1FYHB

1:1 complex between an interferon gamma single-chain variant and its receptor
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
212
structure length
201
Chain Sequence
b'VPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon gamma
molecule tags Immune system
source organism Homo sapiens
publication title The structure and activity of a monomeric interferon-gamma:alpha-chain receptor signaling complex.
pubmed doi rcsb
total genus 42
structure length 201
sequence length 212
chains with identical sequence E
ec nomenclature
pdb deposition date 2000-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fyhB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fyhB01
2ZCKH 1NFDF 1ND0A 4OBSA 2IG2L 4P59L 1IC7H 4IRJB 3GIVA 3RX5A 5GGVY 2VQ1B 3FTGA 2GT9A 3BX7C 5DDHA 3BWAA 3M07A 1OF2A 4PJBE 2G5RA 3BPCB 3CU1A 1UADC 5E03A 1L0YA 2ARJA 3GM0A 2VDMH 2ZSWA 1CIUA 2J8UA 3GSVB 2BC4A 1X4YA 3PHOB 2XXCB 3PP4H 3QQNA 4Q9BA 1GGIH 5HYQA 2Z35A 2Q20A 5IHUL 3EDDA 2EIDA 5GSRB 1MY5A 4QHUB 4HIIB 4FQCH 4JLRB 1AO7E 2DTMH 1DSFH 4CVWA 4L5FL 5EU6D 4CMMB 4RAVA 4PRIE 1Y0LA 1ZA3A 4HG4K 3BW9B 3DSFH 1U93B 4DQOL 4J8RB 1AC6A 5ISZB 5AEAA 4HWZB 4PJXB 4ELMB 5IG7A 2AEPH 4JN2B 5C0FB 4APQD 3H7LA 1OP9A 3FCTB 3V4PH 4X7FC 1ETZB 2VTFA 1G9NC 2DWEA 1TZHB 4XAWH 1B4JH 3GM8A 1FNAA 3ULUE 1IEAA 3HRZB 1T1YB 4Z95L 1FV1A 4HGMA 3LKSA 5MI0B 3FT4B 3KYAA 5AAMA 4ZXBD 2KKQA 1ZA6B 3UEZA 3BN9C 4RWYL 2BVUA 2VLKD 3DMMB 3JUYA 3G6JE 3ZDYF 3TIEA 4FQXD 5SWQA 4X7SL 5IF0B 3MZGB 1SM3L 1T66D 2VXVH 4UQ3B 1IGMH 2NY0B 3LOWA 3X3FL 2VDNL 4KUCD 1EO7A 3QQ9D 5DUPH 4GW1A 5E8NB 1EAPA 1EGJA 5E6IB 1S7WA 4NKDA 1B88A 5EUOE 2EDEA 3O6KH 1KIRA 3ZKQD 4ZYKA 3FHQA 1D9KC 3IJSA 1MOEA 2AV7A 1JCKA 4PJ9B 2XRAH 5FCSH 5IB3A 3MUJA 2EECA 2APTA 1KLGA 3HR5B 4NZTH 1R3JB 3HG1D 1GGBL 3RWJB 4G7VL 1HHKB 3AY4A 1NBZB 5JW3L 1YEHH 3LEVH 1XGTB 2F5BH 1XF3B 4LCCA 4RRPA 3DI3B 4K71B 5FYKU 1MFDL 2YPLB 5TDNB 3IAGC 3SCMB 4ERSL 4HIHB 4NZUL 1GGCL 4GBXC 3SDAA 5IBLD 3X12A 2E6QA 1AKJB 4JPIB 3CSYB 4HBCH 1J1XL 4RGOH 5BJTB 1XF5B 5DJ2A 1IAIM 3P4NA 3RX8A 2WINA 4MA3B 1UM4H 3G5YA 1CDGA 4XNYL 4EUPA 5HHOE 1OM3H 1S7WB 4QWWD 1AKJA 3PQYD 1SHMA 5FHAH 1TZGL 1YMMB 5HXMA 5HGDA 2EKSA 4G6AC 1D5BB 2AK4A 4OV6F 4BKLB 3WSQH 1AIFB 4U1KA 4PJAF 4C54A 4JFED 1MCLA 3AREB 3JV5A 4DOHE 4M43H 1JYNA 3Q3GB 3ARBA 5FYJL 5CWSA 3WD5L 3WNLA 3P0GB 3E0GA 2J5LB 2ZJSH 5D5MB 1LEGA 5J1TC 1U8NA 1WWWX 4OCWL 1OSZB 3FTGB 