 3GZTB 5DW0A 5EWLA 5JSQA 1JUDA 4MTLA 1FTYA 1YS1X 1V6AA 2QZPA 2WD8A 4JLMA 1GNRA 2XOKD 5TGTA 1S0UA 1P8AA 3MBKA 4EPYA 5LKRA 4Q7EA 1C9DB 1Z5NA 3IQFA 3ZNQA 4YMWA 1CUUA 2B3DA 3AP3A 4JUIA 5FD8A 2CLMB 4C7OA 2DE0X 3TW4A 1BVUA 5CHYA 3DLAA 4RPGA 4A8HA 3ND9A 2FXVA 3ETEA 1JXQA 1JYSA 4YJFA 5C1IA 3QI7A 4Y1GA 2QB5A 4G5SA 2ID4A 2ZB3A 2GFQA 5LLSA 1N4AA 1FDOA 1SU6A 1L9XA 1I33A 2X6RA 2GD0A 4CGYA 1DCTA 2QBYA 4HLUA 2QN8A 1PFUA 1KO4A 5A4MS 4EB8A 4RMGA 4JLSA 2R00A 4BEJA 5DM70 3TQTA 1PL0A 3RRFA 2IFTA 1YVUA 2PS9A 3TZLA 2YWEA 4KPUA 1QH1B 4G4SO 3I4LA 4WLEA 4IFBA 3PC3A 2J3HA 2VP6A 1HOXA 4FVTA 3EPKA 2Q50A 3CR8A 2XPCA 3QW2A 1KZ1A 3ODGA 1WXQA 4L4UA 5FBHA 2XE8A 2LZ0A 2WI8A 4WKCA 1GL9B 1I2ZA 1SUAA 1HDXA 4GU5A 4QHSA 1F0YA 2X4LA 5C0OE 2C2XA 3REFA 1UBEA 3EQZA 3KEQA 2GMWA 1YFLA 2GK7A 4LF8B 1W88A 2Z9CA 5IAOA 5KOJB 1AA9A 2IIPA 3N1UA 1B1AA 2QSYA 3CC8A 4CKEA 4L6AA 1Z3CA 3TG8A 1JEDA 2OP0A 3CLRC 1E2GA 4EO7A 1QX4A 4YHBA 1WXXA 4WHMA 3LHIA 4GP7A 3ZHUA 4BZWA 4JP3A 4JI4B 3R6LA 5FUBA 4NCAA 1CYEA 5AW3A 4F91B 3L7NA 3B5EA 4EVSA 5AW7A 5IN4A 4FCCA 1HKUA 4HGQA 4N6OA 1I4WA 5EP1A 5AVQA 4IBOA 3HLTA 2H2AA 2QTHA 3LVQE 4C05A 5CA1B 2DKNA 2H1HA 4MCHA 5JVDA 2HMYB 2O59A 2WINI 5LQSA 4ARZB 2WAMA 1U3VA 2BFOA 2ZULA 5KNBA 2ZM5A 1USVA 3WAKA 3NHJA 4A9AA 4ZHQB 5LQAA 4FU0A 4N0PA 2J48A 3AUXA 3GJYA 1YQDA 4I4TB 2PXXA 3MA0A 3C3CA 1B00A 1KPGA 1U2DC 1I4DD 3NVMB 1JHMA 5I9SA 1WHTB 3DC7A 4TRNA 3T06B 4CM4B 4E5DA 1EWKA 1FU4A 1SUDA 3EWSA 1ZNXA 1RPAA 2EEZA 1QIHA 3SBXA 4X97A 5KJFA 1IAQA 2H1FA 1PKXA 4WUTA 7AT1A 2UDPA 4C0SA 4WFJA 2NZUG 4C7MA 3BXPA 4LYYA 5ARDA 4EB3A 5ICMA 2GN9A 2YNMD 3N87A 1HYHA 4GD3Q 2V6MA 2QGZA 4TMWA 1FUUA 1E8NA 4XVRA 3WRWA 2VSQA 3DEKA 3AUUA 4ENWA 3FPCA 2R5NA 1G42A 3KQMA 3DMDA 1LNQA 2BSAA 4P53A 4ZP1A 2Z2JA 5K8VA 5E4JA 1GZ3A 4DIFA 5LB2A 2DPMA 1ECGA 2FWNA 4C76A 5L3VA 2A9QA 2E5LB 3AI2A 3Q98A 2CMFA 3IQEA 3VOBA 1LVHA 2NX2A 5F12A 4CKZA 5KQLA 4BGEA 4IUYA 5F7JA 1HUQA 3CLSC 1YB2A 1ZYUA 4JA2A 1AG9A 2GN8A 3RQIA 1HR0B 5I4CA 1BU8A 1MJHA 3UWOA 4ISBA 2DX7A 4CL0A 1H8HD 4TZ0A 5D01A 4W5QA 1NN3A 4KNVA 3F5MA 4R5HA 3EVDA 3JATA 3H8JA 4K28A 2ZRFA 4U2BA 2XCIA 2B4RO 4WKGA 3IURA 4IIFA 1XBTA 4MUIA 5FEMA 4XUGB 4I5FA 3S70A 2XDQA 1J0DA 1VL8A 1UL1X 4UDOA 3IPLA 4AT1A 4F3RA 4MRAA 4ENQA 1X7XB 4NOJA 3F9RA 5IVPA 1E2MA 1JAZA 2PQ2A 3O8OB 4CBVA 2YOFA 4ZVMA 3B1FA 4BGUA 1PR3A 3OHSX 3D4NA 4CF3A 4G0VA 3U3OA 3WL4A 1SZCA 1ELOA 4R7ZA 4ALKA 4DDWA 2JLYA 1DAEA 1DIGA 3FCSB 3U7QB 3ZLVA 3EN0A 2NTYC 2OV6A 1O58A 3QU7A 1I32A 4BU1A 2YINC 3QM1A 3I0MA 3G2JA 4IUBS 3KKOA 4QRIA 3KVOA 1GAWA 2BZ0A 2BMJA 3ES9A 3V7YA 4AQDA 1XDGA 4WCFC 1ESEA 1KKMA 1PDVA 2GXSA 4XPIB 5DWQA 1VQ1A 2NPOA 2QD3A 2W5UA 4ZVVA 1XFAA 4NFYA 1I30A 2PA0A 1XCGB 2O3SA 2POCA 3NYIA 1AGPA 4F1WA 4P5DA 2E89A 5FBZA 3TLMA 4ZANA 5IH3A 5AD1A 1U8FO 3K9CA 4PC3A 4B3IA 2XGOA 3QP9A 1GRRA 3RUEA 3DDZX 2Z8ZA 5IVIA 3E5NA 1HNWB 3AF5A 3V2UA 2BBTA 2XKBA 3KNZA 3QVLA 1MGOA 5TQJA 3MT8A 1WM1A 1SY7A 2P0YA 4FGKA 1K68A 4QIHA 4WZAA 4X64B 1UBUS 3TIXB 3AR9A 2P3SA 3PKZA 4C03A 2MTBA 