1FYEA

Aspartyl dipeptidase (anisotropic b-factor refinement)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
220
Chain Sequence
MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNTREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTYL DIPEPTIDASE
publication title The structure of aspartyl dipeptidase reveals a unique fold with a Ser-His-Glu catalytic triad.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Hydrolase
total genus 73
structure length 220
sequence length 229
ec nomenclature ec 3.4.13.21: Dipeptidase E.
pdb deposition date 2000-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03575 Peptidase_S51 Peptidase family S51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fyeA00
1QDLB 2VXOA 4UZSA 3WFZA 3P9QA 2YWCA 1C30B 4QYXA 4R7GA 1P5FA 3SOZA 4GUDA 4N0MA 1R9GA 1Q2UA 2NV0A 1G2IA 3PQ2A 2RK6A 3CY6A 4S0ZA 1WL8A 1Q7RA 1VCMA 3TTWA 2YWBA 1QVWA 4ENQA 1P7YA 1I7SB 3PQ8A 3TTSA 3NONA 3OT1B 4ZDKA 3BHNA 3PQ3A 1GPMA 4P34A 1P7ZA 4MNTA 4B2YA 3P9PA 4UCFA 3PQ7A 1CS0B 2R1TB 4QYTA 1PV2A 2XF2A 1OX4A 3TTYA 5BV2P 2V4UA 5E9AA 4GE0A 1VCOA 2AB0A 1JVNA 2A9VA 3P9SA 3PQ4A 3SF8A 3CNEA 1P80A 4AULA 4OGGA 1OI4A 5LIRA 2YWJA 1OX6A 3EJ6A 3CZ9A 1PDVA 2VPIA 1KA9H 3B36A 1N57A 4WXYB 3UGJA 4L7QA 3TTUA 3L4EA 3RHTA 1CE8B 1I1QB 3EWNA 3EZGA 2WJZB 3NOVA 4MGHA 4WINA 4Y0NA 1O1YA 4B7AA 3BWEA 4ENRA 1KWKA 3B38A 5JZMA 4BTEA 3R76A 2ZUUA 2ZUTA 3B3AA 4P36A 4L8YA 3PQ5A 4ZDIA 4OGFA 3OT1A 2VDJA 1SOAA 2H2WA 1J42A 3ZR4B 3ER6A 5SY9A 2R1TA 1FY2A 4UNIA 2AD5A 1QVVA 3EN0A 3PQ6A 5IP5A 4I4NA 2ZUWA 3M3PA 3P9RA 2NV2B 1PE0A 1GGKA 4L78A 4ZGGA 4L8FA 1P81A 3D54D 4D1YA 2GHRA 3FSEA 4GE3A 1FYEA 4OIFA 3NOQA 1IZYA 4OFWA 4P2GA 4RKYA 1T36B 5SY6A 4N12A 2R1VB 4ZDJA 2GK3A 2W7TA 4L95C 4AUEA 4B5KA 4E5VA 3UOWA 4ENWA 1KEEB 2VRNA 3TTTA 4LRUA 3NOOA 3ZJ5A 4HCJA 1GPWB 1M6VB 4K2HA 4AJ9A 1VHQA 5K4AA 4OJYA 4P5PA 2RK4A 1IZZA 1OY1A 1IPHA 1QWSA 3NORA 2R1UA 3CYFA 2VKTA 3F71A 1U9CA 3R75A 4AUNA 5DFAA 1S1MA 1GG9A 3R74A 1A9XB 3N7TA 2ZUVA 3TTXA 3ZJ4A 2YWDA 5JZOA 4OQ4A 5SYAA 1GGJA 3FIJA 1KWGA 1L9XA 4L8WB 1CF9A 4P35A 4ADSG 1BXRB 3L3BA 2D7JA 2ABWA 3L7NA 2R1VA 4BIMA 4ENUA 4ENSA 4MTCA 1JDBC 1GGHA 4B31A 3UJNA 1QF7A 2IUFA 1OX5A 3NVAA 3TQIA 4Y1RA 4UOZA 1K9VF 1VCNA 4UOQA 4JQSA 1T0BA 3MGKA 4ENPA 2LXNA 4Y1RB 2ISSD 4PXYA 4Y1EA 3VU3A 3CZAA 4Y1GA 4XLLA 4B40A 2RK3A 4AUMA 4ENTA 1UCFA 1GGEA 1GGFA 1T3TA 2OR3A 3TTVA 3EFEA 2FEXA 4Y1FA 4LGYA 4E08A 4ENVA 1C3OB 1ONSA 1PDWA 1SY7A 3KKLA 1QVZA 1OX4B 3F5DA 3MIIA 1KXJA 4I2NA 3L18A 4BFLA 4I46A 1I7QB 3UMMA 3UK7A 4RKWA 2ZUSA 5SY4A 3SF8B 3GRAA
chains in the Genus database with same CATH superfamily
7ADHA 3W8FA 5DXFA 5HF9A 5INTA 1QO9A 1R9NA 3QJGA 4R1OA 1QH9A 4ZCSA 2QZPA 4DA4A 3CE6A 3L0SA 4ZAFA 2G1JA 3QNUA 1K5HA 3GLUA 4FLFA 2WUWE 3WZ2A 4DV6B 3O9MA 3M34A 1CUUA 1MJGA 1EXWA 1RQ7A 3QW4B 1AKNA 3NTQA 4WN9A 4AWAA 4WZBE 1Z5PA 4V0ME 1O2DA 4EBFA 1I3LA 3AONB 3PNPA 1QB7A 2YRWA 3L2OB 2NVBA 3QTBA 3VJRA 1T8RA 1YS4A 1E7WA 4BTVA 4YUAA 1AX9A 2DFTA 5DXJA 4WCFA 1DIBA 3OHMA 5JEEA 4J29A 4ZQCB 3UMYA 2A3RA 3MINA 4E33A 2BCEA 4R8KA 4K81B 3DWEX 3DBHA 5DJ5A 3IR7A 5EYPB 1FLNA 5IM4F 1USVA 2A92A 4LQDA 3N59A 3W6OA 5FI3A 3DVLA 3TPCA 4CTKA 3WVNA 2JCSA 5T6MA 4I5EA 5JZMA 1GG8A 2BKVA 1ECGA 2G06A 1PFGA 1VI6A 3ELWA 3BCHA 3PNBA 2DSTA 2IOFA 2ZRGA 3TCXB 2PSJA 4BKPA 5EHNA 3WICA 2R4TA 3DUFB 2GLTA 2QL6A 2IYAA 2M1XA 1N6NA 2XBLA 1E2PA 5JRJA 3S55A 3OTOB 3EEFA 4EF5A 4LC0A 4P58A 5HM6A 3U5TA 1UQUA 2CXSA 5D6NA 2JC3A 3QM1A 2ZP1A 2FK7A 2H4HA 1SOUA 3C15C 3FSEA 1HKUA 2WWIA 3TZKA 3VSCA 1NBMA 4OK6A 1AF7A 5EERA 5EYPA 4ETNA 1ATZA 3QZUA 1S2DA 3CH4B 1OH7A 5FOSA 2ZUBA 3ZHZA 2J5BA 1YQXA 4K9MA 1U3WA 1LQ2A 5FV7A 4BP3A 3KDSE 1RSZA 5FI5A 1GPAA 3IDSA 1LC3A 1UZNA 2UUOA 1KSHA 5FNVB 3E35A 3UFBA 4Z1OA 2QTHA 1HDOA 3AUXA 1W1WA 2PT5A 4QNMA 3TQRA 5JFGA 1NC3A 2F59A 4I1IA 4D82A 3TD6A 4YC7A 2FAXA 3ER8A 3EUWA 5BNTA 2P62A 3V3TA 4KWHA 4FI3F 4CDGA 5ESWA 4KCGA 2VYNA 1BE8A 2FHSA 3SS7X 2HA0A 2I2AA 2NTNA 1CNEA 5DLQC 1EUYA 3GCDA 3IOEA 1W94A 1ZN9A 3SJUA 3O91A 3IOCA 3ZBQA 4ENUA 2NQTA 3Q9SA 1I0LA 1E0SA 5F23A 3LT4A 1K5PA 1SBNE 1AKMA 1KFBB 1ODIA 1YJXA 3NDJA 3NANA 4G24A 4IVQA 4RIGA 3V7YA 1SUBA 3HZRA 5FNVA 3R77A 1DBVO 1DHTA 5K3SA 3D81A 2HMTA 4EHFA 4Z7OB 4LJRA 1MFZA 5IUKC 3QNMA 3EGDA 1GNQA 2P4QA 1I4WA 3SDZA 1X77A 2WU0A 3CS3A 3F2IA 1USUA 2BFCB 2OO5A 2B7BA 2FMFA 1NT2A 1G16A 1I5OA 1F6BA 2PLFA 5FLKA 2RGDA 3VSDA 1GPJA 1E66A 1XVUA 2DJ5A 3QTTA 3RYHA 5C7OO 2AW5A 4DC0A 3IKLA 2NYUA 2IZ1A 4D3YA 1EVEA 2IYTA 4K7JA 2H2AA 4HV4A 1I1NA 1R4MB 2G8LA 3WLFA 5K6TA 2GPWA 1PZGA 2VXOA 3I2GA 1ZIPA 4O25A 1EWKA 2Q3LA 4N5LA 5MN5A 3OT5A 5EJIA 2AMFA 1D4ZA 5DHUA 3QU2A 1G3UA 2FVXA 2RHOA 1PZXA 5E7MA 3S2FA 2E4AA 2FU5C 4DHEA 1YVDA 1N7GA 4YY3B 2BFCA 2OAGA 1R9JA 2GEVA 5JR3A 4XYLA 2VJDA 1P18A 1PNVA 4HYQA 1E1QA 4Q15A 4FX5A 4GPEA 3I8SA 4PSVA 3MQFA 2DFVA 3FPJA 1VMKA 1BRMA 4GP7A 4M0CA 4PAWA 4PYJA 4UPEA 5BMOA 5HIAA 2RCNA 5DLDA 2GS9A 1R4MA 3DAYA 3ND5A 5EIAA 3ZDRA 2PSDA 1JQKA 2LDBA 5IAKA 1VB3A 5K8JB 1HE2A 1RMYA 1VKRA 3DV0B 3EG5A 4UFNA 1KK3A 3DDCA 4EDFA 1SU6A 1RBYA 4GUAA 3U48A 4EW3A 4HFJA 1KQOA 1GAXA 2B4KA 3KVOA 2H7XA 1G21A 3L8MA 3PNKA 1OXXK 2C54A 