4LSQL 3RVXD 2XZAH 2VOTA 3OAZH 5JQ6H 3MBXH 4M8QA 4X6DF 3MXVL 1CLCA 3SO3B 1TENA 1CR9L 1AXTL 5DMKA 3K46A 3TPUA 3WD5H 4U1MA 1T5XB 3VXSE 4XXDA 4FFWC 1RY7B 4LQFL 3QDGA 3RJDA 1KXTB 5F96H 3HZMB 1KTRL 4KK6C 1FRGL 5ANMA 1FO0B 3O6FD 4WI8A 3DXAB 1UB6B 4IRZH 5BZDB 2IQ9H 4LLUA 1EPFA 1LILA 1EO5A 2ICEA 5FHAL 2A77H 1GVIA 2ADFH 2IFGA 5TQ0H 4YDIL 4DGIL 1CE6A 2DBLL 1IQDB 5DMGD 2P24B 2E5EA 2F53B 5EZJB 5GGUA 3Q6GL 2Y36H 2D31B 1V3KA 2CRZA 2HT3C 3BPCA 5L88H 4JQXA 2AQ2A 1A14H 1VERA 3ZE2F 1S7XB 4PBXA 1AO7B 3D3VB 4NQSA 4KKLC 2C1OB 4NUGL 3QXAA 1QG3A 2XNAB 5D1QA 2GUOB 3E8UL 4MS8C 3VWKA 5DUMH 5JHDE 2FBOJ 1EHNA 3SKOB 1IZKA 2C5DC 3EOTL 1XIWA 1XCQA 2P8MA 2F54A 1X6NA 5E7FA 3T1FA 3UC0L 5I66A 5IW6A 2P5EE 4AMKL 1RZ7H 4JQIL 5JXAH 5DA4A 5CKAA 2HFEB 2J88H 5BOPA 2BCKB 1SQ2N 2GY7B 1DVFC 3MMEA 3PDOA 3QPXL 1S7VB 4JFOA 1N3NA 1DQJA 3C8DA 5E2VL 3SKNB 3S97C 1CZ8L 3FB8B 1TFHA 1BX2A 3H9SD 3HLAA 3TWCL 3MUGB 5CZXD 3V4VH 2J88L 4O2EB 3ULVE 1U2HA 1AD0B 1LD9B 1RZ7L 5D72L 3SE4A 2ZCLL 4HIXH 1Z9MA 1FNHA 1NFIA 5HYSB 5H8DA 4V2CB 1AJ7L 2CLVA 4HJJH 4KROB 5TJWK 4PGEA 5GGTH 2W92A 4RWYH 3F5WB 1RZJH 2NY7H 4KY1L 5C9JA 5MEPA 5ITFA 1Z0NA 2DLIA 5IEHA 3FB6A 2V7NB 3MGTB 2RCSH 5MERA 2ESVE 4WUUA 4UBDD 4RMSA 3GMLA 3D0LB 1TXKA 4K7FB 2BVOA 3EGSA 3UTZB 1RUQH 3IT8D 5BXFA 2RB8A 1I85C 4PB0H 3LKQB 4PR5B 4ZUVA 3KYNB 2VLJA 4OZFG 4ZOEA 2NXYC 1I1RA 1RVFL 1C1EL 1NC4D 2VQTA 3ZDZF 1J12A 1FL5B 1C16B 5B38G 1A6UH 2WK2A 1JPST 2YPKB 4FP8L 2J6EA 5BVPL 2F54D 1KIUA 5EOQL 5F1NB 1QNZH 3C5ZB 5LWYL 4WJ5A 2ZUVA 2Y5TB 4FTVE 3ALPA 3BIKA 4E0RB 1XGPB 1FL5A 5BV7C 4PLNC 1Z5LB 4IDLA 5IMKA 2DI7A 3BP7A 1HHHA 1ZWIB 2VYRE 1JPSL 2N56A 4JHWL 2QSQA 4NQDD 1C5BH 4O51B 5K9JL 3SGDI 1WLHA 4J3WA 4BFGA 1Z9LA 4ZFGH 3FO2A 3MGTA 4XPHL 5MERB 3CXHJ 4HJGA 2OR9H 1CDIA 2VLKA 4KI5C 5DD6B 4JDZA 4LGPB 1R24A 4Z7VB 1H3VA 1MUJB 5JOPD 2GK2A 3MNZB 5GRUH 3HUJF 3TYFA 3BYTA 5HYSA 3BKCH 4HFWA 5E8OA 4BFEA 3TLRA 4Y19E 3UYOD 2JB6A 4Y16D 5F93C 3TVMA 2O5ZL 4ODWB 4OD3L 1G7IA 1MI5E 3TA3C 2OP4H 3FO9B 1UYWL 4GO6B 2CLZA 3WXWH 4D0DB 3WXVL 2CKBA 5EU7E 2YUVA 3ARDB 5HHME 4MB3A 2VB5A 3ULVF 1WV7T 1SYVB 3LS4H 1CD1B 3HNVL 1EHXA 1IQWL 2HMID 4U0QB 5H35B 4NRZB 1WIPA 4JO4H 2IMNA 4UDTA 3GO1L 3U83A 2P43B 5E8EA 3FQTB 4JKPH 3QSKB 4N1CA 4NO5B 4DUXA 5IVZB 5DTFB 4KI5E 4KFZC 1VGKA 1R3HB 1ZT7A 2QR0B 4L29B 4Z7WA 1V05A 4QRSB 1OLLA 2AAVA 5B38B 5DRXB 3KLDA 1MRDL 4U7SA 4RFNB 3RWFB 1TNMA 4KDWA 3H6JA 3VXNA 5F7KC 1CE6B 2BDNH 