2NYRA 4BMDA 3EA0A 1ENYA 1OWOA 3IXMA 4RFLA 1AZWA 1JZSA 2ZKIA 1ZCJA 3I9MA 3AQIA 2ZRPA 4NR0A 1WXDA 4C30A 2YXPX 3VVCA 5EHNA 2IHYA 3U3DA 2PIDA 1S4MA 3PIRA 5HYVA 1AOXA 5ILOA 4DA0A 4KXVA 3W2GA 1E2QA 1XRQA 3GJ5A 3RBXA 2E5FA 3NIDB 2ZR8A 4JJGA 4M4SA 4Q00A 4R2KA 4UUQA 1POWA 5K01A 4N0MA 3KJFA 2HEGA 4X41A 1D0SA 4M0UA 4WKOA 4BEBA 4KAAA 3ADBA 1MPXA 1YZHA 3BB3A 3C3PA 4MRVA 5IDWA 3AP2A 4O4IA 2VTEA 1B0UA 2HOQA 3E2MA 3MINA 3H7AA 4L3OA 5EJEA 3KBOA 1Z08A 3J80A 3BD7A 1N2XA 2HDNB 2WIGA 3P94A 4QDXA 4JEUA 3T3MB 3TZBA 4DL9A 5K8JB 4PCAA 4PBTA 1MRZA 3ZQ6A 4QDUA 3IUQA 2VF4X 5JXJA 1KARA 2ZSUA 1C7IA 3NVAA 1PJTA 4G5HA 5D3MB 4B7CA 4R51A 1QPZA 1W0KA 4G9EA 2O7SA 1RC0A 1IFXA 4NS4A 1S2OA 1M1XB 3ZV6A 1IUKA 2QVCA 3WLTA 5EJ8A 4OLBA 4QEKA 1YJAA 1HE2A 4IVQA 4P33A 5I5GA 4JJ7A 2CK3A 4G84A 1LTKA 2FFHA 1NBMD 1PWXA 3HUEA 1O5TA 2ZR0A 3FLBA 3JALB 5IJXA 1CYDA 4KLRA 4D4MA 3PKJA 1CPYA 2NUTB 1GA4A 3KU4A 3L9WA 4I1UA 4C2UA 2VYNA 5KIAA 5FWXB 3BE4A 4F2HA 3Q3CA 1XL1A 3N6XA 4PC7A 5CH3A 3DAPA 4G1MB 4JGBA 3LCCA 5HRCA 2RGXA 5C37A 4XKJA 2AKYA 5K0FA 5H82A 2APJA 2G04A 1AA6A 5U9CA 2H4ZA 3NH6A 3WWPA 4YCCA 3PHIA 1B8PA 1NAHA 2IZOA 3AERB 3B7WA 2RGDA 4Q93A 5JBIA 1ADCA 4G0UA 5CB8A 2AHOA 2KPOA 1C30B 2RGNA 4M99A 3DMTC 3U44A 4HPXB 2Z3VA 3P2JA 1MEJA 1K08A 1YAHA 4ILEA 4G63A 2B98A 3FUCA 2XZPA 5FUQA 1I01A 5DCWA 3KQUA 2FPSA 3MCZA 1S2MA 2P11A 3ZZMA 1XG5A 1G5HA 2X42A 4HYYA 4AJHA 2O1SA 2G3YA 3OM1A 1JECA 4CT5A 2GEJA 4FFBA 4IXMA 3WLSA 4F5EA 5HQ3B 5BQPA 4OK6A 3ZDRA 2FK7A 1CZHA 3FCYA 4RMHA 3EFHA 1C0EA 2WJHA 4FCVA 2XB8A 2OBNA 1YOVA 5IZ4A 4TYYA 1RP1A 2AUTA 3T5BA 1E1RD 1N2CA 2ESRA 2FPIA 3MFYA 4HMQA 4K9LA 2J59A 1JPJA 3E8XA 1IYZA 1KY5A 2VDUE 4MPRA 5C1PA 5BVHA 4KKXB 2AMYA 1H6AA 1SUPA 2OZVA 3ETJA 4U0JA 1EFPA 5EFOA 2UYHA 2AUNA 1M2WA 3P0IA 3IKJA 1KC3A 3CUWA 1GITA 1EBUA 2WA2A 3M9XA 4DUGA 1K8XB 4J94A 5EKXA 5C7IO 4HGYA 2P69A 3JYOA 3O8QA 1ZCZA 2ECPA 2G80A 2EKBA 3B12A 3MM4A 5IAJA 1EK0A 4W8HA 3NGXA 4MITA 4E7PA 4XFKA 2GZMA 2GFIA 4I81A 2D2VA 2NU8B 3LP5A 1J5XA 4TV8A 1FSFA 4I9UA 1NUQA 3CLVA 2NO1A 4MRMB 4UREA 1YACA 1DXQA 2GFHA 3OQNA 3I6ZA 4HLNA 3WZLA 1XDUA 1GL6A 2YJNA 3EQ9A 1UFRA 2W22A 2X4DA 3SFTA 3HDYA 3K4HA 1WE2A 1WD5A 2E82A 2ZRKA 5FI1B 4LC9A 3G6KA 2R6ZA 3SEQA 2O6LA 5D00A 4BNZA 1T0BA 5U1PA 4DA6A 1XTPA 1WW8A 4IIJA 4RCVA 3RE1A 4DAOA 2HPAA 1BMFA 3C85A 5KX5F 2EG5A 2PUFA 2D6FA 1QYDA 3NDPA 4B32A 4O2RA 3DCIA 3PCXA 2FLVA 4RA9A 3UT0A 5K0BA 4KPFC 5LWQA 1T8SA 2YYZA 1AF4A 1CF9A 3HNPA 3K1AA 5E1OA 4AJ2A 1WVIA 2AN9A 3FLMA 4OQQA 3I2GA 3RUFA 3UQYS 3SIWA 5EOVA 1Y5IA 4ZAGA 2FX3A 3LAWA 2OB1A 4D0GA 1N32B 1Z15A 3B6MA 3VTZA 1Z88A 2EKQA 4Q12A 1SFRA 4ZGWA 1J25A 1PV1A 4N8SA 3VC3A 3RH0A 2JFGA 1UK7A 1VP3A 2P5SA 5AKIA 4AZWA 2VQ6A 1I51A 1K7EB 2YFKA 4HRYA 5CB4B 3QEAZ 4N18A 2ZJ6A 1ZKDA 5AK3A 4OL0A 1WO8A 4GICA 2HYDA 1GPKA 5DT2A 3V4OA 3GYBA 1MW9X 1VKOA 3IR5A 4P5PA 1U98A 1F20A 1E0JA 1VKJA 2COKA 2F43A 2OHXA 3LUJA 4HXYA 5EE1A 4MS3B 1CS0B 4C4ZA 1VKHA 2PZBA 2Z83A 5FNVA 1I6KA 4CLXA 4IICA 2UXCB 1KDTA 4UARA 3TEFA 4JYCA 3AM3A 