4I1RA 4MB2A 4IUCS 4R2MA 2LUOA 5H70A 3BTSA 1SQFA 5GGXA 4YAKA 3PHBE 3R0ZA 1WAMA 3FLAA 2OHHA 3KCNA 3G8AA 1GGKA 1E69A 4ROTA 4YB8A 3FX2A 1H85A 2A67A 3GJ5A 1IXRC 3LY8A 1A5ZA 1UWCA 3GVPA 4J07A 3Q12A 2QM0A 1HYQA 4OFZA 4RO0A 3VO1A 3CWQA 4KTTE 5FJIA 1NIPA 1OJLA 2GFIA 1FK8A 1NPTO 3GMDA 2R1VB 3A70A 1GLGA 1KYQA 1SPXA 2EARA 2X13A 3GG9A 3QOXA 2EGHA 4KTVE 3WLQA 3AZOA 1CT9A 2V7EA 1BE1A 1JFVA 3GNLA 4MR9B 4RMHA 5B6PA 1K97A 1TU0A 2WJ4A 1RHJA 3OX2A 4G4JA 4PLVA 4MP8A 5KSOA 1I2ZA 3PUYA 5B3AA 5FOXA 1YDWA 1EK1A 4ITVA 4MHTA 5MHTA 4JX8A 5LA6F 2JFGA 3KYJB 2D1RA 3AYZB 3G6KA 2BONA 3HNRA 3DCNA 3IPRA 3T6KA 1M2FA 2V9CA 2IQ5A 1YK0A 3U0BA 3AFHA 1A71A 1UJNA 3HN6A 1KVSA 2YZNA 1RDFA 5F12A 4RK5A 3JQFC 1VB5A 1YRHA 3H3FA 5ALMA 3AT1A 3ZI4A 4L8WB 3OBBA 4MA5A 3VHXB 2BR5A 4GX2A 2VWHA 1D04A 2NXEA 4A16A 1DOZA 3H2SA 2R1VA 4D92A 4BFYA 2E4YA 3K0SA 1WSDA 2CYBA 4DWOA 3ZW7A 3OJWA 5C31A 2FKAA 1LJ8A 4JOBA 4MR9A 4R98A 4TTIA 2UYOA 5H7XA 2OC4A 1K9VF 1W0JD 3TLGB 2DUWA 4A4DA 3EDMA 4TKLA 1N6LA 2NO6A 2BM9A 2GQ0A 1KMNA 1BVRA 1RQ2A 4ES6A 2ODTX 5BPHA 2C7RA 4YP6A 5FULA 1FBNA 4KE8A 3C48A 5GZ3A 1KOFA 1OIXA 1C9EA 4FD3A 3UIEA 2CT8A 4M37A 4C89A 4R9UC 3C8ZA 3BHJA 1RFGE 4Y9TA 4GC5A 1L5YA 5THKA 2FMXA 5F1OA 5LU9A 3JASB 4LYGA 1F8XA 1Z6ZA 1QQAA 4DNPA 1ZWLA 1FCJA 2QTRA 2C9OA 2ZDGA 2ZYVX 3H9UA 3LUJA 3OZXA 1O0SA 2OBXA 4MYHA 4Q48A 2UVDA 2F67A 1BIFA 3K3PA 4DM4A 3JZMA 2CFIA 1MC5A 4L9AA 5AKIA 4LEIA 1A2BA 2YCBA 4G1EB 4HNTA 2R47A 1AM4D 2NXWA 4FMCB 1M1NB 2LIPA 4M1KA 4Q3EA 5BW4A 3K71B 3NBYC 4BRSA 1AQLA 5FBWB 3GRVA 4CEJB 1TK3A 2WFAA 3RNOA 3ICCA 2XQVA 3U6BA 1GL3A 3WLKX 2GBGA 2QUZA 3H9CA 3VU9A 1ZOPA 2BLNA 2IJGX 2X9VA 3JASA 2BKLA 1RYDA 2GBLC 4ZO7A 5KYUB 3PUVA 4YUZA 1FJ2A 4G9GA 4K2AA 1V5WA 3CZRA 3JQRA 1EFVA 4MR8B 1EVQA 1AUXA 2GXUA 2WG0A 3KWMA 3LOUA 1E79D 1FMJA 2J7KA 2ZI4A 3UGJA 2BDUA 2UZ0A 3E9RA 2GNPA 2OOSA 3M70A 1AQNA 1AS2A 3TNFA 1AUPA 4DR6B 1KFCB 521PA 2D6FA 4P4NA 1DBPA 4JL8A 4KW7A 2CMKA 4CMJA 1K3UB 2E82A 2O8CB 5A05A 5IF3A 1YC5A 2JGLA 2X0JA 1PW7A 3IUPA 3DM9B 3GDGA 5CA0A 2UKDA 3SVLA 4L9WA 3TBFA 4RETA 1MTOA 4RTMA 2EL7A 3NRCA 4OL9A 3MTGA 1P4RA 3KPYA 1WDWB 2CNBA 3M6LA 3GJXC 2YWRA 4LISA 3KR0A 3D6MA 4ARAA 1LZKA 1EP3B 2PD3A 1WHSB 2Q1XA 4MR8A 4X7MA 4DLVA 5KSZA 3CC8A 3PYMA 3EQ6A 4HH4A 4DNQA 5KREA 3DR5A 3K8OE 4MW5A 1O6ZA 1SUDA 1N1MA 2MIIA 1KMQA 4ZRMA 2DOKA 4RTNA 1SUEA 1Y9ZA 2I7CA 4G2NA 4JQCA 1F0KA 4QVGA 5EE3A 4KGVA 4D5GA 4ZKDA 4B4DA 2P1RA 1NVWQ 2VH2A 3DUWA 3RQIA 2O8CA 1WQ4A 5F5LA 3GYGA 1L5OA 4XIYA 3RD5A 3TF5A 1M2EA 1XA4A 5JAHA 2DLCX 1I6MA 3QMWA 4L5IA 3H1GA 4HAWA 1RP1A 3QVXA 4INPA 3LNCA 4W82A 3NLLA 2QRUA 5CVEA 3TRIA 1AGYA 3BG5A 4L0MA 2OAEA 4MITA 4ZICA 2W4QA 3O47A 4FHCA 1Z5GA 2PKEA 1KOLA 1WHSA 1A9SA 3LCCA 5KTYA 1XAGA 2CXRA 3ET4A 3CNNA 1X14A 3L8HA 3L7NA 2IYFA 3ACCA 3P2MA 2CV1A 2PAFA 4C7MA 3DTVB 5F7ZA 4P0QB 2IX9A 2WIKA 4LVUA 3SHOA 3OH8A 4QOGA 4BE7B 1H66A 1U1IA 3LUFA 4QYIB 3HVHA 5COAA 5K51A 4BLPA 4WRRA 1XKXA 2PU5A 3LPNA 2WSMA 3TX2A 4UEWA 2C5BA 3FETA 1T9CA 4G5HA 4DMUB 3BF8A 1O5TA 3E1GA 3ZHOA 4E5PA 1E20A 5G4KA 2YXNA 1LH0A 3BWCA 3FZEA 3O75A 3I83A 2K7FA 2VXBA 1WV1A 2OG2A 5TS3A 3WRYA 2ZUFA 4IH9A 5JXHA 4D4IA 2E4VA 1II9A 2DB3A 3LQYA 4GOKA 1QAMA 2I87A 4AY6A 3PTLA 4F4HA 3NO4A 5AQ1A 2XEXA 2BFBA 2ZTSA 4ZYTA 5AHWA 2JFXA 5DBEX 3FJOA 4QYIA 3ZDFA 1KIFA 4S3MA 2HCFA 4P4TA 3O8BA 1E0KA 1D7OA 3VZQA 1GNVA 1KRHA 3O1IC 3ON5A 1O95D 2GLXA 1XJQA 2O52A 3JZIA 1Z47A 4OP3A 5F2KA 3AM1A 3D8TA 4EB0A 2ZB8A 1NMYA 1WW8A 4W5QA 3PC8A 3L0IB 1GCUA 4IXTA 1T25A 5HG0A 3U80A 2V9ZA 2XNKA 2DAPA 3M4YA 4ZT6A 2AG6A 5LBUA 4PXAA 2B21A 3S7ZA 1V39A 1NBOA 1N0IA 1ZCBA 2J9GA 5DN6A 4KNVA 5CX4A 4RADA 4AZ3A 2Y0CA 2P4SA 3O8DA 3BA1A 4KU4A 4DARA 1YWGO 5JFOA 4TUYA 3E82A 4GBJA 2E85A 2XYQA 3MAAC 4D96A 4GRAA 4F4CA 4JSRA 1UDBA 1MX3A 4EKIA 1V1MA 2MSDB 1JHAA 4W5OA 5C8ZA 1XB2A 3HZZA 1T6YA 2C4NA 1H0HA 3ZH2A 3BZUA 1I9GA 1T5LA 2AZXA 4U2FA 3DPUA 1NP6A 1M2OA 3DV2A 4KSYA 5EUCA 2JCGA 2Z2KA 3DT6A 3K0CA 3UGKA 1PK7A 4R5MA 4HGZA 1FDOA 1NYTA 2VPZA 1CUFA 1ZCFA 2P0YA 2YOGA 1QGAA 3IRVA 5EUBA 4DCNA 1JGTA 1GEGA 1PGQA 4MRNA 3BMXA 4ND4A 4F2WA 4OQPA 1LX7A 9MHTA 1EUQA 2PZEA 1R0RE 1FLDA 1RPAA 5EJGA 5ALFA 1P74A 2ECPA 4HZIA 4OAOA 2VCHA 1U99A 3A04A 3NOOA 4X6YA 1YIOA 4FFLA 1XU4A 3A4VA 2X1VA 4RZ3A 4KAAA 5JS8A 3KEOA 2NGRA 4QQKA 3RDPA 1X7ZB 4X3CA 1KJWA 3OIFA 1J7JA 5FRDA 2LIVA 3GNSA 4RSHA 3D6FA 4LZJA 5CNMA 4CM8A 3CU5A 3RUIA 3PIIA 3AWDA 3NEAA 1P4SA 2J3EA 3SSOA 5ECGC 3NV9A 4IMIB 4JVMA 1OTXA 4BOYA 3DMNA 3R0JA 5IJ0B 3NNNA 2ZEJA 4N3GA 1W44A 4JUCA 5I5GA 3AFOA 3OOHA 2HSZA 4D9EA 3QE4A 4OYHA 3PE3A 4PS1A 4L3OA 4EY3A 2EP8A 1IWPB 1CY4A 1UKZA 1Z7YA 1U0BB 2WHPA 2YZ2A 5T7BA 5F3WB 4C14A 1SCAA 4RV9A 1ZGAA 1YRAA 1TCUA 2YIVX 4LVOA 3W4KA 1QG2A 3VUEA 4FB4A 3N70A 3H5AA 3ZZTA 4C9BA 3G3EA 5E6UA 2OR3A 4DV0B 5BV8A 4XCXA 3LFHA 2IZ6A 3ZK9A 1NG1A 1KAHA 1PJCA 2JVIA 3KSUA 2XWBF 3TMYA 4YMHA 3H2IA 7REQB 3ZZUA 3TE6A 1QHYA 1ACMA 3MNFA 5JARA 3UQYS 3I2YX 1R0LA 3JWHA 3GLGE 2P3SA 3IVRA 1KQFA 3V1MA 5CFNA 2CFCA 2EKDA 3DZCA 3PJEA 1ONNA 4HAYA 4OUDB 3TLXA 2XR1A 1GM5A 5J4HA 2I6UA 4UU0A 2D5LA 4WPGA 5AXDA 3PQ2A 2PKWA 3UATA 1ZZGA 4AWBA 3K1AA 4P7FA 3H5RA 4A6XA 4C0XA 2VO1A 3SDBA 1V45E 4L3WA 4MKFA 4G0YA 