2FJHB 4AM0B 3RGVC 4PB9L 3VRLE 4GXUN 2FLRT 2XWBB 5E1AB 5KSBB 1SJEB 1MFEH 1INQA 1NBYB 4P5MB 5DHVH 1JPTH 43C9A 2CH8A 2DAVA 3GRWL 4H0IA 1AGDA 2YZ8A 5C86A 5F71A 1I4FB 1MEXH 3OGCB 4WIQA 2R4SH 5C09B 4QKXB 5MENA 1A3LL 1SY6H 4HT1H 3MBEC 4OFYA 5E4EB 1JL8A 3ULVD 1C12A 4E41E 3OSKA 4AZ8A 1XR9B 4IRSA 4KU1A 4P46B 4IOFD 1MCIA 3WSQL 3TV3L 4E42A 1JV5A 5DMIL 5IEKA 3QRFM 4CAGA 1F4HA 5GGVL 4LBEA 1NKRA 1FGNL 5CILH 4K3HA 1FE8H 1U8OB 2HTLC 3ZKND 4O02L 5HYIA 4JVUA 1W0VA 3IVKA 2H41A 3ILQC 1P84K 5KSAB 4IHOA 1IEHA 4HUXB 1J1XH 3T2OA 2WNGA 4TSAH 5T3ZE 5JA8B 2GSGB 3KXFB 3RU8H 3BP5A 4Q6IC 2VR4A 1D6EB 3UJIL 4F7CA 5C0EB 4P5KA 4ZXBA 3IFPB 4R4BA 4NOBA 4HSQA 1CXIA 4B7IA 3QYCA 5KW9H 3GK8H 4RISH 2R29H 1QD0A 3QO0B 3S88L 1BMGA 3KYMA 4LKXB 3VMPA 2M8XA 2YA2A 5CSBA 5FDWB 5DJ2B 3BD3A 4I13B 1AGFB 4GMTH 4J3VA 3V0VA 4OT1H 5GS0D 4G5ZL 3ARFD 3ZYZA 1RURH 3P4MB 3MLZL 3SDCB 1JNHA 5T1DH 3ECBA 3OF6D 2HVKA 1XAUA 2VN4A 3FQRA 1ZT4A 4PP1D 2X9WA 2HLAB 2P5WE 4UQ2A 2VDNH 4W70A 4D9RD 4P23C 3MJ7A 4G8FB 1IEBA 4WFGE 2BNRA 1OGAE 5EZIH 3S4SA 4NJ9L 4ZNEE 1RU9L 2D7OA 2XA8L 1GRWA 4KRPD 2FX9L 5I1IL 2OQJA 3FO9A 5J12B 3HC0B 3UPAA 3HI6H 3ZYJA 4U2ZA 5KJRH 3PHSA 1SVCP 4PUBL 1U8LB 4UAOC 3MLVH 2YWYA 2HA1A 4Z8FH 2M2DA 5ETUB 1GOHA 1BBDH 4ZOBA 4YLQT 1GIGH 1IJ9A 4MA7H 5EOCL 1RJYB 5J06A 1RZGA 1W8NA 4Q6IB 1LP9B 4KHXL 2RAMA 4QT5B 1DVFD 4DQOH 1ZEAH 3DSFL 4FXKB 2Y5TA 3C5ZC 4Z8FL 4WEUD 4WTZA 1MWAH 3ZTNL 1G9EA 2WWKT 4JPKL 2QADB 2JK5B 1U42A 1WFNA 5DHXB 1JTTA 4LCUA 4PJDE 1ACYL 3S98A 4XRCB 1I1AA 3HCVA 1GGIL 3D9AL 1OTTD 5BMFL 5EUOB 3OV6A 1YPZA 3O8XD 1NAKH 1T0PB 3ARPA 4OLYH 5EBLB 1U3HC 3VD7A 3NABH 4JRXE 5E4EC 4OCLC 5ISZA 1CDBA 3LZFH 1SMAA 1UM5L 3ZT6A 2LTQB 5D7LD 5C2BH 1QVOA 4K94C 5J11C 1P69B 3RGHA 3WXVH 4OCSH 2DQGH 2VXQH 3BFOA 3KLAB 1CK0H 4JZNB 4BUHA 4R90H 1FH5L 1UENA 3MREB 2BSRA 1CLYH 1BVLA 1J0YA 4N8PA 3NA4A 2H2SD 4KKBD 1A21A 2YMXH 2CO6B 4NQEB 3VFNB 1OOAA 4K7FA 5ALBL 3HI1A 1J7VR 1A4KA 1HKFA 3RNQB 4JFZH 4WGVB 3D2UA 4PRHD 5IBUB 1UA6L 5F7EH 3U0PB 2YR3A 2AJUL 3D3VA 4NQSB 1FVDA 3MV7B 1L9NA 4ENEC 3QHZL 1A7NH 3H8NA 3QUMH 3UROR 1AR1C 3DUHA 1ZAGA 2VXUH 2OTUA 2FIRT 3UTPE 3W5MA 1KACB 1FNLA 1HI6B 2Q6WA 4C56E 1ZSDA 1KN2H 1BWWA 2AP2A 4YJZL 4KHTL 4DVBB 1M6OA 4TUJB 1QBAA 4K7PX 5DUBB 3BE1H 3DARA 2HJLB 5C9JB 4PREA 4CW1B 2E27L 3QNXB 3P3YA 4NT6A 3OKYA 4X9BA 4EJ1C 3QO0A 5GZND 5IESL 1UXWA 4U6TA 4JRYE 1OWRM 4QOKA 4U4BA 2LV4A 4PJ9D 3FT2B 1VESA 4ODXB 4JFDB 4HZLB 