3ZZUA 1Z2CA 1KO1A 1OI2A 2VHVA 3E27A 5ALMA 4YP7A 4EPTA 3N2NA 5DX1A 4FT2A 4YBRA 5FNZA 1U6KA 1IK6A 5EUMA 5JSZB 3A9VA 1OXTA 1QO0A 1U0GA 3QZUA 1D1PA 3A06A 3VVBA 1E20A 1F12A 4EHJA 1Y7TA 2V98A 5KWVA 1XO1A 1L4FA 1R18A 2H51A 2I7CA 2FSUA 2PQMA 2KBFA 3G23A 4GIBA 1N36B 2ODEA 1GTSA 1H3FA 3HU1A 2OV2A 1MO5A 2AUMA 4G1CA 1P62B 2OYSA 3L5KA 4F86A 2OFXA 1WD7A 1OC4A 3Q9UA 4Q18A 1NY6A 3DWIA 2A3NA 3UG6A 5ED0A 1G4UR 2X9LA 1F6WA 3UMVA 3MHTA 1NVWQ 2WJYA 1LPNA 3FETA 4A8JC 4L75A 4NYIQ 3SHVA 2W4MA 3R3WA 5A6SA 3IBCA 4MRPA 5DCLA 4PZEA 1OCEA 4RHEA 3QVUA 2ZG6A 1RWNA 3BK2A 2DQKA 4X3CA 4A10A 2PL9A 5LQUA 1XQ1A 1Q16A 3A4YA 3LPMA 3VNBA 4JFAA 5B37A 4Q66C 2BR5A 3FOBA 3VZDA 2PUAA 4M9CA 3TBKA 2J6HA 1ZC4A 3BAZA 1Z7EA 2P40A 3C39A 4K9KA 4MAAA 4DIOA 3TNLA 5HUQA 4J7AA 5FULA 4M0LA 4TSRA 1IM8A 2IYZA 1B8UA 1MIOB 5D87A 4DLAA 2VAMA 2QJRA 5B30A 4G9GA 2Z4RA 5JQWA 3PQDA 4FX5A 2R6CA 2Z43A 4ZO8A 1H2XA 1ZD1A 3U13A 2EKLA 4CIWA 5JDCA 3IQHX 5IVDA 2V7QD 3BZWA 1EQAA 1W75A 3ZIAD 2WWHA 2IU4A 3GEMA 1XROA 2J8ZA 3HCWA 3SDZA 4Z4CA 1IB6A 4A3SA 1T3LA 2Y93A 1XEWY 4MMZB 4ZT5A 2EG9A 3TLCA 1COWD 3OZTA 4YJHA 4LF9B 1O96B 1Y8QB 3CO5A 1W2GA 2ON6A 3GZNB 2EJBA 4KH1A 4ADSG 5FR2A 2R751 1C4OA 2Q28A 3GLUA 4K3UA 2QTVB 5KVAA 2WHRA 1IPEA 1YRQA 1T9HA 1UODA 2QR2A 3WLOA 5LM3A 2A5GA 3ZXYA 3GROA 2C4NA 4HNSA 3BIXA 2FUG1 1U0LA 2QTLA 4OA5A 4FMPA 1A5ZA 5ALJA 1K5PA 4ZU3A 1BA3A 4RF4A 4Y2HA 1P0PA 2YDYA 1IY9A 1L7QA 2C9YA 3ZE2B 5KSYA 1FW8A 1GG8A 1LFDB 3WFIA 1E6EA 4FDUA 5IEBA 4HNAA 2BHLA 2X9QA 1YR7A 2HF2A 2PGOA 3L6OO 1JSLA 3PC6A 4UUMA 4ZC1A 3THWB 3GVCA 3F0TA 4MKFA 4EL0A 1FDIA 4YQYA 4M8LA 1IHDA 3E9MA 4MCJA 2ZE8A 3JASB 5KYYB 3TS1A 1QVZA 2P4HX 4GEGA 2OAEA 2GPYA 4ND3A 3RU7A 4OJKA 3TPZA 2Q9CA 1NNSA 1Z12A 2ERXA 2QP3A 3REOA 5J2UB 5JZBA 5KYKA 1RJGA 1FIUA 5EE9A 4Q3BA 4W63A 2V74B 1N7HA 2A92A 3GRCA 4D57A 4YBZA 4O3MA 2BR4A 2GM4A 1JFSA 3SMVA 4U7GA 4WH0A 3VM6A 3GBSA 5DOZA 2ZFUA 1F8YA 4TMTA 4CTMA 4TXNA 4PFJA 1QHNA 4DMHA 3NHMA 3U60B 3BL8A 4GSLA 3BD6A 2OO5C 4UCQA 5SZJA 2GUWA 1G5FA 1GQOA 3F6SA 5L7YA 4JQYA 1KDYA 5BV0A 1V96A 1W1IA 4MJLA 2QN2A 1OKKD 3DZJA 2W2KB 5AJVB 4B4DA 3SJ7A 1IC6A 5I7RA 2I3BA 4DCSA 4RF3A 1LX7A 1IQRA 3Q7IA 4H08A 1PT5A 2XCLA 5GVRA 4PONA 5KSOA 3UENA 3C4VA 1W48A 1BVRA 3A9TA 3GJ0A 4KI0A 4G8BA 1R9GA 1CUEA 2ODPA 3ROZA 4DV6B 4QEDA 4YRNA 1E8MA 1VBNA 2LV8A 5AK6A 4F0JA 2BHNA 4BLTA 3TBHA 2ATCA 3S2YA 3D0KA 1D2AA 5EZSA 1HRKA 7YASA 2WV7A 3DAHA 1C0KA 13PKA 1C8KA 3KUKA 3IO5A 4UHJA 2XQKA 2DZDA 1NXVA 4Y9SA 4MQMA 3JAMA 1U1IA 4BNVA 4OKNA 4FJ1A 3DOEA 3DLCA 4E1BA 5KTRA 2VK2A 4W1QA 5LYJB 1Y5NA 2JF0A 1T6ZA 3KYJB 1PEAA 1P2GA 3SSOA 2FPXA 4IZOA 2WIAA 2NTVA 4DVJA 5PGMA 1F1BA 1KXJA 2G76A 1MBZA 1RRPA 2EBWA 3EUWA 3N0TA 4FKMA 4PX9A 5BN5B 3OFJA 5SZIA 5A03A 1CEEA 1LK5A 3BHNA 5ALEA 3HCFA 1YDMA 5AW5A 2ZI6A 4EY5A 2NV0A 4HGOA 3AVQA 3GFPA 3K70B 1SOWA 3DD5A 4H16A 4LYAA 3W5DA 1S8AA 1JJVA 4D4KA 4FKZA 3IQWA 1Q0HA 4UU7A 1CV2A 2GRAA 2RHWA 3UMSA 3VDMA 1E92A 1NHGA 3DMHA 5JD5A 1CR2A 1GTVA 3B51X 4OATA 1V5EA 1P1KA 1FQJA 4RANA 2ZTMA 1U8CB 