2JZNA 1FS6A 2FW6A 3ZIUA 1MABB 3A7EA 2O8BB 4FONA 2C4KA 1VIYA 4D8TA 4F6RB 3RUHA 1SUWA 3LP8A 2H17A 1KJNA 5EKTA 1ISGA 1J25A 3I5MA 3ZWQA 2ZIFA 2J0SA 1YZHA 3SIRA 3UWKA 3WYEA 2Y1EA 3ZX5A 5B7QA 5HKOA 2GYVA 3GQBB 3MXTA 4MRMB 2NT4A 1OAKA 4B7ZA 3E3AA 3Q1LA 2FEPA 1KIMA 4UHCA 4OUDA 5B7NA 5HIKA 4P3OA 5ARBA 5JC8A 2H7CA 3KT0A 2OBYA 3BUSA 1L5NA 5AVQA 4DLSA 3ONVA 1ZLYA 1JEAA 1FP6A 1FYXA 3NOVA 4LDPA 4XR4A 1G59A 1FJGB 3B38A 4BQIA 4DREA 2O8BA 4XFDA 4Y2GA 2GZSA 1ZUIA 3WJ2A 4L74A 2PQ2A 2JFVA 4L2IB 1CDZA 1XDUA 3A11A 5HKBA 3CZQA 3TG8A 2B20A 3S2EA 3ZI0A 2OCPA 4DSOA 1OLSA 4MRMA 3ZCXA 2PX5A 1A5TA 1P2VA 3RC3A 1TQDA 5JXWA 2C2GA 3RRZA 4C7BA 2GHRA 3DEFA 1NG9A 3Q5GA 2Y0DA 1L7AA 3SYMA 3IB6A 4E11A 2Z6AA 3EZNA 2GPYA 4L3VA 1K3TA 4JHLA 5A4AA 4A0RA 4AIIA 3T06B 1SCIA 2WV7A 4PC1A 3DQZA 1EJ0A 3DMTA 2RGGA 4B09A 5JHHB 3KVRA 4DIUA 5LP6B 4EGSA 1QWOA 3NT5A 1NA5A 3R3HA 1NZJA 4BHTA 4UC0A 1YF3A 2H0QA 1ZMTA 4L2IA 4IOJA 3N1UA 4GP6A 3K1JA 3K5IA 1GITA 3OQPA 4JJZA 3CX7A 1W29A 3D6AA 4OHBA 4XR9A 1JEYA 4LRYA 3ETLA 4MS4B 5F7XA 1O95C 3TOZA 5C1BA 4AECA 1P45A 2BSAA 4PWYA 3K05A 3KUXA 4QXMA 4IDPA 1FRFS 4Y2RA 1T9ZA 3I2IA 3VZDA 3DAPA 3BFXA 1X74A 3PEFA 3HYLA 5HEKA 1KI1A 2Q0SA 1UT8A 3X1XA 4ZN6A 5KQGA 1TEZA 1X1TA 1Y8QB 1OTHA 2R751 1X19A 2ZATA 4MVJA 4MV5A 2J3LA 3PFGA 2B7LA 3A9UA 3VI3B 5A1TA 3UKDA 5LP6A 5AOCA 1WY7A 2RGNC 4WOCA 3WV4A 4EG7A 2ORYA 1CZLA 1UC5B 4G41A 3GO4A 5DCWA 4PIVA 5EJ2A 4A15A 5ALZA 4CW7A 5C80A 4XGNA 3W2TA 1YIDA 3U4MA 1TT5B 3P5BA 1B6SA 5I45A 4AYXA 5JVDF 1A69A 4AKHA 3D6JA 1E59A 3RGWS 4MYTA 2W2QA 5IT4A 1TVCA 1JLLB 4P92A 3GZNA 3IKVA 4WKNA 1T6XA 2F9FA 2FSVA 2OUIA 3QUTA 4I99A 5GAJA 5FPQA 2WF5A 1A4UA 1NN0A 2ZOSA 3QLUC 4PE5B 1V9SA 4PZPA 1FOEB 3BCRA 4QNRA 4ZYXA 3KQVA 2A7XA 2XVXA 1O0BA 3ZIAD 4MCAA 2XUHA 2UUBB 4NU0A 3EQ9A 3VJLA 4S0ZA 3HCPA 1YB7A 2XUDA 3LT0A 4F97A 5EXEA 3T3OA 4Z0TA 1ZUNA 1JPNA 2X22A 4HD8A 1K7CA 2DBVO 2CD9A 1TT5A 4HNHA 2Q6KA 4JLJA 5DGIA 1HXHA 3UJPA 1GU0A 1IPFA 4EZBA 4JI6B 5AHXA 3RRJA 1HBJA 2JAXA 1TKRA 3OG9A 4KDCA 2D59A 4R0VA 4D8XA 4E7PA 3IL2A 5C2JB 3TR6A 1I01A 1JLLA 2NPFA 3GRFA 3NVMB 5BV7A 2GN1A 1EE2A 1NF2A 3K1YA 1XG5A 2AR9A 3AIKA 3NIGB 4MQLA 2R44A 1WR8A 3WGQA 3R9WA 2JGDB 3GFPA 2HHLA 4R2XA 5EZ5A 1L5KA 1H2XA 5CK4A 4BLUA 2Z8XA 2ZRJA 1PHRA 3G1UA 4B3MB 1I14A 2VWQA 3GPBA 1QOQB 4N03A 4JELA 2C1XA 4BNGA 3G2IA 4KIFA 2JB9A 4M0EA 1K0UA 4ENRA 3TAHA 2Y1LA 1X1EA 3SZMA 2ODBA 3KWFA 2D0DA 2JLRA 5E4TA 1IBCA 1TQ6A 4CM4B 1QIJA 1F0NA 1PZMA 3EG9B 3W4JA 3LIPA 5CIWA 1YMUA 3IBYA 1I2BA 4FOPA 4EVSA 2ZWMA 2JGDA 4OIFA 1OC4A 1PUXA 1NOIA 3K32A 1E8MA 1EHYA 5DBIA 1ZI9A 3Q7IA 4LCBA 4UZEA 5DEIA 3ULKA 4OQFA 3L6BA 2GJ4A 3ZVMA 2HA6A 3CZPA 4IG4A 3TTTA 5JPIA 3ZNOA 3PQEA 5D3KA 1LTQA 1G20B 1GPWB 2VSYA 2XTJA 3JQBC 3WLJA 1N2HA 4HXEB 7GPBA 4BV2A 3AIMA 2IS2A 4HC4A 2WJYA 4BB6A 3PYXA 3EG9A 1PGPA 3FPHA 4Q93A 1Z0SA 5JRZA 3C43A 3K72B 2VUIB 1TE2A 3KUCA 3OQVA 5DT2A 2N9UA 3DFKA 1IATA 4U6SA 2IFTA 3R6GA 4GQIA 5FD8A 4D9IA 1JUDA 3A4TA 3HRKA 3SYNA 3AI3A 5EP1A 2VDWB 3WAGA 1J8DA 5DF1A 4L22A 4D25A 3O3CA 4XIFA 1IY0A 3VGJA 2P90A 4HNQA 5ELMA 5B4UA 1MN6A 3IV9A 2C0PA 2ADOA 2I9KA 1F12A 2AG8A 4NZPA 3JD2A 2XMPA 4IJWA 2ISQA 4GMGA 2W9XA 3WYBA 4A2CA 3I4FA 3NEYA 4K0RA 3T4PA 4EQZA 4BB9A 1B93A 1E77A 1E1MA 1ZG3A 1V7QA 2X0KA 4MO2A 3R8FA 4Z5XA 5IT5A 1U8YA 4BX9A 3MUFA 1NYQA 4BFWA 3NC1C 1ODKA 1PEKE 1ODSA 1YOVB 2YY7A 2ZWVA 4UAVA 1WUYA 3G5AA 2FEXA 2GN0A 3RIXA 2GUWA 3UWOA 3VO9A 4WZBB 3UNXA 3ZQUA 5B7GA 1CQZA 2VK2A 3AEQA 3G88A 4HDRA 4J4BA 4HAZA 2X76A 4G4SO 4B3BA 2VDWA 3CEHA 1PR5A 3IOMA 3MFYA 3P96A 3ZV3A 1T29A 5JISA 3CLTD 3AVWA 3TLCA 1O58A 2B1JA 4AIRA 1UBKS 2VJMA 1ZH6A 2OCLA 1KNQA 1YDFA 2GPAA 2WFMA 3NYRA 2Q6TA 1Q19A 3CTMA 3EW9A 3O8QB 4RVNA 1IVNA 4WLFA 4DSAA 1K3FA 1F38A 4JJAA 2WIAA 4TYWA 5EZYB 3CT4A 3KP1A 3UPUA 1PGJA 3KPUA 5DTRA 4FEEA 5TRTA 2BSQA 3KV1A 1DFHA 2HM7A 4W1QA 1NR1A 1TMYA 1CIJA 1ZNZA 2J3IA 1QH1A 2IK8A 2V6JA 1YOVA 3GEMA 3ND8A 3F46A 2B6HA 2WU4A 4JD5A 3BHNA 4O33A 3B12A 4WZBA 4V0MA 3BN3A 4FJ1A 3HB5X 1G291 5DGDA 3QOFA 1RAIA 5FJJA 2H92A 5I8ZA 4MVYA 1V9CA 3SC2A 4R31A 2DPHA 2QXUA 5JZSA 1KY3A 4NARA 1XEXB 5TGDA 1K63A 2RJNA 2W6NA 4P9NA 1RKBA 1BHJA 1HE1C 3I76A 1K86A 4D0SA 3EIWA 3UV3A 1MPTA 3H9BA 1EM8A 2W4IA 3LQQA 4QSHA 2Y3IA 1MNQA 1DJPA 1OXMA 2V4ZA 2XWPA 3SVZA 2X0RA 3FPKA 1GY8A 1K8ZB 3FMVA 1X13A 4NOJA 4YJ2F 1QLJA 3RS5A 1BTOA 4FXOA 5T8KC 2AXPA 3ICOA 3BS4A 5JSUA 2WZDA 1QPZA 4K6OA 3DXZA 3Q41A 3SZ3A 5DVZA 1L7NA 2QD1A 2VDJA 5KWEA 1TECE 1QTIA 2G67A 1IJBA 4DA8A 2A1TR 3ANTA 3DZDA 3O2NA 4BAUA 1TLTA 4M0MA 1YA8A 1NDQA 3U1VA 2AJCA 3AVPA 4LWOA 3OZRA 3NYIA 1XEXA 3VR4H 2WSSD 3IDFA 4EL5A 2QAJA 4K26A 2B6NA 3JQPA 5DNVA 2PD4A 3L6CA 4UULA 2IHTA 3VPFA 4DS3A 2H4YA 4YMSA 3CCBA 5LDDC 3AI1A 4D9FA 2F8MA 3JYQA 2D0PB 4B76A 3MGAA 4Z2AA 1L7EA 2Z04A 4BASA 4OB6A 3BULA 3T9CA 4LXUA 2Y27A 4A0GA 3FR7A 4HCJA 1EX6A 3NHJA 2Q5HA 5K09A 4G5RA 3M89A 4F5YA 3AF5A 3U7QB 2VBFA 3A6KA 1JH8A 1YSCA 2VH1A 3GH1A 2YDXA 1Q16A 4UM9D 1HDYA 3A9RA 4A8JA 3HCWA 4MRAA 4MDFA 1ESMA 3ECSA 3GWZA 4Y0VA 3SF0A 2AKYA 4DG9A 2VUTA 1JR3E 3EXIA 1SJ9A 3IKJA 5E4JA 4HS4A 2DPYA 1VLLA 3UG7A 3W5IA 3AVYA 1TDJA 4KAFA 4LSWA 4RTKA 3B5IA 4PBSA 4RPJA 2QHXA 3O8LA 2H1WA 