1LDSA 2A1WL 5F88B 3RZCD 1F2XK 5L7XH 5EBMB 1FZJB 4UB0L 3HR6A 4APQC 2F58H 2Y9RT 1MFEL 4XVTH 3TVMD 2DQCH 4Z77A 5EPMB 3D18B 2NPLX 2DQDH 2X5PA 3ARSA 4K3JH 3WIHH 1VDGA 3O3EB 3A6CL 3S7GA 3KPQB 1YDPA 3VXMA 2PYED 3QRGH 4M62H 3FQRB 1WT5A 1XF2B 4OZGF 4ZFZA 3WLBB 5C1MB 2BVEA 1F8TH 1Q8MA 3RVUD 2XZCH 4MCZB 5IB4B 3VXRD 1S3KH 2B1AL 1I1FA 2EZ0D 2CLRA 2FD6L 1A6AB 4M7LT 5AD0B 3GZKA 5I75B 2VDRL 4MJ4A 4J3OC 4MQTB 4Y4KC 3OR7B 5SWZA 1NLBH 35C8L 3PNWA 4M1CD 2APVA 1FO0A 4YHKH 1UZ8B 5EOTB 1JYVA 4BJLA 1QFWI 4HG4J 3LEXB 1H0DB 3JTSB 2BVTA 3CH1A 1E4XL 5BO1L 5EZOL 4Z7OF 3MUHL 2ICEB 4HMEA 3Q5TA 4HULB 5TE4L 2B20A 1A3RL 1R3IL 1LO0H 3O2WH 1ONQA 3WFBL 4JQIH 5EU4B 5DRXA 3HZYB 2JJSA 3F7PC 3G04A 3R0MA 2ZWLT 1HSBA 1KCUL 4X6BA 7FABL 1V7MH 2X1XR 5C0BD 2XN9B 3L1OH 3BN3B 1CL7H 1UCBL 4ELME 4LSSL 4LKXA 1ZKAA 5IW3A 1I8KB 4CVZA 4ZS6C 1FBIH 3MLWL 4LEOB 4U1LB 4XNQB 4XMKH 5IKCB 4WY7H 5I1EL 4XWGL 1GC1C 1T83A 1V3MA 4FQIL 4R26H 5DA0B 1KIQA 2J3SA 5KS9F 2MKLC 1CGVA 2JB5H 4DGIH 4YHZL 1G7IB 1T2QL 3P4NB 1NGXA 3D18A 5HPMB 2AXFB 5C08B 2HFGH 3BP4A 5C71A 1RUAH 4D0DA 4W6XB 2BFVL 2Q76B 4MJ5B 3GJEB 4NKIH 3TT1H 4NO5A 2FD6H 2DQJL 3D85B 2AV7B 3MSPA 5IQ9B 3N1FC 3WL9A 3SGEH 5L8KB 5H35A 3RIFK 4X0KB 5EOQH 3EYVB 3BHBB 5JW5A 3T0ED 1T4KA 4LLQA 1R3HA 4G8GD 4JE4B 5E95B 3MODH 4KI1A 3DWTA 3O45B 2CDFA 3CZFB 1P7QA 1OTSD 1UH2A 3MRBA 5FO7A 4DZ8A 4ZYKB 3BKML 1BF8A 2FECI 4OCWH 4N8VB 1EBPA 2AXJA 1YC8A 1KPRA 5C0CA 4UT6L 4U1SB 2YD8A 3BMVA 5E5UB 4QCIA 1RIUH 4RFEA 4MNQA 2RCSL 3WKML 4QHMB 3UCRA 3KWWB 5HHPB 1QR1A 4TQEL 4P57B 2GCYA 4P5TB 4TRPH 4ZMAT 2BVQB 3RDTA 4HKBA 2GAZB 4YE4H 4XH2B 5DEFB 2O26U 4QRPB 3QUZD 4G8EA 2DI9A 4R7DB 4MA1B 3BE1L 3N0PB 3QDJE 1Q9OA 2HT3D 4ZTOL 2AI0L 5IIEA 5M95B 4M3KB 5MP6H 4O00A 5K9OB 1VACA 2PW2A 4NM4H 3BGMB 4MD0A 4OGYH 1BGXL 4RX4A 3IETB 2UUDH 4QHUA 4Y2OA 5C0FA 5D1XA 2G5BB 4JFDE 3CVHA 4KKCC 3S37H 1DBML 1NGYB 2WIIA 4P46C 5GSVA 1CS6A 4PLKC 2ADGB 2WV3A 1IAOA 4QXUL 1YEDA 3RHWK 1MLCA 2LTQC 3S37L 4OZIB 2VR5A 5FDYA 1LD9A 1NAMH 1NCDL 2MNUA 1C7TA 4H20H 2JCCA 1RFDH 4D0BA 1EDQA 4NZDA 5DO2D 2KUTA 1MHPH 4WO4A 3ARBC 2DKMA 3JSSA 1BFOA 4NFCA 1ZA3B 3SKUD 1CFTB 2GKIA 3E2HC 2O5YL 4HJGB 2DM3A 2DQCL 4U6VH 4XC3H 5ESQA 3E6FA 4WUUB 5AYUL 3FN9A 1LWRA 1I9EA 4P99A 3TNNB 3L7FB 2XZZA 2V2TA 2A6KA 3OBAA 1ZHKA 3S96A 4XCEA 4JFXA 4JM2A 3TN0B 1NCBH 5J57B 1J05B 3KHOA 2H2SC 2CGRH 4F2MA 5CAYB 1PYWB 5F89A 1QSEB 1IILE 3G6JF 4KRNA 1N8ZA 2ZP0T 5FKAB 3AAZA 