1S02A 5CNKA 4MVJH 3RRXA 3OQIB 2RHTA 3V1MA 2NSLA 4RCYA 3U7FB 1EAYA 1D2HA 4EOGA 3THYB 2H7VA 3TPCA 1OH8A 2WAYA 3IQZA 4QVGA 2BFDA 1UWCA 2GA9A 3ET4A 1HDIA 4WINA 4OXYA 2IBSA 1JF8A 4URVR 1DXOA 1V5FA 4NICA 4NLLA 4CTNA 1RLUA 3W1WA 4KUHA 4FE7A 3IFSA 3UBMA 2CZGA 1QPGA 3MT7A 1FVOA 3R44A 2EBFX 4KYUA 3U4AA 2JH9A 3GEDA 2MYPA 3UJ3X 1P19A 1DIHA 1X7WB 2IKSA 1W4RA 3F74A 3VR1A 5J5CA 1YVPA 2VPWA 2PGLA 2YJ5A 2J1LA 3HWSA 3JTEA 3TTYA 4A0FA 1ZM3A 3FFXA 2B7LA 1SXJC 2VP2A 3RS5A 1TIPA 1E2UA 2VI5A 3O84A 4KIJA 3EBLA 4L0QA 4PSAA 3GLVA 4Q9IA 1E7YA 3IUSA 4LX0A 3M0EA 2P9FA 4QDKA 4MZXA 2SECE 3A2NA 4Y1EA 4KQ1A 3KSBC 2EZ9A 2ZZKA 2G5GX 3QEKA 2H6EA 3ECSA 4BMCA 1X3SA 2R7LA 1HQCA 1VBKA 4QOFA 4H18A 1I1QB 1DE0A 2XYQA 3GEHA 5DWDA 1XDZA 1BAPA 1MV5A 1OXSC 1V43A 2OAGA 5AIAA 5KWIA 2OZLA 1PJLA 3JXEA 3QYJA 1V4VA 4E5VA 4DJ5X 1R0CA 1K98A 3T34A 2WT9A 4LZJA 4YCAA 2JEZA 1Q22A 4GPEA 2ONZA 1JBEA 3DOJA 4GW3A 5IAAA 4BX2A 1V4BA 3LC0A 3NAGA 1K89A 1OD6A 3L4BA 4DDMA 1A4UA 2AEJA 2ZJ4A 1T5SA 1J20A 2J45A 5CD1A 3NO4A 1Z6ZA 2QP9X 1Y6FA 2C9ZA 1UOQA 1F0NA 1T4DA 4UUPA 3WMRA 2E9SA 4YV7A 3U3KA 1M5RA 3CH7A 3JARA 3SXJA 2FSFA 4LF7B 4QRHA 1MZPA 1TO6A 2W58A 4M0FA 3C7KA 4JMPA 2QENA 4FHGA 2VNSA 3LIPA 4BOYA 3QIAA 2RD2A 4JWKA 4HBZA 2Y2UA 1J49A 2B1IA 2IHZA 2OHVA 1V1MA 3T3GA 2V4MA 1Z0UA 2AEMA 4YAUA 4Q4HA 4TS4A 4U7JA 5J40A 1N6LA 4Q6WA 2IZ6A 4X6LA 4FINA 1KRHA 2J0VA 1XU7A 3T95A 4B2YA 4KK3A 3O3OB 1YC2A 2HH9A 3O74A 4HUTA 4IDOA 4BO9A 3LP6A 1QMGA 2PEYA 4QTXA 3R8CA 3OETA 2G8NA 3NHLA 1M72A 3BB4A 4K6GA 2PNJA 1HEIA 2DC1A 1HTTA 2DFNA 4NEQA 4EYKA 4OHBA 2JIMA 3ECCA 4W8GA 2ZOSA 2QL7A 1QAMA 4FWTA 2E6KA 2RH9B 4RHXA 3SX0A 2IL1A 1SKAA 2JJ2D 4MW2A 2WWYA 1JP7A 4DNPA 5E9JA 3LF2A 2IYYA 2WQZA 3T9AA 4EUKA 4TSKA 3KKPA 5CVDA 1F2TB 3SF8A 2GZHA 3ZDYB 2P9EA 2O8FB 2F8MA 5ECGC 5TSDA 3RYFA 2ZIFA 1BU5A 1CZNA 5IBCA 3NETA 3ZC3A 3SZMA 2TMKA 4CJXA 4CN8A 2AYXA 2EYQA 1I8TA 1L3CA 1E4VA 2WAAA 2VHJA 4HXFB 4WA7A 3WLMA 1T5HX 3TRDA 4QVKA 2GAOA 3HZOA 1QHFA 4LJ4A 2ZUTA 2I7TA 3ONWA 4URXR 2IZ0A 1P1FA 3HI4A 3IGFA 3M9LA 3PQ3A 4UBNA 4UM7A 5IYZB 2FR8A 1DOZA 2YIMA 3S5JA 5CDGA 3OEHD 4GQBA 1VMEA 3L07A 3ICVA 4PC6A 4XTCS 3JX9A 5I7OA 4IJKA 3DBRB 3G2QA 4RFVA 5HSGA 2VJQA 3R5SA 2FMUA 1KI7A 4RK6A 4LNUA 1XEXB 4NEHB 2C3UA 3ABQB 2RH5A 5K0SA 2ZJ8A 2UYQA 1DKMA 1ZK3A 2EIHA 1AXEA 5BSMA 1ZITA 1AGNA 2JGDB 3CZMA 2EFYA 4B3MB 4MVJA 4HDCA 4MW1A 5IHPA 2JRCA 3I6IA 2QMEA 4L85A 1VKRA 2NOAA 2WDZA 4NQZA 2VK4A 2QVZX 4S1NA 4CR6A 1RXEA 4DS3A 2HUPA 3K35A 2G5PA 5SY9A 5JRDS 4TMXA 4AMBA 3SDSA 3SI7A 2AVNA 3OTHA 4EI2A 3DKIA 4CKYA 2JASA 4ZYWA 2N3ZA 1JXMA 3IERA 4ETMA 2J09A 1VLJA 1EGVB 2C4TA 3QBEA 4KI7A 4QARA 4WKNA 2ZE6A 4PU0A 4YPFA 3VQTA 1U5AA 3WIBA 2A1TS 1PL8A 1V16A 5AW4A 1DMRA 1E7SA 1FP4A 4F04A 2B8NA 1MW8X 2OHGA 3R9XB 2QRPA 3PQEA 1KDPA 3TH5A 4EHDA 3V46A 1H2YA 5G02A 5HJ2A 5MFPA 5LL6P 2ZBVA 2MINB 4Q3CA 2KWIA 4P32A 4MLPA 3IDZA 2B1RA 4RIGA 3ANYB 1E5QA 3VUEA 2CUNA 1T36B 1U9IC 2PWBA 3IQXA 1PWEA 3RYHB 3UCFA 7GPBA 4KU4A 3CLUC 3RTAA 3TOZA 7ADHA 1ZUNA 2F1KA 4JXJA 