3DMHA 4K8OA 1ZJ6A 3RQSA 5H82A 1PGNA 4PRLA 4PZ9A 2VWPA 4R1SA 2FRDC 5ARDA 3ZE8A 2QNRA 3LTNC 1HR0B 4G0OA 4X62B 4GFDA 1DXQA 3GLVA 1BHO1 1Q17A 3L4SO 3H99A 1RWXA 1R37A 3RODA 4I4CA 1ZJYA 4ZFNA 4C4OA 4ZI7B 2PMCA 1RXUA 1ADBA 3NDPA 1V41E 1TU3A 1YI0A 3OMLA 4Z8YA 4BUJA 5EY5B 2HADA 4Q4CA 4YDQA 1S2NA 2R2GA 1YNSA 2GAFA 3EZYA 3SHFA 4DMKA 1RLTA 1J9EA 3OZDA 1PVDA 3JQ9C 5BSFA 1NNUA 2PT7A 4NL4H 1L7BA 1SCQA 2DE0X 5KSWB 3F6RA 3CB2A 2QGFA 4NYIQ 3C3DA 4TXHA 3IJPA 3JVVA 4FZ5A 1FUYB 1U9JA 2IW3A 3HBJA 3HLTA 4F5DA 1Q3HA 1FMCA 3AERB 3AJEA 1AT1A 3F3SA 3MTJA 1E7SA 4IV8A 1KEPA 4QJ5A 1N5IA 4HPJB 3RWBA 4LN1A 5JXGA 1CJKC 1N6IA 1JHRA 8OHMA 4Q5IA 4Y6GB 1BO6A 3ZGLA 1Q0ZA 2IOQA 3GD7A 4PWZA 1GCGA 4Q9AA 3P26A 4F92B 2HRDA 1Y6ZA 3U19A 3LHSA 1KRXA 5KZMB 3COZA 4G0XA 1NUTA 1ARZA 4U2DA 4AJHA 4EH1A 5B1EA 3CZ5A 5JALA 1A8UA 5BN5A 1YJ8A 2EHJA 1OFGA 3BORA 3BRSA 3AR2A 3VO2A 4DTIA 3O83A 2ZRKA 2IELA 3FNBA 4P38A 3H5TA 3KKZA 4E13A 1ABFA 4DF3A 4JWTA 3AUJB 4N3AA 4QG7A 2WRZA 1V8DA 1K6EA 3AERA 1TAUA 4WUVA 3T7AA 5EC8A 4EHKA 2O0JA 5L95A 1KYIA 2AFHE 1ULTA 2YZ7A 2ZJ1A 1BNCA 3HNPA 4MUIA 4RD4A 5LXTA 4GXQA 4MVWA 4P33A 1R3UA 1R2QA 2C84A 3BOSA 3UENA 4C4TA 2V3CC 1Z12A 3PWSA 2RHCA 2AG5A 4P4GA 2E0IA 5TS2A 3RNLA 2Q3BA 5HTOA 1YZKA 4PV7A 4AZWA 1NLZA 4B3GA 2B2NA 2QTWB 4KWEA 4TWAA 4WKBA 1KIAA 1XZBA 1J09A 2B4AA 3KSDO 4RE5A 5ICCA 3DMPA 3BXFA 3VR6H 1CJVC 2XJ9A 1PW5A 3RC8A 2FCAA 4EUHA 4RVSA 4XX0B 3EMDA 1NUAA 1EE9A 3ZEAA 1J9ZA 4LI3X 3LLVA 3TIGA 1JQBA 5BSEA 5F2NA 2X8BA 1U11A 1T10A 4PNPA 3CLTC 1FU7A 3CXUA 3D4LA 1U2GC 5J58A 3ZJVA 3EUAA 2E3JA 4BVFA 1SQGA 2F1HA 3GFOA 3NG1A 4TXMA 3DFFA 1G1AA 1NLMA 2DC1A 3FKQA 1EQ2A 2A84A 1KS2A 1QGED 1C7QA 2C2HA 1FTWA 3S68A 5A4IS 1EIZA 2W2TA 2CFRA 3GW8A 3H11B 3KBBA 4M54A 3WHKA 3WBKA 3Q8KA 1G9XA 2IYOA 4PHFA 1LI4A 4F8YA 1J21A 4YR7A 4FJ0A 3DLHA 1EINA 4LJ8A 1EGHA 3HB0A 4R83A 1CWUA 5CRIA 1OY1A 1SXGA 5A7HA 4MJ3A 5FB3A 5FF9A 3N53A 1LS1A 4U7TB 1CZOA 1SOMA 2OXIA 3FUVA 4RGBA 3UMBA 5F7JA 4HY3A 3LY5A 2LGJA 2J08A 4Y2TA 3QWIA 4LQLA 2WIJA 6Q21A 3RVSA 3KK0A 1JJFA 4G0QA 1TYAE 3PVCA 4BB0A 3GD5A 3SSNA 5ALJA 5TQ2A 3U3XA 4EI9A 4HPWA 1N3IA 1W5TA 1IXKA 3LG2A 1ZH2A 2X19A 4AY4A 2ZYGA 3H11A 4RIFA 3K9NA 3KKOA 1O9GA 3BCSA 4KKXB 1SO8A 1Y48E 1NMZA 1D2GA 4ODIA 4GGMX 1RW4A 3N8HA 1Y0BA 4KVGA 4BRZA 4PC6A 4IVNA 2FPUA 2H7VA 1CPYA 1UC9A 1PYGA 2VRCA 4KE6A 1GADO 4QBIA 1QNLA 3GNTA 3U5ZB 2IHJA 3IAS1 3Q6MA 1GCAA 4UEQA 2A1UB 5EWJB 3THWA 4Z4GA 4NBVA 4JSYA 4RYDA 5DYWA 5K5EA 1O94D 2PCLA 3ND7A 4EARA 3BJIC 3OPXA 1LX6A 1ORVA 3KALA 4XPIA 1J8QA 2ZRLA 2NV0A 3N0TA 4D80A 5GGYA 1KZ4A 4LTNA 4YUYA 5HJ2A 4HEQA 1P6UA 2VEDA 2V54A 3BEOA 4RKEA 2R6CA 3HO1A 4LE0A 3F9IA 5TMBA 1P7ZA 1ZK2A 4BKQA 3O93A 3U16A 1CS0B 3HU2A 3QLVC 1I7DA 3R9KA 4BVHA 3TOXA 2Q41A 2MINA 3E48A 1GKLA 1HFWA 2A1UA 2FE4A 5IZ4A 1Y4UA 2L69A 3VOBA 4GE0A 3ZLJA 4AVYA 5M7EA 5IKMA 5E0KB 1TYEB 4N39A 1TCBA 2ALJA 2C57A 2XMSA 2H5IA 3QP9A 1H0KA 3DZFA 3EJWA 2AI2A 3NMUF 4LTDA 4F3TA 4X6UA 3AR6A 3S1AA 1TO2E 5BY2A 5CDSA 2CL0X 4XEHA 4ILEA 3MPUA 2QIOA 1ZIXA 4IIUA 4IZIA 2XCUA 4ZC8A 1CS0A 2EBUA 4CN9A 3PT5A 3ANSA 3F8WA 4HOYA 1MAUA 2B0CA 2V7QA 1CW2B 2VJBA 4JR2A 4LOAA 3V2GA 1A3CA 3WL7A 4AKEA 4AMZA 4FC6A 3ZBPA 4CZ2A 1U9IA 3KUDA 1MC4A 1OXVA 1QHGA 2B4YA 3A05A 3JWIA 5TSDA 1PJZA 3VRHA 2IITA 2FWJA 3Q2IA 5CXSA 3HB7A 4J8PA 4B81A 1EGAA 2CJWA 2A1IA 1R12A 3LP5A 3I5AA 4WV3A 2BZ0A 4ZOAA 2ONYA 3N2IA 5LM3A 3KEMA 1JFFB 1NN5A 3MMPA 4M1OA 3QELB 3SC6A 3TI9A 4C04A 1SBCA 4DYDA 4U2GA 2JJQA 4C3ZA 2R7KA 1WD7A 1IN7A 5HS4A 3DAGA 2OHIA 2ZRFA 3FPBA 1QP7A 3FTEA 4YXFA 1DBRA 5ALQA 2HNBA 1NVDA 3I01M 2IXTA 4XSHA 2ZSDA 3WADA 4IGAA 3BXXA 1NXTA 2NACA 1YJAA 4KO4S 2UUAB 5B1YA 3K0BA 1VP3A 3MAGA 3KKQA 2EJCA 4OI0A 1V47A 2HX1A 1W88A 3L1KA 1DO0A 2DSNA 2O0MA 3A36A 3L0BA 4UD2A 2J3KA 3TIVA 3R6LA 1XKTA 2P11A 5E0OA 4Z4FA 3EULA 2VP9A 1W0KA 1JFFA 2B4RO 3AEXA 3CG0A 5EKUA 5A7GA 3HABA 3QELA 2EJBA 3DBVO 1N4AA 2C04A 1GVHA 1V6AA 3WG9A 5HDQA 1RWKA 2BMAA 1VCNA 3VOSA 2P40A 6CHYA 3QG5A 3OQBA 1DPGA 1DG3A 1W9HA 4ENTA 2H2GA 1J06A 3JZDA 1OAOA 4MKZA 4NSNA 3CX4A 2WQ7A 3AUTA 2EW2A 2X7HA 1C3OA 3DZKA 4R2HA 2ZWPA 2JJMA 3KO8A 3UG6A 3QOYA 2WHEA 1B15A 2I1VB 3UICA 3KS9A 4MWEA 1ZY2A 3AFMA 1EUZA 1IAVA 4S12A 4QEZA 1SCBA 5FFMA 4RTLA 1E6EA 4L27A 2H6EA 1LVHA 4I50B 1GQQA 3ED1A 3V7WA 1Y8AA 2YWGA 4XGKA 1VI5A 3P9QA 3VR4A 2QZ9A 3KKMA 1T4DA 3M83A 2CZCA 2EVWX 3K8QA 5LC1A 2OILA 1FTQA 1D1TA 1R18A 3A6ZA 3A4NA 5JE8A 4Q37A 3SEFA 2ODEA 3KAJA 3GVIA 1Y3IA 3B85A 2P79A 4IMRA 2QMQA 3J7AC 1LVGA 2HKIA 3KEFA 4X93A 4DILA 5HKLA 1XJCA 5KVAA 5EWLA 4JP8A 1GPLA 4ZYZA 4MWGA 1C5KA 4G1MB 4X45A 5SZKB 2J0EA 3OFVA 1R15A 2JLSA 4JLDA 3VV3A 4I50A 1L4GA 5C4MA 3AWIA 1TCVA 1AS3A 3AMVA 1OI4A 1SBHA 2FPMA 4RF2A 5KINB 3C1UA 3KQYA 2KLHA 3P94A 5DTEA 1ULAA 2QVLA 4HQNA 2YXPX 4U2EA 3DNPA 4IJ5A 4WXYB 3E53A 1E92A 2Z58A 4NV3A 1LRLA 3RBVA 1E5XA 3ZK8A 4DJAA 4A0SA 1ECCA 2YS6A 4O2AA 4TV9B 4BBZA 1IVSA 1ZVKA 4FQ8A 4GBED 1GKIA 3R9XB 4X8OA 3WISA 1OB5A 1II8B 3NU1A 3KJGA 4JDUA 3REFA 3I5YA 3QBTA 5LLDA 3HH8A 4OATA 4JBWA 2AEJA 2CF5A 3AKEA 3ZHRA 1DQNA 1NV8A 1QR6A 2Y71A 1GA6A 1SVNA 1YQEA 4JZYA 4B3JA 3ZKWB 1OC2A 1HLPA 2GCGA 2VTKA 3CLKA 5B6JA 5C81A 1QP4A 3FTPA 2N47A 1RBQA 