5F1NA 2HWZH 2VZOA 3FB7B 4M7JL 5JIHA 3NCMA 5JHLL 4EDWH 2ZUTA 1JGLH 4PG9B 1JN6B 5DVMA 4WO4B 5FUOL 1IC5H 4TSBH 3FQNB 4KK8C 1CT8A 5EOCH 5C6WH 4NQED 4LMQE 5SX5K 4D9LL 5JW4R 3PWPD 3T08A 4PGDB 4OFKA 4MQ7B 1LO3L 3EAKA 1NSNH 4Q0XH 2QHLA 4P49A 3V6OE 1I3VA 3PV7A 4GKOA 4XX1G 5IHLB 5CEZH 3G6DH 4HXAH 2BRRL 4MAYB 3EO0A 4JJHA 4WUKL 1EX0A 2VQUA 3VGEA 3IDMA 1YJDL 2R2HB 3KXFE 1IQDA 1IM9D 4XNYH 2ICCA 3IGAB 3OB0K 5A3IC 1Q9OB 1QSZA 3MA7A 2P48B 5J1SC 1OL0A 4GG8A 5ACLA 4NQCD 5BCAA 1UH3A 1FL3A 1W72A 3NIFE 2E9IA 2UV3A 2GAZA 4JFYA 1DBJH 4K8RL 4H8WC 2Z4QB 5HHPA 2EZ0C 4LSSH 5D5MA 1LP9F 3PP3H 2Q86A 3MROA 4FNLH 3WS3B 2HJFA 1U91A 1WWBX 3BMWA 1K5NA 3CPLB 2VITB 4HK0A 1A1NB 3GBML 1RUKH 3AREA 5IMMA 2HTKC 5TGBB 2FO1A 4JCMA 4RMTA 5FYLD 1ED3A 5FOBA 4FXGA 3QDGB 1NKOA 5FUOH 4P9MH 2GHWB 3O6KL 3BGAA 4M02A 5I1CL 1QRNE 4QRPA 5JOFB 2X4PB 2CR6A 5IQ7H 5JIIA 5DMKB 3T65A 1LNUA 5D8JL 1U3JA 3C5SA 4NQUA 4LHQB 4U1JA 5IFHL 2FYYA 5DJZB 3S5LB 1BJMA 3TO2B 4JRYD 4Z7UE 1XGTA 5DQ9A 3MX0A 1MREH 4I18A 2C4FT 5JOPE 4ZTPH 4JN1H 4XXCA 4PRDA 4R9HA 3H9YA 1MLCB 5EORL 2Y72A 4G3YH 1BFVL 5E8PA 1KPRB 2GQHA 3PP3K 4JFHE 5TFSL 5DURD 2CKBL 3VWJA 3ZSTA 4GG6F 4X5WA 1YQVH 4RSVA 1HNGA 1BQLH 3CZFA 2Y6SC 25C8H 3RIAF 3RTQC 3UPRB 1J8HB 5HVHB 1NDGB 5BZWB 5AAWA 4Y4HC 1V7NH 2PYEE 4LL9A 4LRNH 5DYOA 4JRYA 4YEFA 1T21A 1N2RA 4LASL 4LSDA 3FB5B 3MBED 4L8CA 3ULVC 2XG5A 4X6DB 1NCDH 1ZA6A 2X89A 3HAEG 3Q5YA 1A9EB 4LSVH 4MCYA 4UDUA 4C4KT 3MLRH 1BQSA 3MXWH 5FYJE 3PIQA 5TQ2L 3EO1B 5DD5H 1OAQL 5KG9B 1T1XB 3A67H 4XMPL 4M00A 2VNCA 5LGHH 1KCVH 2UWEA 2EH7H 3A0OA 1DZBA 4Y16C 4H0GA 3LPFA 4Z78B 2BNQD 3MJ9A 3KR3H 1A47A 4K7PY 5IB3B 3VFRA 3FFCE 3IU4H 5CEZE 5F7UA 4JHAH 5D1ZC 3ZZ1A 4M93B 4P59H 2QSCH 4F37F 1EEZB 3F7VB 3JWOL 3TV3H 2BRRH 3H9ZA 3U4EA 2EE3A 3AMLA 4YHYB 5J4MA 5C92A 3INUH 5BVJB 2DICA 3WKMH 3ZDYE 4BA8A 5C70A 1W0YT 3OX8B 1X5YA 3U9PH 1HINH 5KSAD 3CDCA 3HMXL 3THMH 12E8L 2DQTH 3D0VA 2W9LA 4N0CC 5HPMA 1OAXH 5D9SA 4UTBL 1KIRB 4NYLA 1ZTXL 2NW3A 5SWZB 5C2BL 5DMJB 4I0PC 5JR1H 2ZNWA 4OD1L 1UWGL 2XKNA 1J0IA 4ZUWA 1U8QA 5GIRB 4G6FB 1E6OL 4JO1H 4TVPL 5M94B 2X9YA 3NZHL 3D9AH 1WFOA 1YA5A 1PG7H 2KZ1B 1HQ4B 2NY6D 3VI3F 3QXVA 4ORGA 4JFXB 4JM2B 3TN0A 3K4AA 1MAKA 2HKHH 5TPWH 4HQQL 3PWJB 3HPLA 3IKCA 3L6FB 3G08A 4GAGL 3BPNB 4WU5B 5DS8A 3QIUC 3ZMRA 5BS0E 4XP1L 2GJ6B 1UKTA 4XCNB 4TVPH 4X6CA 3G5VA 2AS5M 3RBGA 5C3LD 5E8DL 4P4RA 4RDQF 1A64A 2B7DT 1CFTA 4U6YB 4OCNC 3EYQD 1N26A 2FGWL 