3CX8A 3ANSA 2I4RA 1H23A 3EXAA 3TM5A 5BUQA 2J9GA 5HMMA 4TLAA 5PNTA 1RJDA 1VLVA 4QG7A 4C4TA 3C3AA 1CQZA 1XXLA 4RADA 2G7MC 1YZYA 1JAXA 2X4GA 1V3QE 3D7RA 2R87A 5DHUA 1A5AB 2CZCA 3C6QA 1D2CA 1ZH2A 2H2HA 2HJVA 2ZJ7A 5I9IA 2Q6VA 5ALNA 3NTXA 3K15A 3FE2A 3O91A 3DPUA 3OWHA 4KWHA 1J2JA 4UAVA 3KQPA 1I1OA 3TMAA 4LJYA 2VFAA 3E0QA 1XZJA 2VJLA 4BNNA 3NBMA 4DIBA 2Y0PA 1ULZA 4CRWB 4QTYA 1X7GA 3B1KA 1A4RA 4Y9TA 1QHGA 1MFPA 3A1SA 1VPTA 4GWGA 4MAFA 2IYNA 5AKJA 3NGLA 1WPGA 1TM2A 1OZGA 3TFWA 4R0MA 3OA0A 1OLUB 1ZM2A 4TSFA 2E4YA 2BFBA 1EJ6A 1OJLA 3CLRD 4J43A 3TDKA 2WUEA 1M0WA 1Q7BA 1QH9A 2MR5A 2YC2C 1O77A 4ZOLF 4QYXA 5K0LA 1W25A 4NPCA 5AM3A 4JMLA 4NCIA 1QOZA 1W29A 2Y71A 1U9ZA 3RGGA 1NJ8A 1TT5A 4KOAA 1SC9A 4MPJA 3P0JA 2CN1A 8ADHA 1H8EA 3T61A 2WFMA 3DZCA 3ZXIA 4DSAA 1NL3A 1FK8A 3RS4A 1R8QA 2IUUA 3U49A 2XMDA 2FVXA 5BT9A 4B8ZA 3ROQA 3VNAA 2RHMA 1I9GA 2TMDA 1X38A 3QWFA 4X92A 5F4BA 4BVKA 3NIGB 2H2IA 1XYVA 1GZ7A 2HRBA 5IKXA 5F35A 1Y3DE 3NANA 4HC4A 2A67A 1K9SA 4QULA 4MO9A 1KMCA 1IBRA 4ARUA 1XAJA 4OXXA 4E3WA 1R4NB 3OO1A 1CUYA 2CDRA 4ENVA 4RD4A 2XCTB 5C1OA 3PRYA 2VDPB 2XUGA 3E0XA 5JI3E 2WTUA 1GUDA 4X7MA 5K9ZA 5DGTA 5ECYA 2R6AA 2QT1A 2OCIA 2HM7A 3PLRA 4MGYR 5EIBC 2CMHA 2FW9A 1E2EA 1MO4A 1H2BA 3I76A 4MPTA 2RGGA 5CW2A 4NPAA 3TNDA 3U3RA 1GD1O 2BFEB 3MWJA 3QXXA 4MVYA 1TRHA 3RVBA 2Q7OE 2O50A 5CFOA 4RTSA 4RE6A 4U00A 3KQNA 4OJYA 1OI3A 2IF0A 2WUVA 4EJSA 1E3QA 1ODIA 5JR3A 1R37A 3LVRE 4BFCA 4F12A 1Q0TA 3X44A 2FSPA 4ZT7A 1N3LA 5ALVA 1GGVA 1R6UA 2AA3A 4LCJA 4BKRA 4EQ6B 2XEDA 3C3KA 2VAPA 4RE5A 2V7VA 4Y0AA 3CLSD 4B6PA 3VR5D 3ZHQA 2JCYA 4CIXA 2ZIXB 4BX0A 1A8IA 4KMMA 2Q2OA 1OHHA 4LBYA 3M5PA 3KHTA 5CVUA 3U4CA 1EFRD 4G5RA 1VHWA 3N86A 3TW8B 1BXRA 1PR1A 2RK3A 1U0JA 3UK6A 2ZQZA 2I67A 2WNSA 5A5FA 1YE8A 1G4AE 3FYCA 4TQAA 3WXBA 1IXKA 4FLEA 1DKQA 1JIVA 4AMVA 3ANNA 1ZPDA 5CA1F 1OZHA 4IO0A 2RBKA 2IUEA 4WFIA 1I2AA 1TCVA 4CQLB 3EIHA 3ZY5A 4ZHQF 2Y1FA 2BKAA 1UK9A 1PZNA 4I4TF 2DJIA 5EFZA 4DLKA 1XP5A 1A04A 3LZDA 3L7MA 3R1IA 4YJ3B 5KHAA 3DBIA 3ETDA 4OI1A 3UJ7A 1DC6A 1AB5A 3KPUA 1I80A 2JK1A 1LWNA 2LWIA 3D5QA 5K0EA 4A8TA 2Q7DA 1KYZA 1WOMA 2D00A 4TYNA 4R9UC 1NVDA 5LZ2A 4WAUA 1I0IA 3PWZA 2PLRA 5BOSA 2B8WA 2CNWA 3QEOA 3VR2D 3ONFA 1JG2A 1ZVMA 1RXSA 3UFXA 1PHRA 5JNRA 5K2OA 1K7CA 1YUBA 3C4JA 1N2ZA 2D59A 1UDXA 3MJSA 1NOKA 4RENA 5COAA 5DULA 4YMUA 2UZ4A 2JIDA 2XSZA 1C8BA 1T6YA 3LRTA 5HKOA 3OLZA 1TQ8A 4IVRA 2ATVA 4D4HA 3A0RB 2OD7A 2WYOA 3F1LA 3V1TC 2VJAA 4DT1A 5KS2A 5BN3A 1GQYA 4ZU1X 2I4IA 3UTCA 4ZJUA 4OX9Y 5DEOA 1O7JA 2OD2A 3FIJA 4FSDA 4PS1A 1JR6A 2JDIA 2PSSA 3X1YA 3AONB 1DFGA 4LOIA 2Z6VA 4YJ2B 5IPFA 2IS4A 1IXRC 1XZPA 2JGIA 2ZT5A 1NLMA 1DBRA 3AI1A 2E4VA 3CNHA 3K8YA 1XRSB 3TRHA 2PZGA 3QYFA 2OO3A 5C8YA 5F9FA 2RONA 2JARA 2KQUA 3QLUC 4H7IA 4JP8A 3WGMA 8GPBA 5L3ZA 3W6NA 1Y1SA 3DW3X 3G9ZA 3L7DA 2OBLA 2QUAA 3OD1A 4LYEA 1ZICA 4OFXA 4MWSA 4PSUA 3NIWA 3CEAA 3TIFA 3VOTA 3HUUA 2AZXA 5FDFA 2XWSA 2JLVA 3VC1A 4AW9A 1C3EA 1J5EB 1E94E 2M2IA 2Z1NA 2Q29A 5JQGB 1GZ5A 1RXWA 3EQ7A 