2YY6A 3LF1A 4JX9A 1JN0A 5LJIA 4GPBA 2R79A 3FYSA 3DFIA 3Q0EA 3TBKA 3UUFA 2IYPA 3AZQA 5IM5A 4YWHA 1E2EA 1ZA1A 1ILWA 2GO7A 2I2WA 2UYYA 2XZPA 1SCNE 3S4YA 1AXEA 3QGMA 4F3NA 5FBVB 1I51A 4U9HS 1EWYA 3O73A 4FEAA 2G7MC 3K09C 4U6QA 1M76A 1G8GA 1RTTA 3WDLA 1JDBB 1UFOA 2VNIA 2MYNA 3BVPA 1A1VA 1II8A 1YS1X 1N2XA 1CFZA 1SHUX 3MA0A 4L4YA 3T7CA 3UT5A 4EQ6B 4GMDA 4JK3A 1CQIB 4G81A 4GMHA 1SXJD 3B3JA 2PJUA 4LNUB 2VKTA 1GUZA 2GN2A 4MW7A 3S27A 3ZKWA 1LTKA 3RKUA 4LDAA 5NLLA 1C81A 2XUAA 2VNKA 3SYRA 1BYUA 5KTOA 4AU1A 1IDN1 2G5TA 4Q6BA 3VYSB 4DUGA 3T4XA 5T4HA 2C20A 4YFVA 1PJ3A 1MB4A 4FLMA 2FWMX 1XDDA 1P7CA 2I80A 1DB3A 1V5IA 1IULA 3OEWA 2D7JA 4UATA 5K8IA 2PUTA 2CEKA 2W0MA 1F9EA 2CE7A 3UZUA 2P5YA 3OEYA 3FYTA 3K6SB 2BR3A 3FNRA 3WIVA 4BV8A 1UM8A 4EQ6A 3TZCA 1QX3A 3CQ9A 4B17A 1CQIA 1BQEA 1DCKA 3H4MA 4E5MA 2XRZA 4ZARA 3UFXB 4A92A 4LNUA 3RJZA 4FFWA 4J2HA 2Q4BA 3REOA 3QWFA 1NBMD 1WCIA 5KHOC 5DRYA 5EKXA 2QR2A 5BMVB 5CEEA 3QITA 3F5DA 4LY9A 5J4LA 1LNZA 2G9ZA 4CIYA 5DMXA 2JGKA 3VR6A 4K28A 4FR2A 5JCXA 5IU6A 3JYPA 4INAA 4LGVA 3ROXA 1TCCA 1X1QA 3OHPA 1C30B 3ZV6A 5ALVA 2IXAA 5G0TA 1R9GA 5CH3A 5IVPA 4YRDA 1OFVA 3PEEA 1PQ4A 3ZWXA 3PHGA 4OPMA 5CVDA 2PV7A 2KB0A 4EYEA 1XTUA 3N8GA 1L1EA 4YRLA 3P9IA 2HDOA 3DWGA 4MWSA 2HJSA 2BEWB 3NHAA 1RAGA 5AVTA 5ITSA 1ZI6A 3D4PA 3LRXA 4ALKA 1Z9BA 5E7QA 5CX1B 4D7AA 3F9RA 1Z45A 2R00C 1WP4A 1RWQA 1ZD3A 1W73A 2TYSB 5EE1A 1N36B 1K06A 2RHHA 3SVTA 3CNEA 4PZ0A 1MH9A 1MGPA 3NCHA 4B47A 2JHCA 3BGVA 3ES9A 5AW7A 5HPYB 1D1PA 1PYOA 2F1RA 3FDIA 3VNRA 4ER0A 4P32A 1CUJA 3BIOA 3EF1A 4Y9RA 1ULUA 4IW3B 5CM9C 2I2CA 3OJCA 3DKVA 5C5EA 1YNOA 4KO1S 1WB4A 1Y5IA 1UMCB 1LB1B 1D03A 1IOLA 1TZBA 2G0AA 2HCTA 1JW9B 4L6IA 3MERA 3LSYA 1RXIA 3PUIA 3STWA 3B1JA 1Y5LA 3PDIB 2C94A 4TWRA 4FS8A 2FX3A 1A5AB 2PLNA 1ZMBA 4REQB 3AM5A 2BE7A 5CX1A 3WL5A 4GYKA 3L77A 2MHCA 4UBOA 4XTCS 1U6KA 1C8KA 4Y7DA 4DA6A 1T2VA 4IOLA 3FOAA 3WZLA 1FFBA 4FFRA 3V55A 2M32A 1E2FA 3C8DA 2ZBGA 4BJ6A 4E5SA 1FTGA 3RIMA 3UC9A 4O5OA 2QNBA 3M1LA 1W4AA 2F3UA 1J39A 3PFIA 4L4RA 4QTYA 1FL9A 3GLHE 4ZHSA 3WNDA 4U5QA 3K15A 3KL2A 5FHRA 2EP7A 1UMCA 4X60A 5JY6A 2VHYA 3TPFA 1KEVA 3B8EA 3H8JA 5L3SA 1Q22A 3WGUA 3MELA 1U2DC 1UKAA 2L42A 3PUWA 2X3FA 5I7AA 4AJ9A 2FSIA 3G0GA 3BRWA 3PDIA 4JH0A 4CV3A 5J1TB 5EJMA 3QE2A 5E4YA 5E2IA 3D7KA 4R7ZA 5L7YA 1IPHA 1LBSA 1QPGA 2LRHA 1DV1A 4MGYR 4PG6A 2E5FA 2NO5A 4MS3B 4O0MA 4H3KB 1A4XA 4URHA 2D54A 5KJEA 5JJKA 2PCJA 4KLAA 4BLSA 5IM4A 1SCUB 1C0PA 2DBZA 2HBQA 5CVJA 4EW2A 4JP3A 1DEAA 2ZJ8A 3E7FA 3L6EA 2E5WA 2HA3A 4IH4A 5H3HA 3DM5A 1KVRA 3KD3A 3V2HA 2WP0A 3WJ7A 4BVEA 5IUJC 3LKDA 3OIWA 4U7JA 1V3VA 2BEKA 5CITA 2OD7A 2PA3A 1J49A 1OX5A 2B0JA 5A06A 4TV8F 4GRDA 1P4GA 1C4OA 1RKUA 2C3MA 1PG0A 3LOPA 2WTAA 4CR7A 5K05A 1EGQA 2OV8A 3IAEA 2C9BA 4HNGA 5HE9A 5HF8A 3BK1A 2XT0A 3ESAA 3FYUB 4R16A 3KRTA 2VZ9A 1V0JA 2E7ZA 4OK5A 5E6SA 2AQ8A 3CR7A 3KLMX 4HQFA 4IMJB 4D81A 2JLUA 1H4QA 3U4HA 1L9KA 3FUUA 1XGKA 3H8WA 1SCUA 3FLEA 3HUFA 3FG9A 1EM6A 3QW2A 4Y2XA 5EGNA 4AO7A 2I7TA 1MKYA 2HXYA 1KVTA 1DAEA 5DU2A 4FMDB 4R0MA 2FOIA 2A35A 3VA7A 2AT1A 1V5GA 2HU2A 3GJRA 1RMQA 2GJ9A 2PSEA 2QMHA 2OTCA 2Y1KA 5JSQA 1P8AA 2G3YA 3IP3A 1QH8A 3QBVA 2YRFA 4FTWA 3PHHA 1J56A 3PYLA 2Z2JA 4ZVSA 1I7SB 3FYUA 1Z56C 4JJ7A 1CQXA 4KI7A 2BI7A 1O6FA 3OQ6A 4Y30A 5JOQA 3VKGA 1NSTA 3HYSA 3GT3A 4JI8B 2E48A 3P9PA 2XSZD 2YY5A 3LBAA 3PQ7A 4ZDWA 2I33A 4WCFC 4KP7A 1SXJC 4IXWA 1WG8A 2O5RA 5K0GA 4MWTA 2W2NA 4JXZA 5DM0A 5JNTA 3VDRA 5IARA 1N7HA 5U1PA 1OWMA 3ZXXA 5FA5A 1XF9A 2KS6A 3PQ4A 3EDYA 3HU5A 3GOHA 3BMCB 2YJ3A 3S2YA 3VNVA 1XL0A 2FPGB 2JF0A 1FMLA 4OI1A 2AZ4A 3D3QA 4KPUB 4RA6A 4WH0A 3IVXA 1AUOA 2ZB4A 4JEUA 1NJ1A 3T1NA 4AG5A 5KVVA 2IWRA 5FO1A 2OHXA 5NULA 4QKQA 1VLHA 4MLDA 3GDOA 3OTWA 1U8CB 1F3OA 5FTKA 4A6PA 1DEOA 1ZUHA 3RSFA 1YZVA 1BH2A 4Y6RA 4RL6A 3D7MA 2P3OA 4GHWA 4RF5A 2J7PA 3T4UA 4EKDA 4LVCA 3LK6A 2GJ8A 1U63A 4GXTA 3AESB 3H0KA 4UASA 1R88A 2YXBA 2JANA 4O2BB 3ZDBA 3AJDA 1PQWA 3BMCA 3BWYA 5U4XA 5C52B 2D8MA 3LRPA 3JQ7B 4OFWA 3SXPA 3T99A 4Z0NA 1COZA 4KPUA 3RVDA 3AEUB 1NMXA 1RM4A 2H4XA 4FFBB 1I1OA 3LTEA 3R5FA 4G1UC 4WOBA 2HUPA 1DC4A 5IT9A 5JWRA 3RYIA 4TXNA 1IEQA 2KBFA 3DO8A 1T43A 4P93A 3O3NB 3K7EA 5FR2A 3RVJA 7ABPA 1LQTA 4QUIA 2Z5VA 5BN1A 2PR7A 4MDHA 4RV5A 4GLJA 4IV0A 2CCGA 1Z68A 1L2TA 1IL0A 2FUKA 3EW7A 1TT7A 1RAEA 2A5JA 4CKEA 4ERXA 1A9XA 3EDCA 4POAA 5FWNA 3R8CA 3RIHA 5AW6A 1WNTA 2F3QA 4YROA 3C2QA 4MIEA 4AICA 3A2NA 2IEBA 4G63A 2ZYRA 4J0FA 5G41A 1BKSB 1FFXA 2AV6A 2ZULA 3JQ7A 4LHVA 3V5NA 4KHPB 3I9JA 4L02A 4LBYA 3UAXA 2B8EA 4N9QA 1EDEA 4PO3X 4KH1A 3WO0A 3SZGA 3DULA 3WYCA 3L05A 4NZMA 5L40A 2DTXA 1MVOA 1TMOA 2J46A 2J87A 4DPLA 1J23A 5LA6B 2VJAA 3NHMA 1XZMA 4Y2SA 4KN6A 3UJHA 5KMGB 4TWIA 4M8SA 3GLSA 2WYIA 2OO5C 2R5NA 1V96A 2OXFA 2Z3WA 3C6XA 4GZLA 4KGZA 4L9SA 3SNHA 1ZGBA 4RTOA 2BH2A 4F7DA 3WSWA 1NOJA 3I23A 3U40A 4CIWA 2CV2A 1Q7CA 1IWOA 1EX1A 2Z3VA 3GBPA 1JG4A 3O5AA 1HQKA 4YRMA 2XRMA 1E1DA 4HEJA 2HTEA 3FMFA 3FZQA 1IVYA 4DB4A 4BLTA 3D0OA 3PF9A 3V6MA 3W78A 3T34A 2NSJA 3D4BA 4EHNA 2RSLA 1KI7A 5EE5B 4B8ZA 3RIGA 2AN4A 2FQQA 2YFQA 5EMMA 2VAPA 3GUZA 5LA6A 4UVDA 4PX9A 4CF7A 5KMGA 4PPFA 2BY4A 3M4JA 1JR4A 1HYEA 3BJEA 