3EJZD 3UDWC 4N8CL 1X5GA 2VDQH 1LNUB 4KVNL 4DVRL 1IGCH 4L8BB 4IMLB 3U46A 1MJ8L 3MJ9L 5IG7B 1DR9A 2CK0L 2R1XB 5L2JA 2L7UA 4I8DA 4WY7L 2W1NA 4QNPE 2ZNXA 4ZSOA 2P7TB 4OZIA 4UTAH 5CLWA 1TTUA 3IS0X 2P5EB 3KNBA 3V6FA 4NQEA 3VFNA 5HYJA 1XGUB 2F9BT 3P11H 3GMNA 2NY7L 1KEGH 5I74C 3FN3A 4M1DL 3UTQB 1G7MA 1IC4H 3VRJA 4BYHA 1KCLA 3WDJA 1TETL 4YO0B 2BHZA 1A7PL 1R3KA 1R0AH 1RI8A 4JHAL 2E7MA 5IV2B 2DF3A 2DTSA 3LQAC 5GGSY 5TF1L 3DVFA 1XR8B 2GJZA 1ZT1B 5FGCB 4QYOA 3OQ3B 3CX5J 5DD1L 5J6HB 5D1QD 1C5BL 4X9HA 4KK9C 1FVCA 1DL7L 4L4VE 4HPYH 3TFKC 2EH7L 1KFAH 1TJHL 5IB1B 1FP5A 4O4YL 4IDJH 4XI5D 3QBTB 1PKOA 2WWMD 3HUJB 3HMXA 1YEDB 1AO7D 3IFNH 4L3EA 3DX6B 3JV6A 3AROA 3IETA 5LVEA 4WO4D 2DQDL 2R0KL 3UZVB 4LASH 5D4QA 3UTOA 4DGVH 3IDIB 1A6ZB 3M17B 4M61A 1FE8L 4JG1L 4GH7B 4E5XA 2JTDA 3MYJB 2A77L 4R2GB 1KXVC 2J6EH 5EN2B 5CD5D 3FN0L 1CI5A 4N90E 1JF6A 1FNFA 1PFCA 2QSVA 3EO1A 3BN9D 5CGYD 6CGTA 4RFEB 4PRHE 3H9SB 5CBEB 3HZVA 1ZS8A 3SPVA 1YEFH 2YA1A 3RWGB 5I8EB 1XGRA 1YZZA 3KYKL 4EOWL 2DWDA 5D72H 4IIQA 3PWPA 1A4JA 1SYSB 3ARVA 5I73C 3TNMB 4XTRC 3VA6A 1ZMYA 1LDPH 1JF5A 3IFOB 4LVHB 4WW2F 5F9JA 3OZ9L 4WNQA 4KROD 3T0EB 1FLRL 4BH7A 3QAZC 5ABDE 3NCJH 2FGZA 3G6AA 5A2JH 3MRBB 1CGTA 3QEUB 4G6MH 5J11B 4HUVB 1P84J 4JFFD 5IW1A 4P48A 1IAIL 3HB3C 2ZCHH 1MI5B 3IFPA 4R4BB 3SEPA 4FABL 4XRCA 1NUGA 3VI3E 4YHML 4HC1L 3EYVA 5J13C 4AIXA 4NIKB 1NH6A 3L95A 4MNGB 1ZLSH 1DE4B 1JHLL 3RHWF 2Y6SD 3HA0A 4F9LA 3SDAD 1WZLA 3MRLB 4YHIB 2APBA 2UVEA 4HLZG 5ICXB 3KPNA 1P7QB 1DLFH 4ZPVB 1CFQA 4L1DA 3TO4C 3MR9B 3VFTA 1MJ8H 3MJ9H 5HYJE 4M9OA 1CXKA 1OLZA 3RJQB 4N8CH 4PGBB 4Y19A 4HKZB 5F7MC 4NNXB 3GSUA 3VFWB 1DLFL 4X6CF 3REWA 4QRPD 3JBG7 4HMCA 2VKWA 4M03A 3VXQA 3B9KB 4WFHD 4ERSH 2ADFL 3V8CA 5J56B 4GW1B 5BMFH 5B22A 1BJ1H 4TSCL 4HD9A 3V5HB 4J23A 3MRHB 5CIPH 4HUUA 5E94B 2VDRH 3UXFA 1KCSH 4Y16B 4L3EE 3N1GC 5ALCL 1MWAA 5HI5D 3U6RA 4QTHB 4Q0XL 4JFYB 4HWBH 3FFDB 1CDJA 1I1CA 1HHIB 2YRLA 1FPTH 3A6CH 1BIIA 3MNVA 4QXGL 1QACA 4L4VA 1FAIL 4TVPD 5T5FL 4OLWH 1C5CL 4PD4J 5FKPB 3ZHDA 3VXPA 4O2FA 4PJ7F 1MJUL 5BS0B 3R1GL 3RWDB 1EEYA 1RAMA 4G8GE 5C07E 2WAHA 5EU7C 4JHWH 4L8DB 4XB8A 4PLJD 1YNLH 4J4PA 5DEGB 4Z9KB 4HS6A 3IJYB 1H15B 1BFSA 3CFBB 5B39B 1F6LL 4RGMB 4Q9QH 3IS1X 2F8VA 5I17B 4FFWD 1U8JA 4GKZB 4AY0A 1N0XH 2LVCA 1AR2A 3NOIA 1QNZL 1T7WA 4NN6C 43C9B 5LWYH 4PREB 2QBWA 4FQQA 3LS5H 2HT4C 1NGZA 4ODTH 2A6DA 1U8HA 2WQ8A 3SOBH 1HHGB 4NZRH 4C59B 4PJAA 