4OK3A 4EHFA 1ISFA 1DJLA 3QPVA 1XVVA 1H2ZA 3N0RA 4OHFA 4P1ZA 1GNSA 1JAYA 3CW9A 4FE4A 4EYGA 4GS5A 5JCPA 2YICA 4OFBA 4YGXB 3RNLA 1Q77A 4IIEA 4BHTA 4RTQA 2X1LA 2GJSA 4WADA 2KMLA 2ZT6A 1SU7A 4V3BA 3Q1LA 5IDVA 1T1SA 1QDLB 1OVGA 1VCNA 4NBKA 2VCEA 4Z9XA 4QTUB 3SSNA 1ENPA 5B3KA 5HJ7A 3GLIA 5IKOA 3DW1X 4CMEA 1Q5PA 1UPXA 1SVLA 2C9OA 5KJCA 1FRFS 3NJ4A 5DXJA 1ZOLA 2YH2A 3R5JA 2VZ0A 4EENA 4IR7A 5I5EA 1M0EA 5JCXA 4ZGGA 1VG8A 3P2YA 5EHXA 5F52A 4Y18A 4CYMA 4O6VA 4OTZA 2O2EA 1UBJS 2ZXEA 2RSLA 4JYBA 3WBBA 5K99A 1YGPA 4Y8VA 1NBHA 3CUVA 4R2HA 1AMUA 1IEQA 4IY1A 1VJGA 4FMBB 4XWTA 5IJ9A 1FLVA 4XB1A 1YI1A 3RABA 3WMFA 5K3AA 2Q6LA 5LBUA 1XMQB 1NM5C 5CA0A 2L18A 4Z7OB 1Z6QA 1UC5B 3OHPA 4B44A 2VXCA 3IAM6 1U02A 1QV7A 2C9MA 2O1EA 3R5KA 4V0NA 3H2HA 5H0IA 4DSNA 5D6NA 4Z4QA 4JI0B 4GF5A 2XNHA 3JZDA 4PG7A 2H85A 3CIOA 4BVHA 5FV4A 2OBXA 4PPGA 1FDVA 3A6FA 3LQ4A 1U31A 2Y99A 1T9DA 4YFYA 1ECJA 3A6HA 4Y7CA 3USES 3THXB 4HDKA 4PSKA 5JCJA 3GW8A 5HF9A 3PICA 4X7RA 2I6SA 4YJKA 5DTEA 4X7BA 2QJWA 1T6NA 4DLBA 2LP4Y 3DWFA 4WQMA 2RBGA 5B58T 3Q7EA 4E5PA 1E1QD 4G5OA 2WD7B 3C5CA 1MNQA 3H84A 1JHXA 2BBOA 2JHAA 5ECDA 2B5VA 3FB1A 4UCFA 3DE1X 4RPCA 3PJFA 4MR7B 2HY7A 4QQ8A 1MOSA 3B36A 1F4PA 2OOKA 1C0IA 3EH1A 4HDRA 2Y77A 4IHKA 2NM0A 4O0MA 4C0JA 1KEKA 1C14A 1R5JA 3WRYA 2QHXA 3DL4A 3OIYA 4KR9A 1Z0ZA 3EWIA 3L93A 1TMOA 4IOJA 1AQYA 1T3HA 1GGEA 3RAJA 3A3PA 1XDDA 4JGGA 5JMPA 1YJ8A 2C5SA 1GHTA 3HADA 5EZ5A 1E2BA 2OBBA 4OD0A 3AR7A 2IHUA 2E4WA 3IHLA 4FONA 3ZY2A 3WHLA 1MGPA 2UZ1A 3GPCA 3H8VA 3WIOA 4AULA 4E32A 3ISTA 3E15A 1DSSG 3FX2A 1WBDA 3E05A 3ZW7A 4KR6A 2BFAA 1U9CA 3DTNA 1GAJA 3LBFA 4R0NA 2ORYA 3GP5A 3Q6MA 4IDEA 4ALJA 2FRDA 2ICAA 2FETA 2FTKE 2P9TA 2Q0QA 2J3DA 3HCOA 8LDHA 1A4IA 4XB2A 5LQMA 2QWXA 3KFLA 5ALZA 2W0MA 4GZLA 3WP0A 4MWGA 4QUJA 3L1VA 4YAWA 4A15A 4JEMA 2R1VA 5FTLA 1XTUA 3H2YA 4I99A 1OAOA 1S3SA 3I9FA 3LT2A 1R50A 2AK2A 2YHUA 4IXNA 1XHLA 4ARVA 1TUEA 1V0JA 2ZBFA 3GLHE 3HN2A 3C48A 2VA8A 3BMXA 1Y7LA 1URPA 1NMXA 1NE7A 5FPHA 4XVHA 3H0CA 4XJXA 1IY2A 5AIBA 2FK8A 2GHRA 2HBYA 1H6CA 5D1NA 3RARA 3U4DA 2GK6A 1XE3A 3QJYA 4EW1A 4ZA2A 3NV7A 3ZX5A 2V7WA 3KWFA 2YWFA 2AD1A 3FSGD 3CONA 4F1KA 2C7PA 2PBRA 4PW0A 3S5UA 4QQNA 4ZAZA 5DHQA 4PNEA 2MMCA 1NZDA 5IUNC 4UHCA 2AV6A 4D3YA 4Y1RB 3TLJA 1DO2A 2BLLA 3L1HA 2GS9A 3KD3A 1XB2A 4C5CA 3WMGA 3K9LA 3ZI7A 3TRFA 5TPWA 5GGXA 3TI9A 4ODIA 3KE9A 2IZ7A 2OXIA 1FCJA 3KOWA 2QLFA 1CRZA 4E5MA 5DYWA 4Z49A 5JYBA 421PA 2FR0A 3TDMA 1CUIA 2YYSA 3F9IA 2EFEB 1TTHA 3R5TA 4XVUA 3FDFA 2VKTA 3H5VA 2A9OA 3S8MA 4QUEA 1VLZA 5KQGA 3A3OA 4EX7A 5LOVB 2NG1A 5DN9A 5TR9A 4LE2A 3ZCVA 1RLTA 1LPOA 4KXNA 1LQ2A 4QLAA 3WYEA 1UZNA 4WY8A 4BQSA 4B3BA 4MQLA 1FXUA 1XZQA 2HJHA 2B1QA 3WZ2A 2K7FA 3ZYCA 1BEUB 3F7TA 4M7PA 4P4GA 3P96A 1GA6A 4LJAA 4OMUA 1IEWA 1MB4A 2A58A 1Q83A 1RTTA 3PPYA 5DWVA 1CSEE 1Y3IA 2PXAA 1EWYA 1SXJE 2WWFA 3PDIB 1TD9A 4QWWA 4ZZ2A 4OM8A 5HW0A 2AR0A 3SR3A 3T3DA 1YE3A 2O2JA 1XK6A 1H85A 2P1ZA 2PO5A 1EX7A 3K1YA 3NTUA 3R3XA 2I8LA 2XOXA 5JS7A 3VR3D 4ALLA 4LN1A 