3F6BX 1YV9A 3L7KA 3MWEB 3U3JA 2NXCA 2Q2WA 3TRHA 3L1IA 5CT4A 4I3HA 1R0BA 3INNA 4JVSB 4UDNA 1A9ZA 3HXPA 4LJ7A 2A1TS 4NK4A 3ORHA 4RZSA 3HI6A 2WKRA 4YRNA 4BLQA 4YMUA 1FTSA 3EY9A 3TRJA 4CNBA 3AY0A 3IESA 4W7IA 1BEEA 5FBLB 3K8ZA 4ZHQF 4E2FA 3QXSA 4LAFA 4HRYA 4P82A 4A73A 5GTDA 1DOHA 2PH1A 1KJZA 4QTUB 3FHOA 4N3CA 4NY1A 3N0RA 3FNEA 2UZIR 4RD1A 5F1KA 1FMTA 2QTMA 1P2BA 3CUSA 4YQEA 3TZBA 2C1EA 4K03A 4MS1A 3DXFA 5ALXA 1QORA 4AUMA 1HNWB 3OPNA 9LDTA 2BMDA 5HBRA 2FHPA 4PQFA 4Y2HA 2YQ5A 5BOVA 1KC1A 3MWEA 2RC6A 4IJ6A 4J90A 2IHNA 1AY0A 3PKZA 4KFSA 5CXXA 2IH2A 4R9SA 2IYZA 3O8OB 1DBIA 3SLGA 1ORWA 2YINC 4ZEVA 1MD9A 3A7DA 1E3WA 4EHLA 2OXRA 3HB1A 2N1MA 4LV5B 3TQSA 2J3QA 3KQWA 4Z9XA 1J1UA 2CZGA 3IUNA 1JT9A 3HE3A 4ZT4A 3P9RA 1KFEB 4C76A 4BZWA 1K4MA 1FTNA 3IMFA 3V34A 3DTVD 3LYUA 3RIEA 3GVHA 4X92A 4CGZA 1OMOA 4LJ5A 5LWHA 2IY8A 1GFIA 5L8VA 1JXQA 1U5AA 3H2YA 4K6HA 2C8KA 4M1ZA 4XH9B 2XXJA 4Z7NB 1OVMA 4URFA 2B8JA 5GOTA 4BQQA 2YC2C 1Q44A 3UMRA 3HL4A 1P3JA 1ZINA 3C7DB 3ZNQA 3U7HB 1N0HA 1QFYA 1QE0A 4LOLA 3IP7A 4TMXA 2PRZA 3NHKA 2Y92A 4NJMB 1TLLA 1V71A 3SJ7A 3TB4A 3PI7A 3L7LA 4FVTA 4Q16A 3ZWWA 1QIHA 4ML3A 2R68A 2W90A 3TCKA 4QJ3A 1L5SA 1GDTA 3R74A 2QX8A 2PL5A 3UWDA 3FTFA 2D2VA 2D5AA 2PJZA 3LYAA 3PLNA 4K9SA 3FCEA 1OPRA 5D5PA 1AQYA 1NE7A 5EE0A 3LW8A 3NWEA 1O9HA 3GXOA 3DXYA 3NHSA 2ZAMA 3T15A 4CQLB 4YX9A 4HAIA 2WSYB 1E2DA 2AMLA 2W6PA 3QKSB 2JEZA 4HDMB 1KK1A 2YNMA 5EJ4A 1XV5A 3UHPA 3BD9A 2J4CA 3F0TA 3SMQA 1QKJA 2W6ID 3MBOA 2XYVA 3W6ZA 1F5SA 4NJMA 1H6AA 4DTCA 1CHDA 2WABA 3AP2A 1V6CA 2ZYWX 2IE0A 2RJOA 3NDRA 5AI4A 4W5TA 1M2JA 2VK4A 4CHGA 2AKEA 5LP1A 2IU0A 3BAFA 1E89A 4DMCA 4ZQIA 2XYGA 1D1QA 3H83A 4W7HA 2IZ5A 1RLOA 1LPAB 5AM0A 4YRAA 3LM8A 2WAXA 4IPTA 5G4LA 3RAEC 1WZ2A 3GJ8A 1EWQA 1DS6A 2A57A 4Y6QA 2OV2A 4H18A 4LWZA 4HSGA 4REMA 5ALTA 2YYSA 3ESXA 3ZLVA 2I3GA 3MWGA 5LD2B 4HDMA 1F06A 5T57A 1DX9A 4LWQA 4EX7A 1B8NA 1T2UA 4TRMA 1ABBA 4UJ3A 4HYTA 2PUWA 3T7IA 1AA6A 5K3DA 2VEOA 2VYVD 1Q74A 3ZK7A 3L07A 1UK8A 3AUYA 4WLEA 1J8FA 1ECBA 3PBKA 2P2YA 4FILA 3U9LA 4QGSA 2J30A 2VHZA 3NHLA 5AJZA 2QNIA 2ZCVA 4FNMA 4PG4A 1WXGA 2BHTA 1C0IA 1VIAA 3GV0A 3T5MA 4KXXA 1Q50A 4AYTA 2WHQA 5ENVA 1Z0FA 3DEJA 4KZKA 3KVVA 5I7RA 1XXLA 2ISCA 2JA1A 2R6HA 2V8OA 5FBRB 4MSUA 2AFHA 3EJ6A 3ROPA 2HAEA 4NLLA 3RADC 1Z2AA 2VQ6A 3C3EA 1J8VA 1UXOA 4K9RA 1EFTA 2OCKA 4BWYA 2FR0A 4JBYA 1TW2A 3V8EA 1RYHA 1FX0A 1GRCA 1KOJA 1KSFX 2QI9C 2KYRA 3HJAA 3JWEA 3LK7A 2VHCA 3HPQA 1KAMA 4HNSA 1U04A 2IVZA 2EYQA 4CWAA 4E1AA 5L3VA 1SHLA 3OCVA 1WMAA 2ZIEA 5K9ZA 4X41A 3TG2A 5KYWA 1JYEA 4B1FA 3CKMA 3KZMA 3M6FA 4IIGA 5A04A 5D85A 5KC9A 2V3VA 3RABA 4GZ3A 1WMFA 3VZBA 5KYGA 1G63A 5HZGA 4F72A 2P2SA 1RD4A 2FEWB 5DZSA 4IDDA 4PU0A 3UJ3X 4ISCA 1NVEA 3UPTA 2XKKA 2JGEA 1LA2A 3HY3A 4C4ZA 2QQFA 4GEGA 2ARKA 5DE3A 4B9EA 1M2KA 1VSTA 3JPYA 4JVNA 2VZ8A 3BWVA 3C1AA 4AF8A 4AN1A 4NXNB 3MJDA 3QENA 1KBOA 4O29A 3SHTA 4XVUA 1W4BA 2RGRA 4FK8A 3MMSA 2E6KA 3MJ4A 4RAQA 4WECA 1Z6AA 1E2NA 1MF7A 1FXSA 1Y5RA 5F64A 2HQOA 4QM7A 1KERA 5EJAA 2Q5IA 5LQNA 1ZNXA 4TZTA 3WIEA 1OASA 1VPTA 2EFGA 2VJOA 4GI1A 1MORA 5G2OA 5BYKA 1JNXX 1EK2A 4KEAA 3A6FA 1VLJA 5HVNA 4AJ4A 4KK4A 2JNWA 2C5FA 3IAS6 1OSNA 1KMCA 1HMYA 3EZ9A 1YCGA 2DY1A 3HYTA 4TTAA 4DDHA 4EGFA 2K5UA 2POCA 1TVKB 1WF6A 4UOQA 4EI8A 4PVDA 5TLSA 3WYGA 1LFDB 3PGXA 4UHHA 4G67A 2I8AA 5HYVA 4CXMA 4HWSA 1CYEA 1HDIA 2WHYA 4BP8A 4BX8A 5DNYB 5E3IA 2H59A 5A71A 3WRYC 1DCFA 2Z30A 5C46F 5JQGF 1E3DA 2Q9BA 2P6PA 4WOKA 2IV2X 2QOEA 2DLDA 2IYQA 1VRVA 5K4HA 3PX3A 2NTJA 1HDRA 3CPJB 2FUCA 3N2EA 5F9MA 4EVIA 4WKCA 1HLDA 3IFSA 4BJ1A 4ZI2A 3TS1A 5KTRA 1AKTA 2BM1A 2CLEB 3FM9A 3T54A 1PR6A 2ZUEA 3RSGA 1XPOA 5KJFA 2PUEA 3AW9A 1OFUA 3FZYA 1TVKA 3TBHA 5LQDA 2P6OA 3KXDA 3FFWA 3CEMA 1CUEA 1XMIA 1Q21A 3TDMA 1E3QA 3F6EX 4LS3A 2CNOA 3PQ8A 2VF4X 3QY0A 3PL1A 4G0PA 2AC4A 2CUKA 2VDVE 5AT1A 2ACKA 3I0MA 2G70A 2DM6A 4O4JB 4R68A 2QE7A 3PC8C 5AM1A 5JAIA 5JZBA 3LV8A 4WVLA 3SJAA 3W3AH 4I7EA 2KHZA 4MVJD 3HDVA 1J00A 1QFZA 2X2FA 1IJEA 1J2YA 1X86B 1X7WA 3GAMA 4OHVA 4E07A 3G7UA 4DR7B 4R7TA 1F17A 2WNSA 5LIRA 4CGYA 2WHXA 4FFVA 5BT8A 2YOFA 2FMKA 2A0WA 4ARVA 3C3JA 1VKZA 2QG4A 4LBZA 1SA0B 1T1RA 4HWTA 5DDIP 5IFKA 2EWVA 3NBZC 2M6KA 3FIUA 2UXDB 2JLQA 1UUFA 1XD2B 1HK7A 4H31A 4JB2A 4Q05A 5LYJF 2G08A 3ANLA 2OV3A 1W8DA 3L6RA 5LIPA 1PJRA 3K0CC 3T4EA 3L5OA 5IP5A 4RA9B 4GPD1 1EMDA 4HNAB 2ZJOA 4IUYA 4ND7A 2PX2A 1XTVA 4IFTA 4KRXA 4IHJB 5D3ZA 3D0RA 1NW6A 3ZOKA 5KX5B 1DLIA 3EQ2A 4ZYYA 4QT0A 5FOTA 2JJ1A 1RXCA 2V5AA 1HFKA 2GM3A 1YH3A 1SZPA 3OZGA 5KS2A 4DRXB 2YV4A 4MPRA 3OTIA 4PAOA 2RD2A 5CLQA 4UXIA 3F6SA 3BQNB 3I8XA 2BV3A 5H5JA 2PL9A 4XB6B 1J20A 1RWVA 1JRLA 3NYQA 2BKAA 2J9YB 4D57A 3O84A 2IS1A 3OPYI 1QHEA 2QVBA 4Q7KA 5EI5A 3TW8A 3I1FA 1Z62A 3DW1X 1Z37A 4QU8A 4UM7A 1NURA 3FCUB 1S3FA 3UB3A 4A7PA 1UODA 3A6LA 2FG6C 2VP6A 4QGHA 1L5FA 3SZOA 5DO9A 2UUCB 3AUFA 4A6EA 3ITKA 3T7DA 2B1RA 4BDSA 3OJXA 5A9SA 3BXHA 4ER5A 3ENVA 2RKOA 5JCJA 2FDRA 4C4YA 2B1IA 3PJDA 5FUVA 4J9VA 4C2TA 4DUYB 4IKPA 3RTAA 4BB5A 3NRBA 4EUNA 4F9TA 1OV4A 4M6WB 3VAAA 1KDRA 2QT0A 5FAXA 3ZI7A 4V02A 5HRUA 1QGUB 1Q1BA 2Z9DA 1LBQA 4GS5A 5JCOA 3CBGA 4GGOA 4KMRA 4WA8A 4YMGA 3WYNA 