3PGCA 1A1MA 3ROLA 2CKBB 3ZSSA 2IAND 2UYLA 4ZFOA 2BC4B 4OZIE 1QSFB 4ZSOE 2FIKB 3MRGA 4BSWA 3RQ3A 4QXWA 5CUSH 4F7EB 3V8OA 1IT9H 4QHNA 2QV2A 4QY8B 3ILPA 4X4ZA 3RY6C 2KZWA 2NY6C 1VGKB 4DKDC 1IGTA 3KVQA 4HV8B 3RL1B 4MD5A 5D7IB 3ISWA 5LGHL 4F2MB 4XVSL 3ARFA 1K9TA 1FNGA 2FX7L 1QFOA 2IBZX 4NRZA 1T20B 2CXGA 2QQKH 5JO5B 4ONOA 5CGTA 2BNQE 4Z7VA 1OAUL 4I4WA 2ZKHH 4YNYB 4YIQB 1PQZB 4UIMA 4F57L 2R9HD 1KTLB 3DX8B 2HH0H 2BSTA 3RGVB 1T89C 3MBEB 4XZUB 2ZUQC 4ACPA 5MHSD 3GEWB 3MRLA 2H3NA 2E6JA 3C8KB 4LGRB 2OTUB 2VXQL 3T0WA 4PJGB 4QEGA 2JCCB 1I85A 2XWBA 5T1KB 2D0GA 5T3XE 2FNBA 3PXHA 1YNTA 4NKMB 4B7LA 4R0LA 1N5YL 1KV3A 4XVJH 5HVWA 4NDMB 2Y23A 4X7TA 2VLRB 1FIGL 5ID0B 5IGXL 2VISB 5CINH 1G6VK 1DEDA 1AHWC 4N0FB 4RMWA 1S78D 4KI5F 4HIEB 4EI5D 2P8PA 3QDMA 2G2RB 2CLRB 3WIIH 1SJXA 2A83A 1WCQA 2R69L 4KRLB 3W9DB 2CO7B 1CTNA 3GSNH 4JEGB 1J5OH 3FQWA 1NUNB 4JRWA 3QXTA 5D7SL 1X5AA 4DVRH 2Y36L 2F19H 5FHBL 4H25B 3GSUB 3RA7H 3VFWA 5FO9B 4BZ1L 2XFXA 3SDXB 1FVEA 4ZFOL 3GKZA 4RMVA 2AJSH 1DVFA 4DUWA 1ACZA 4DN4H 1CFNA 2Z8SA 4DAGL 1EO8L 4HWBL 4QRUB 3VFGL 2BVYA 1GOFA 3GBMH 4XI5C 4YZFF 2QQNH 1XT5A 3FAWA 3HE6A 5EC1A 4YWGL 5AG9A 1QHPA 1EFQA 1QRNB 2XPGA 5FCUL 5I9QC 2X4SA 3ES6B 3QWOB 2EO9A 3B9EA 4LVEA 4OIIH 1MRCH 4YBQD 5FXCH 5L9DL 1F45A 5E2UH 1M7IB 1IGJB 1IQWH 1U8PB 3GGWA 4OF5A 5ISZD 1T2QH 3QJFA 1KGCD 2X6MA 4HMDA 5IVNA 4YUEL 3WLWC 2BHYA 1G0XA 3U1SH 1A7QL 1OAXL 3BDXA 4K3EH 4XPBL 4B0MM 3WNPA 4R2GD 3TPKA 1QYGL 4OSUH 2YKLL 4GAJH 1MAMH 4F7TA 2DQHH 3QA3B 1FN4A 4CU7A 4U6HB 1MCCA 5SX5H 5TDOA 1VPOL 1CL7L 5FAAA 4HV8A 2R29L 4G6KL 4OZGB 4Y5XB 4RA0C 7FABH 3KXFA 5DQJB 1FYTE 3CZJA 3MLTA 4G8GB 1YEGL 2B5IC 2FBJH 3BO8A 5DSCB 2UZIH 3BDBA 3UJIH 2VDOH 2FB4L 1MQKL 1OSPL 1YNKH 2D31A 4YR6A 4HS8L 5GZOC 4U49A 3GSRA 1TIUA 2D7TL 3OHXA 3SDDB 1BVLB 3UTSB 4L4VD 2G9HA 4ODBD 5ENWB 3GSWB 4XNUL 3B83A 1FC2D 4H25A 1I7TA 3HC3H 1RV6X 1F90H 3MV7E 1T83C 4LLUB 4XCYB 4XP6L 1U58A 3TA3B 2BNUB 3WO3B 1QRND 2PYFA 1VGEL 1OGTB 1T0MA 4ODHH 1S9XB 4KROC 4NQDA 5HDOA 4IJ3C 3A67L 1LE5A 4Q74A 4WWKA 4G7VH 5EUOA 4XXDB 1RZFH 1EAJA 4XPFH 4ZAKB 3ZTJH 3SGJA 4PJBA 2J6EL 3SE8L 1LO4L 2R4SL 1D3CA 3SE3A 3A6BL 3IB4A 1WBXA 1HDMB 1T3FB 1U8MB 1JPTL 1E4WL 3SDCA 1WFTA 1BJ8A 3L3DA 4L4TD 5CJXC 1B2WL 3TO4D 3CUPB 1DQJB 5EIVA 3OKKB 4UINL 1IFHL 2FZ3A 4XNZB 2YD5A 3U30C 5BRZD 1R3KB 2ED7A 1KT2B 2YXFA 2CIIB 4ONHA 5D2NC 3LIZH 3VI4F 4ODSL 5C0EA 5GRXG 3S34L 5JO5A 2EYSB 4WHTB 4KDTC 