2Y9PB 4LFAB 5F33A 4GI5A 2OEPA 1XDSA 1LS1A 1X1DA 3A58B 3ORFA 3VH2A 1Z9BA 4YP6A 2WB4A 1FSZA 3C6ZA 4OQDA 4RH3A 1E6UA 1T43A 5EMJA 4BUCA 4EEXA 1UQTA 1XEAA 4IDGA 5TLSA 2CNLA 4O1MA 1QKJA 1N33B 4UHFA 4BFTA 1DHTA 3VPHA 1JR3E 1PRYA 2JJ1D 3NWBA 2EIXA 2NO9A 5CB4F 3FKSD 4JJFA 4CEIB 4C29A 4FM9A 3GEBA 4M38A 3EA4A 3GN2A 4K9OA 3W7VA 1VMAA 4MS1B 4DR4B 2QAGA 4ZQFA 3L8FA 3AKDA 1TGYA 2O8DB 1RU3A 2OCBA 2Q8QA 2XMBA 4L6IA 4Z3DA 3OLXA 4CQMD 4HF7A 1DKNA 1UC4B 3QVMA 5DMXA 2HWKA 2PLNA 2DBYA 1OYWA 4XYMA 3N6VA 4G23A 1VE3A 2HK8A 1MQSA 4AAYA 4F11A 3O75A 5KCZA 2PS1A 1QB8A 4CVNA 4C3ZA 1V7CA 5ALIA 1Y9DA 2V96A 4UE3S 4W9NA 3UJHA 2X4IA 3ZHVA 5KNCA 4LOHA 4KQHA 2IYVA 4YJGA 1QKKA 3QFCA 2H0RA 4LJLA 4TKUA 4EARA 1ESNA 1DBPA 4GECA 5K5EA 4CXMA 2D7DA 3HNRA 3X2EA 3L43A 1YB6A 3F5QA 2V4ZA 4O2BA 1KEWA 3ETCA 1CEXA 4HI0E 2JH3A 4RHFA 4CDNA 2Z8YA 3CH5A 2FFAA 3EZ9A 1UPCA 2OFPA 2Y66A 1KVUA 1AQJA 1KTIA 1XZ8A 2LCIA 1MAWA 3O8CA 2H06A 3U81A 2YZ2A 1IHUA 2GJ8A 3JQ7B 4YECA 1USIA 1GU7A 4QFMA 2CXQA 2TRSB 3OZFA 4KLCA 3AVPA 1DFIA 4J4TA 5BMVB 3OT4A 1B6SA 1SHZA 1DEXA 2IPAB 2VDLB 1O95C 3AJRA 4FMDB 5HK8A 1ZK1A 1M34B 3VTKA 5IX8A 4JJAA 2NU7A 3D2BA 1GZVA 2OV1A 4UNRA 4LMRA 3GCZA 2JNWA 4IQ4A 2NYUA 4MWOA 2OAQ1 2AOTA 3HJTA 3ESZA 3NM6B 2OYCA 4WBSA 5IAGA 2HMWA 4D80A 4I1SA 1K6IA 2X9NA 4WASA 1XTZA 4A26A 1TTPB 4OB8A 3TTUA 3ZW9A 3M6FA 4U6NA 2I22A 4R1TA 3DO8A 3UMYA 4CDRA 4C20A 3ZYZA 5IJWA 3H2BA 1UDRA 4BCDA 4OY3A 2P2ZA 5EA2A 4TTIA 5F78A 1P9WA 2P35A 5BNWA 2VDWA 2GHTA 2O7RA 3A9WA 3PFGA 2PBFA 3QFTA 2ANBA 3QPAA 3HP4A 3IMCA 4JOSA 1KAQA 5EJMA 3WI7A 4D4IA 3CBQA 2B92A 5HF6A 1OC2A 3B1JA 2ZIUB 4F8JA 4J0CA 4X91A 2RGWA 4C0HA 3COYA 2C04A 2ZJBA 2X7JA 3H99A 1BC5A 3KR1A 3TFQA 5CFPA 1QQ6A 3A9SA 1VPEA 2ENWA 1KZ4A 2QRMA 4GLOA 4JB0A 3T4EA 2NUAB 3BFXA 4D98A 4DQKA 2F55A 4HR7A 4AQYB 3KFXA 5DP2A 1N2OA 5TQ2B 3KRTA 1J5PA 3U3XA 3UWSA 1J39A 3PXCX 2IELA 4Q9AA 5JUWA 3VKGA 5JS1A 4HQ6A 1U8UA 3MAAC 4FYPA 4JP1A 1T6BY 4AN0A 2W6IA 5I8ZA 1Y63A 2A9JA 5JNSA 2BUCA 2W11A 3HDVA 2E4ZA 3EC7A 4XLTA 7REQB 2GBFA 5ITWA 3WK6A 2XOKA 4L76A 4QQRA 3A1VA 2ZQ5A 2O8BA 4HB4A 3WDMA 4GXTA 1ATZA 2BM8A 2JKYA 4P92A 5G4LA 4V24A 3VYTB 3IAFA 4DBLE 5BUZA 3H2KA 3LJKA 5AXAA 5J2UF 2ZJ0A 2ADMA 1SUFA 3GVHA 5DBHX 3TZCA 4E08A 3GQBB 2DLNA 3W3AH 5BV8A 3MJTA 1DZ3A 2DUNA 4D9CA 4R8KA 1JSZA 4J3JA 5BSEA 3KJGA 2O52A 3O0TA 4TKMA 2P65A 1KZ6A 1LPMA 4D3FA 4MUEA 1ZJ4A 2PK3A 3JQEA 2D1TA 4YP0A 4JOBA 4C01A 4EECA 4KITB 4MYUA 2B25A 2HSJA 4WW0A 4ND8B 2YVLA 2J4FA 3PLAE 3VO8A 1B0AA 1X9IA 2JGLA 3P9RA 1QHEA 4GRDA 1YBHA 4AUMA 3C7CB 1JILA 2P9GA 5BR7A 1QTQA 4V3CA 4OYRA 3KLPX 1NIJA 5BXQC 3S29A 2G08A 2PWPA 2RHDA 3JQBA 4G1UC 2FZLA 1WXWA 4FDVA 3VI4B 1X7ZB 2HL6A 3OIVA 5D85A 3WIEA 3BDVA 4RK1A 4GL2A 4A92A 1UBFA 2CF6A 4J03A 5C5DA 3Q2IA 2WYHA 3MWKA 1J0XO 4EKEA 3AHHA 1XI2A 2DGDA 2YYAA 3KV1A 3W4JA 1ZH6A 3GNSA 2DR0A 4CT0A 4HXEB 1TYAE 2ZTLA 1QCCA 4MUJA 1FX0A 4N40A 5LYJF 1JKMA 3OH8A 1UUFA 1JLKA 4LZNA 3T1TA 3FH0A 3CN9A 3LX8A 3N5KA 3SR0A 4J1QA 1VL5A 1ZJZA 1PNRA 4NJEA 1SXJD 3DOFA 3JQFC 