4D46A 4ENPA 5AIAA 4C6TA 3KSZO 1BMDA 4KDRA 1XCMA 1MO5A 2PXAA 5FI0B 5EPUA 2BTOA 2O1WA 4ESOA 5JJLA 4C7VA 4KK3A 3RS8A 4CNQA 4YK7A 3BDIA 3V4SA 1N5MA 4JC4A 3V8RA 2PX0A 3G8DA 4C0HA 4RX1A 2BF7A 2I2FA 2WC1A 3DA8A 4O1MA 2ZIZA 3AHEA 5DP2A 3EB9A 3X1JA 3HXMA 1TZJA 1SUFA 4RORA 3EFBA 1HRKA 4S04A 1QIDA 1NWHA 1TL7C 2V58A 1OXBB 3GRRA 3T8YA 1RMTA 3LDAA 4B82A 3KTDA 1BA3A 4IHQA 3GVCA 4BATA 1X9IA 1JHPA 1VIDA 1Q7RA 2NSYA 5DP1A 4GNKA 2F1KA 3VYRB 3EH1A 3HPRA 5LB2A 5ILQA 3QKRA 4HVTA 4BGEA 5LOVB 3EVZA 3W77A 4B46A 1FDSA 2WYUA 4PXSA 3P2KA 4Q7LA 2HDWA 1ZCZA 3WK7A 3ACBA 5EHGA 2AN3A 1OZHA 1A50B 2PFSA 4EFLA 4YUWA 1U8UA 1MDFA 1XQ9A 2OZEA 3X1YA 2NT3A 1DAKA 4PSUA 1N8SA 4BVLA 5LU8A 5CYPA 2IYUA 5C37A 2ZCUA 3PENA 3NGLA 3U49A 3WKCA 4F60A 2FSSA 3PFCA 3H2ZA 3WNZA 3ZGXA 4B80A 4EWLA 1KBQA 4DV5B 4LZOA 3JQGA 2FEAA 5EQDA 4AYWA 1FLVA 3OD1A 1P1HA 4KGDA 3LS2A 2OQIA 4MIOA 1WPRA 4PFKA 4WNAB 2B9VA 2AQIA 4FE3A 3ED5A 2X58A 2ZUUA 1UADA 2ADMA 2DYKA 2IZ7A 3WV5A 5JMOA 3OEEA 4GWGA 2YMLA 2UZ3A 2IEYA 3GLIB 1QONA 2QUHA 3PXAA 4XZ3A 2AWNA 5FUQA 4JUIA 1XA0A 1MOQA 4BXOA 1K8QA 1V8FA 2EKPA 3AETA 3EOAI 1PG2A 3GJTA 2FXIA 5FNZA 1P81A 1UZUA 5A4JA 4FLEA 1EUDB 5CDFE 1J70A 2UZ1A 1L3IA 2QY9A 4LNAA 4RFVA 1DKQA 3L1JA 3DMTC 4DR4B 4NG4A 2XVAA 3VV2A 5E38A 1T3HA 3NUQA 3R7SA 3EAFA 3D4OA 3W1VA 3WHIA 4YI3A 5ER9A 1GV0A 5TIIA 1CUXA 1Y3BE 3PR2B 5G02A 1NONA 1H8EA 1PUJA 4PLFA 1M8FA 1POXA 5IAEA 1NTOA 1MIHA 4HDNA 2MR5A 3CSUA 5HA5A 3I6IA 4KXNA 2Z1MA 1U4NA 3WK8A 2TMKA 4JB0A 1T8WA 4PYLA 1OTYA 3SQWA 2Z57A 3UAOA 4YDRA 4XIIA 5AJXA 3JYLA 3EIQA 1OIWA 5AO9A 4NEHB 4CF5A 5DHRA 2OXTA 5AI8A 4U3JB 1JXOA 2AE2A 1WW2A 4ZI5A 3GT7A 2VRBA 3F4LA 4K6FA 1HT3A 2O1XA 3A10A 3AR7A 5LP6C 5JAPA 1VE7A 5F33A 4KMSA 1YRQA 3K0KA 5F4BA 1NDHA 3DH0A 3E7DA 1BGVA 3OPQA 4I55F 5CDTA 4Y1RA 1IEXA 2Y0PA 1OBVA 5CFRA 4L0QA 2DUJA 4F5EA 3SGLA 3DAOA 3P32A 4JXKA 1CIVA 4O3FA 4EDHA 1UCFA 3DVAA 1NVUQ 2Z9CA 3C6QA 4EMSA 5LR6A 1US8B 4TTSA 1T0JB 3CZCA 2O2YA 4NMLA 1MJ5A 2FSVC 2J48A 3RHZA 1EBBA 4Q4JB 3WHLA 1BRTA 3R0VA 3EVFA 4X97A 2PFGA 3E5NA 4DLRA 1CUDA 1OX4B 3JRWA 1F0PA 3M4ZA 2RGCA 2WTMA 5G1NA 4DABA 1DINA 4X8LA 4PRZA 4DR3B 3KSBC 4B44A 1A98A 4NFLA 5E4FA 5JSZB 4WK6A 3MB5A 3L1HA 2DTEA 5JANA 2CBZA 1NWCA 1KHHA 3OJOA 3QLTA 5D6OA 1TQ2A 4BCBA 8ATCA 1GPYA 2MU1A 4QC2A 2NPOA 4J4HA 4C6HA 4ZQGA 4CR6A 1T3GA 5HUJA 3TOSA 3K1ZA 2D5CA 4MYUA 2PSFA 2C29D 3L04A 4RHUA 3O4JA 1E60A 1V43A 5EP2A 2FPWA 3SIXA 4UBKA 2OYSA 3GIWA 4I4TF 4F4DA 2RHTA 3FWYA 4Q4JA 1MV8A 5H9VA 4FEYA 4LYDA 1ZVVA 1OX4A 1FP2A 2ZYDA 2Z5FA 4RZXA 3GGCA 1RFLA 2GHIA 3VBEA 1Q1NA 9GPBA 4BU1A 4IDFA 1V1RB 1JVNA 1NVMB 1R6TA 2H16A 2JBWA 4OXRA 1AZWA 4X20A 4XDGA 3R20A 4DLLA 1KEKA 3TIIA 5JSZA 2DBYA 4YMIA 1O54A 3EEIA 4CM1A 1ZAYA 3U7RA 1ML4A 1KSGA 1SUAA 1Y6RA 3S1LA 4C21A 3PHLA 3VJKA 2BGMA 3WK6A 1UXKA 4P86A 3VTFA 3VZRA 1ZQ1A 2AIRA 4C0BA 2AGVA 1Y6FA 3AXSA 4M8NE 2QQEA 4BFCA 1FY2A 4JI5B 1PT5A 2J85A 4TTQA 3V3KA 4UARA 4I2VA 2EIHA 2B1QA 2XD4A 2XWSA 4R1UA 5EEGA 2PT6A 4G23A 4EHJA 1B16A 1M0WA 3CNOA 2WWRA 3MOGA 4MUFA 2WZBA 1JHYA 1OFTA 2D0IA 3L8EA 2J3DA 4YJ2B 5GQSA 4ARZB 4LFAB 4F86A 3O31A 5GJBA 5KOHA 4MMXB 2HQSA 5CNIA 1AIPA 2Q49A 5B1HA 3GLHA 3RSLA 2R8RA 4Z9BA 1V4NA 3I30X 4KH0A 2OV1A 1KAOA 2ZVJA 4M1EA 2HV8A 2VHEA 3PXCX 4IJVA 4KPEC 4Q4AB 3P9CA 4PYRA 4QJBA 3TUJC 4EY7A 1UFRA 5DRTA 1VM6A 2JHGA 3II6X 2G6BA 1G8FA 5G0WA 5K0CA 5HILA 1NMEA 2FK8A 2ZIXB 3OZFA 4N4AA 1XO1A 1EZ1A 2WLTA 4TLLB 3ZWPA 3TGLA 2Z98A 4TMKA 4D4HA 3OESA 3EH2A 1AKRA 4WACA 3B6MA 4WFQA 5AM5A 3PC6A 2NU6B 3RM3A 4CCSA 4HUJA 4N6GA 5FFFA 1IQPA 4H0CA 1R4ZA 3ODGA 1ETUA 4YJ2A 4OU5A 1IUPA 1C0KA 3JW8A 3W3AA 1QK3A 2QD4A 2CMGA 4IM7A 1ZNYA 3FB1A 4FCCA 4F06A 1QF7A 4OBEA 4BEBA 3SYLA 1QE5A 4HLCA 4P6VF 4DJTA 5A4MS 3N0WA 3DPSA 3WWDA 5KYVA 1HUQA 4LDZA 3ESZA 1T4CB 4U00A 4B0OA 4BV3A 1JYFA 2FSHA 4FN5A 4R3UC 4Y67A 2G09A 4PYQA 5GPBA 1YB6A 4C88A 1JU3A 1WTCA 1KMHA 2ZIXA 5JYDA 3JXEA 1JEJA 4BWFB 3VKHA 1VE6A 1RS0A 4RH0A 3R7BA 2F3TA 2QENA 4FUQA 1QCDA 4NCJA 4ENVA 1YRWA 2VQEB 2HI0A 1P19A 4MHOA 4RF4A 1KY5A 3EFHA 2FZGA 3RANA 8ADHA 2PXXA 2IUTA 3AOGA 4PAGA 5SY4A 1ISRA 5BOSB 1TJNA 4L4SA 1Q0LA 4Q03A 4YUXA 5DCUA 1ZX1A 1EXNA 2CDRA 1KAQA 4J0KA 4MJLA 3EXFA 4TQGA 4MWCA 1Z7BA 5J4YA 2ZE5A 1U7ZA 5DM60 3RF7A 1VCMA 3E6AA 3JU3A 4FYXA 3V4FA 4MUNA 1EJ2A 2QUIA 1Y7PA 1QZUA 3ECAA 3R2JA 4LK3A 4V03A 1IJKA 3UYKA 3RYCA 5J5AA 5IWAB 2ZM5A 5FNVF 1JFTA 4WJZA 5FWYB 3U2QA 1BAPA 1NY6A 1LFAA 1K89A 3TW0A 2A4MA 4OXXA 3C5EA 1WUIS 2RH9B 1VJCA 1TTPB 3I1IA 2A59A 2ZR8A 4R5HA 3GF4A 2PRSA 1FSGA 4B8WA 1BJKA 3NH9A 3NWOA 1QUFA 3TJRA 5FDFA 1VRCA 3A6DA 1E7QA 4N0QA 1JI0A 3KQKA 4LNHA 4M8LA 4MTLA 4RAOA 3HGQA 1I5EA 1JLKA 2BZGA 4X6XA 2I2DA 1R00A 2FFQA 1PL7A 5JS2A 3ZDCA 3W2EA 1VGQA 3N2GB 5LZ8A 1GZ5A 1JPJA 1I1QB 3MUEA 4JLVA 1H2HA 5E6RA 3RVQA 3QYJA 1PG5A 1MLDA 4D0LB 5AVZA 4J7UA 4WJKB 2OHFA 4MUYA 2Q2QA 5JH7F 4C0QC 1OLOA 1ZGZA 3GT0A 5FWYA 3ETEA 2FFAA 5EJ9A 2PGJA 3AF6A 2PS9A 2P69A 3FGZA 3GUHA 3TIXB 6REQB 3STXA 4R0NA 2F64A 4B6GA 5KSPA 5T3YA 1T9GR 1A7KA 3IV7A 3HFRA 4FB5A 5ABPA 5FTLA 5I4CA 3RFCA 1MDBA 3SS9X 2Z0MA 3HHEA 4UMDA 4X24A 1WXDA 2FGKA 2IPXA 1MQ8B 1OWOA 3BK2A 2PUCA 1V2GA 4PM4A 4OLFA 1BQ3A 4TYNA 1N0VC 4DXAA 3FFAA 