3N2LA 4CU5A 1J21A 2GJ9A 2HJ9A 2QD5A 2P0AA 1ID8A 4RGQA 2AD5A 2BEWB 2XKAA 2HZBA 4ZCTA 3OTIA 1TC2A 2CW5A 3HJRA 5KTYA 1EGQA 2GILA 3WNDA 1Z4IA 1BDMA 1QHYA 5G4KB 3DE5X 4PBSA 1OBFO 2FFRA 4MKHA 5I8PA 3EIWA 4J1SA 3WJ7A 1QHXA 1CIVA 3CYFA 4FB5A 1H93A 4Q9DA 1Y42X 1J2YA 4UZFA 3E9NA 5CT5A 2KE5A 4QYIB 2WF6A 3GRFA 1KSGA 3QXGA 1SA0B 4R1OA 2TYSB 1SQSA 4KWEA 2CVFA 5ER6A 2GVZC 3RC9A 2WP0A 4CEHB 1FFWA 3BJMA 1M10A 4RXTA 1LW6E 2NLOA 3ZHCA 1UT5A 1ZNYA 2P41A 3ZY3A 2YN2A 1NVUQ 3CX4A 4KRFA 3NBXX 5ENZA 1TF2A 3STXA 5K09A 3A11A 3L0BA 1JIQA 4JQZA 4WN9B 2EF1A 1LZLA 3BGVA 1T34A 2YNMA 5FTKA 3O0DA 1U28C 2WWVD 1SBNE 4O5OA 1ZZEA 1R8YA 2D62A 3QF4B 1C1XA 1DO0A 4OMDA 4H4DA 2IP1A 3C98A 3NATA 1KQGA 1DBVO 4J16C 3MFQA 1DLJA 3DZDA 1YHZA 4HD8A 1WZUA 4O4HA 521PA 3WK9A 4D9FA 3K6SA 1U3TA 1ISPA 1DEHA 1JEAA 5ALRA 4YO8A 2IYRA 3H83A 1KYVA 4H2DA 2OHIA 1EXNA 1U5BB 2XQVA 3R0QA 3CVVA 4KTTE 1RWMA 3ONEA 5LU9A 4XRGA 1TM3E 4WKPA 2HD4A 4D92A 1RW4A 3I58A 1SCUB 4WD3A 2C78A 3HSSA 3TMKA 3UAZA 1H8HA 4RLHA 4ZIRA 1CUZA 1U0RA 5KZMB 5J2TA 4Q9JA 3MUNA 3H8WA 1XALA 3SQDA 1BWRA 2PMKA 2Q9UA 2AEEA 3IV6A 4GM4A 4Q48A 4RQBA 4P0QB 4DG9A 2PD4A 4JBNA 1C81A 2AB0A 3P9KA 1RPTA 3OVMA 5AKHA 1IXSB 1EJ2A 2YIVX 3NWEA 1KOGA 4WVLA 4EW2A 2Y1OA 3GCDA 3QU4A 1UH5A 4XE5A 2OZEA 4K2HA 5EVCA 2C59A 4LV8B 2J5QA 1CJMA 4IH9A 4JASB 4TWAA 3G5LA 4BE9A 3H19A 1J2TA 4HEJA 2BMDA 2QXTA 4R68A 3RODA 3GFRA 4Q3OA 2IV7A 2XQGA 3OFVA 1DJQA 5EXDA 3CE9A 3GD5A 3D2CA 4Z8XA 4A7PA 1LUAA 4YRZA 2VXYA 1NURA 4HH3C 1DDOA 2PMDA 4BFXA 2X2PA 4MV1A 4EAAA 3DHWC 3CPEA 2X8BA 3OX4A 4GOJA 4S35A 1ZD4A 4DCOA 3OOWA 4ZCRA 1VA5A 3HZHA 3W2HA 1EE9A 3NBZC 5E95A 4OHWA 4W4TA 4Z4EA 3FSRA 4HQKA 3ILXA 5T64A 1P0QA 5DBEX 1C41A 2BGLA 3TLEA 3LXUX 1YS9A 1QZUA 3IO3A 4LRQA 3RT7A 4EH1A 4KN5A 2RG7A 2PRIA 5J23A 1SVOA 3HQ4O 1O8BA 3OT5A 4LPKA 1BMTA 1CQIB 1CF2O 3B6IA 1M0TA 1DQYA 3X1MA 2O3UA 4Q4JB 3V2HA 1WXIA 2Y8EA 3G8CA 4C0WA 4HH0A 2NZ2A 1T8UA 4OKSA 2K6GA 4KR0A 2R8ZA 2RFLA 4ZHSA 1M9NA 2HKIA 2HXYA 5EE0A 5LNK6 1SKQA 4NJMA 4CG3A 3FYTA 3PXGA 2BGMA 3IALA 1SHTX 1QHHA 2V3WA 4LXIA 2FWRA 2XHZA 1R4ZA 1HT0A 1C7RA 3KR2A 2HMAA 2WZQA 1WMEA 1Q1NA 2LW7A 3E9DA 4BO0A 1OASA 3SNHA 4M21A 1NDHA 3QVOA 1Z5UA 4YMHA 4NVRA 2L17A 2V6IA 1KEEA 1FP1D 3COJA 1B73A 4MI9A 1JRLA 2R60A 3OQPA 1Y81A 1WDMA 5D84A 4G1FA 5D51S 1Z07A 4D0LB 2QV7A 1J6UA 2G4VA 1UBHS 1JAHA 2D4AA 2VHXA 4BJ6A 2IXFA 4HHEA 3JRNA 5C52B 4Q1DA 2ETVA 3NAZA 3AR6A 4WZBB 1N5JA 4I9FA 3IUJA 2MU1A 4HEA6 1W4BA 4RL6A 5KMGB 3KP1A 5F9MA 3DCJA 3H9BA 2O8BB 1AGYA 1SUCA 4FIZA 3MXTA 4YPOA 2R3SA 1V9CA 4IJUA 3QVSA 4PR0A 5TF4A 2VQ3A 4PCUA 3CLUD 4GX5A 4TS3A 2ZRJA 3M2TA 3UJDA 1ZD2P 2FNAA 4I5DA 4KQ6A 4O02B 3QG5A 1GV0A 2Y1XA 3LQYA 3CWQA 4RZ3A 4UASA 3F47A 4DMRA 1HH4A 2IYEA 5DNYB 3BCSA 4R84A 4CV2A 3BIJA 3TSOA 1MNAA 1NBMA 3R75A 4IGAA 2B36A 5B53A 3FHOA 3IEPA 1TU4A 5KYUB 2HV9A 2H65A 4GBGA 2O8EA 3NM5A 4U1RA 5CGZA 5CLHA 3RYIB 3HVRA 3OF5A 1PE0A 1UBMS 3WLPA 1CQJA 5JALA 5M04A 2JB9A 3DXYA 3CINA 3HB9A 5BYJA 4M0DA 3GRYA 4X95A 4XM1A 1O94C 4DF3A 1WEKA