4YCJA 3PCTA 2RC5A 5AK0A 1AKWA 1MP0A 3OEHA 1C3JA 1N5RA 3ABQB 5ECYA 4EA6A 1TUGA 3N2GA 4CIAA 3ZQJA 4NYJQ 4Q4LA 3DB1A 3ROMA 1MAHA 2VSNA 2VVTA 3NTRA 2VHVA 2ONCA 1YKGA 3H9EO 1AQ6A 1RC1A 4ER7A 3OF3A 4EAQA 2QX9A 1UMBA 3K16A 1G8AA 3L40A 1YA4A 1CVIA 1W2GA 1H22A 2JVJA 4POOA 3V4LA 6REQA 1Q3KA 1GA4A 3U3KA 1X39A 3U7IA 3K6KA 5J5CA 5ICGA 3U0VA 2HIAA 2VCYA 2EFYA 2GEFA 2QU8A 2AFIB 2X41A 4BKOA 1MFPA 1AU9A 4XGQA 2QE6A 1Z6PA 3L0DA 3L6OO 5L45A 1GZHB 4OXKA 1KDVA 4U7PB 1H4TA 4JLKA 3SXJA 4L28A 4C07A 1B00A 5LQUA 4V1CI 3LVFO 1Q5PA 2Q9AA 1QHIA 3CLHA 1TC2A 5E8JA 3RT1A 1XYGA 2CNKA 4AZ0B 5BVHB 5DHQA 1HZZA 1DQSA 1NZFA 1TK9A 2V7QD 2ACVA 5LVAA 3PEWA 1FDIA 4B3RB 4M9SA 1K8YB 3NXKA 4Y8VA 4F3KA 3JR7A 1ESEA 4NZNA 4W5RA 1OIVA 3U4AA 1KZYC 4YJHA 4J7XA 4MV0A 1G5QA 3LWDA 4KE7A 5AVUA 3B1XA 2XB4A 2AFIA 2JH8A 4MYCA 1P9LA 5HBGA 2YYAA 4LV6A 1QHHA 1XKLA 1OI7A 3ZCTA 3IQIX 4RTJA 4UHBA 1WMSA 2Q5EA 1QOZA 1NKTA 1XWWA 1ZJJA 1HEUA 1M6NA 4RNDB 4BNLA 4HI0E 5E95A 1W7AA 2WG2A 4NDZA 2B94A 1V8OA 4TZ0A 2H54A 3ILYA 3TX6A 5BVHA 5K0SA 3AUKA 3BIWA 4M9CA 1ULSA 1M3SA 4PSKA 1T0PA 2B4TO 2CMDA 5D3QA 2YFKA 5ALUA 2HC9A 3N58A 2I3BA 4WESA 1KKUA 3HKBB 3JQ8B 3LY7A 3SM9A 3STUA 3RK4A 5IEBA 1GD1O 4FINA 4R9RA 4DZZA 4MV9A 1OZGA 2W71A 3ZC3A 1TEHA 4JQYA 1NNSA 1E2UA 3FW1A 1ADJA 1TD9A 2O0HA 5TE9A 3ZKAA 4BO8A 1SVWA 1IMOA 2HJRA 1BYIA 1JPVA 2QRHA 1II0A 2V4UA 1OWLA 2VJNA 3LHFA 4RQUA 3RFVA 1Z5WA 3FBGA 5L53A 1HGXA 1PDOA 3RRFA 2VOEA 2GRAA 2Y1CA 5AVOA 1WBBA 1QP0A 2WMNB 4HH1A 3CBQA 4DUPA 1DAHA 5ALYA 2ZZMA 1IE3A 3H17A 5GZ6A 4EMBA 4QRDA 3KKEA 1ODCA 1N1EA 4G09A 1D2AA 4FKMA 3LCJA 3EGXB 1MT0A 3HKBA 3JQ8A 3IR5A 4GI5A 4M87A 5DIFA 5ERXA 5B3LA 3OLCX 4PLYA 1CF4A 1M73E 2P2NA 3RAFC 1W93A 4JY7A 2IYSA 1UKVY 3KE9A 4XYGA 4DIKA 2C98A 4AD8A 3AJRA 3KYDB 3R6TA 4PIMA 4RYLA 4U5XA 2LKCA 4I9NA 1CR4A 1FA9A 3SY8A 1QM5A 3GJQA 3LXRA 1K8XB 3B52X 2VJLA 1NGSA 2CL7X 3GGPA 3R0XA 4OLJA 1XPUA 2JFQA 2O4UX 2BE9A 3GEHA 3V8QA 2Q1TA 2PRJA 3LP6A 2O1EA 2Q07A 2J09A 1S0UA 4NI5A 4XB2A 4C0AC 4YAIA 3KIPA 5KWSA 5M2QA 2HHHB 3W7BA 2HIMA 3EGXA 2HZBA 4NCHA 1G4UR 3T1YB 4KQMA 2OVFA 1BOFA 3EEBA 3NIDB 5B2FA 1RYNA 5AXCA 3IJRA 5EHZA 4HMOA 3ANXA 2W22A 1AHNA 3I12A 2G82A 4GR4A 4ZTBA 1QIFA 2QI9F 3N39C 4OQYA 3K5PA 5DNUA 4MI3A 3ADBA 2FUEA 3IP9A 3M0EA 1MRNA 5CTAA 5EHIA 5JASA 1WZIA 3B53X 4TSFD 1Q7GA 2V0CA 3AR9A 1M34B 1IY8A 5IKOA 5IFLA 4JLPA 4MH0R 3ME5A 3KXPA 4B4KA 3G8BA 5JW6A 4AMGA 4XM1A 2ZSHA 3QEOA 1M7BA 2C9YA 4LYHA 3T12A 3FNFA 5IXJA 1U80A 2I2XB 2JK1A 5ALPA 1TTHA 2PO5A 2ZT8A 3NHZA 1GSHA 4PHTA 3PQDA 2P8JA 2CK3A 3VU3A 4E5DA 1JEDA 2A33A 1VSVA 1B3RA 1G8KA 2EQAA 4ICIA 5K0TA 1T2AA 2P1ZA 4PYNA 2BKXA 2JATA 3IVCA 5J63A 4IICA 3LUAA 1NW9B 4YMVA 3VJMA 3FSJX 3SSMA 3Q3VA 1UZAA 4MDEA 3IR6A 1YR2A 2GVDC 1E2MA 4JQZA 1Z7EA 2YICA 2PKQO 5EVJA 4MGEA 1G8MA 1RXEA 2BMWA 3L0PA 3RSHA 4NBTA 1KI6A 1BS2A 3VPHA 2VDLB 4IQGA 1T24A 4KN5A 2NVUB 5DLPA 3N5KA 1OZAA 2DRIA 1ORHA 1FDWA 1ZM3A 3NKVA 1Q92A 4D9HA 4FIDA 3NHUA 3DEIA 1QVWA 4IWXA 3ZYZA 5EG5A 1WETA 1N0WA 3AM3A 4L15A 2GCPA 3LQ4A 4HB3A 4LE2A 4ZPXA 3WWPA 1ISHA 1W0JA 1ZVMA 3EPRA 4ID3A 5CW2A 3RU7A 1WCWA 4BUZA 4DUGD 5LUAA 4FFDA 1RXVA 2RH4A 1O4WA 1XMOB 2COKA 3NWBA 2FZ5A 4BPBA 1PSWA 1PUIA 3KU4A 5JSFA 1G7RA 5SV2A 2AA3A 1GZSA 4CKXA 1VCOA 1ZD8A 3EGCA 2NUAA 1A9QA 1OU0A 2DFPA 2FY8A 1X7HA 3EGEA 3EQ8A 4OD0A 1MCZA 1C29B 3D7RA 5DHAA 5DSTA 3UM9A 5EJ6A 3PP8A 4QFMA 1O8CA 2ZSEA 1BCSB 3OJEA 4OL0A 5F21A 4J0IA 1TUBA 3DKIA 1NUHA 4QLBA 1WEKA 1I2MA 2ZRBA 3HYRA 4FQ7A 5EN4A 1OD6A 1UFQA 5HCIA 3T41A 2GPNA 4NPHA 1OPXA 2CB0A 3R76A 1CJTC 3MBKA 2X6QA 4P36A 5A5DA 3I61A 1CLUA 3G0BA 5KYKA 3PU6A 4EB3A 3H6GA 1CEYA 4WASA 1H2AS 1V9LA 4E88A 1I3CA 1SN7A 1SKYE 4HS9A 1UP7A 2RBKA 2CCKA 1DKLA 3VR6D 2IY9A 1OBOA 3CCCA 5SYNA 3IV6A 2O23A 4ZRDA 3OIVA 4JGBA 3KM0A 3OCCA 1K7SN 1JG1A 1T9HA 1VLQA 1YJCA 2VNAA 3CG4A 3M1IA 3R7LA 1Z8NA 2Y77A 3QHPA 5G0VA 4YT8A 3ZHSA 3DW3X 4MZDA 3KKNA 4NOKA 5A2QA 4DMHA 1BS9A 3IO3A 2OL4A 1U0TA 1Z2CA 1NJGA 3MBIA 4INZA 5DWVA 5C5CA 2OA0A 1QUEA 2OAQ1 2VBGA 3ZJ5A 1L7VC 5KNDD 3P4YA 1UIMA 4OHKA 2DETA 1JAZA 1UJ2A 5HS6A 3U9TA 1Z6GA 4ZCLA 1XROA 3KJEA 3LBHA 1XTSA 1Y8RB 2NX2A 3IVAA 4PGFA 1IZ0A 3PRHA 1ZMXA 2NPIA 2BHNA 4QREA 5DHFA 1R0YA 3OIDA 1NXOA 2P4EA 2WZQA 1GV1A 3PIDA 1XI2A 4NBSA 4JJFA 1A76A 1AUVA 2VL7A 2RIRA 1KP9A 3RTBA 3VSBA 3ID6C 4H17A 5IS2A 3HV0A 5LSAA 2J3MA 4KXMA 4NH4A 4QG3A 2ZPTX 4NS1A 4D4MA 1GTVA 3ETDA 2CLLB 2QGZA 1N5LA 4I5DA 1MOPA 3LDUA 1F60A 1FC0A 1OAOC 1RYZA 1V7PC 4U9UA 1QRUA 3D4NA 2ZSBA 221PA 3OU6A 4E5UA 1Y8RA 2IU3A 4HF7A 4G0WA 1A0OA 1XCJA 4MROA 3W1EA 5JWOA 1ZITA 2X0FA 2AI3A 1CEXA 1H4SA 3RT7A 2EERA 1DX4A 2ADFA 4XOIA 3IUMA 4E1VA 2ZSJA 4WEOA 2PK3A 3OLQA 2FE1A 1JEEA 5E9WA 1DO8A 2JH3A 4EJFA 2OCYC 2G63A 3JVEA 3DEHA 4GOJA 1WXWA 2I7XA 5F1PA 4GO1A 1CR0A 3Q88A 4HDSB 4OHZA 2HWKA 4ABYA 3BRWD 3SOZA 3UWMA 2V7BA 5DTIA 1WVGA 3GAZA 2VYFA 3CLRD 3R3ZA 4QA9A 3TTWA 3ZHUA 4D4KA 5M29A 5JS7A 1ECLA 2JGNA 5KHAA 4EYSA 3A31A 4HLUA 1VCIA 3E3OA 3Q9NA 4URXR 2X9NA 1I4TD 3D2CA 1E3LA 1RLJA 2H5LA 5JQWA 4XX1A 2G71A 4BO9A 3DR3A 1SU7A 3AIOA 2WM9B 3CRW1 1YDGA 4PZLA 4KLZA 2CXPA 1G1MA 1KEWA 3K35A 4Q66C 1Y3HA 4RPIA 4Y6LA 3WGNA 4B3CA 2Q29A 1MAVA 2XYPA 4HDQB 4Q01A