4PJDF 3FMGL 3ZL4L 4JN1L 5GS1C 4G80B 1FFNA 4RNRB 1OP3H 2GUOA 2ZCLH 2EDQA 3D39E 4HIXL 4IRSB 4PRID 5T1KD 5IFHH 4DW2H 4O5LH 5J3HC 2X4OA 3LS4L 3PGCB 1YEKL 1FG2B 3DV6A 1RIHH 2NX5E 4LRIA 3CAFA 1VENA 1I1YA 4KTDH 1CXFA 5JMOC 5TH2B 1T0NB 3VA2C 1YY9C 1WTGT 3ARYA 1MCWW 5J89A 1G1YA 2DTML 5E1AA 2FBJL 3CX2A 3NBNA 4ZOAA 2EE2A 4P2CG 3V6ZB 4RZCA 4MSWB 2QR0A 5GJTL 3N50A 2H2PC 4JFQB 3RVWD 4RIRA 3G08B 1S9KC 4NQDB 5DUML 1YY8B 5IROC 5C0AB 2W59A 4PJ9A 3BKCL 1I3UA 1XIWD 4QOKD 3KS0H 5C8JA 3GSOB 5C09E 3PV6A 1BEYL 4WHTA 3W82A 4RZCB 3RVVD 4X5XA 2IANA 2YUZA 1UQSB 5B3NA 2CK0H 4DUVA 3LHPH 4KZEL 4WU7B 4KVNH 1JYWA 4XPBH 3BKMH 1GC1H 4O51A 2XTJC 5TDNA 3D69B 4JFFB 1U95A 4HK3N 5DD0H 4DKAA 5SWQB 4YFLI 4Y19B 1XZ0A 2ADJB 3BAEH 5FIEA 5DQJA 2WUCL 3MV9A 4UV4H 1WQVT 1D9KD 3AS2A 2FWOA 1OPGH 4HXAL 1X44A 3TGXA 1Y6MR 1J0JA 3AGVA 3SDXE 3CVIL 1CFVL 2VXSH 1T2XA 1RJCA 1OQOA 2AEWA 1M71B 3TT1L 3IFLH 3I6LD 1TQCC 2H32B 4PJIB 1C08A 4NKDB 2JB6B 5T3XL 4HKZA 4Z18A 4OAWA 3O4OC 3V5HA 2WUCH 3K2UH 5BZWA 3LKPA 4OZ4B 1FYTD 2WIMA 1OGTA 1RVFH 2D2OA 3GFUA 3DGGA 4P9HC 1DQQB 3LH2H 5DFWH 2H6PA 5LXGL 5JUEL 2VERN 3X11A 4LSUL 3W39B 5I1EH 3THML 3RX7A 3FRUB 3LN4A 1BIIB 4W4OA 3UTSA 2XN9D 1HK6A 4PRDB 4ZO8A 3IRZA 5FGCE 2EDBA 1IKNA 2VH5H 4Y5VC 3BZFB 2YPVL 5DVKA 4Y0GA 1I1AC 2V2XB 4TTGA 5C0CE 4R96B 4YFDB 3N1PC 1NL0H 1F3JA 2OXHA 5GGTL 3T0DA 4NN5C 4NC1C 4EI5C 4U0RB 3SDYH 5EZIL 1SY6A 3B9KD 1P53A 3KGRA 3MJ8B 4NJAL 3RZWA 3B5TA 1IKFL 1VA9A 2YHGA 2VZ1A 2Y5EA 4MAUH 3REWB 4Z7WF 1P5VA 3MYJA 3SKMA 1PJ9A 1D7FA 2IQAB 3AS1A 3L3IB 4NM8H 2P4AB 3FOLA 4PR5A 4ZUVB 3VGAC 3F12A 35C8H 5B4MD 2Z31D 3LN9A 4Q7DA 1SEBA 3ARZA 3HE7C 4LIQH 4IS6A 1MFCL 5JW3H 3QDJB 3FMGH 2QTEA 1GPOH 5DEZA 3QUYC 1I7RB 3WHE1 5ADPL 2ZZUT 3L5WB 5JNYA 1GZPB 4HWEH 1OB1B 2Q7YA 4F15C 5IHZA 3ES6A 3BXNA 4J12A 2J8OA 1FL6A 5DRZA 3T77B 1ROWA 2W0KA 1CG9A 1D5ZA 3SKNA 3L9RA 3NH7L 5HBBA 2CDEB 4S1SH 2K7PA 1OP3K 4QXTB 4UV7L 3C08L 2QEJA 3L3OA 1EK3A 3LD8C 5LAXB 1YEIL 5E2TH 4RDQG 5DJYA 3DX7B 4JFOB 1XGYL 3LMJL 4JDVA 4B41A 2MTPA 4UNVA 2ZUXA 2OMNA 2CJUL 4MJID 4XPFL 1NC2B 4L8SB 4GXVL 5I2IB 3FOMA 1HYSD 3I50H 3IDNA 4PYHA 3HZVB 3GB7B 4LNRB 1W0WB 3EBAA 1FZOB 4BUGA 3GMNB 3MRIB 4UT6H 5EO0A 1XGYH 2H1PL 2E27H 2J7LA 2ZOLB 5EIIB 5F7YC 3QULB 3O6FA 5E2TL 2JJVA 3BQUA 4WTZG 3NIDE 5EA0L 2C1OA 1IGIH 4YO0A 3RPKA 5I18L 4GKNA 4TULL 1W0WA 3VFSA 1MCOL 3EJZC 3D39B 3PABA 3L5HA 2OK0H 2NYYD 1TZIB 1XIWB 1FPTL 2HLAA 3K74B 4E42B 3GMOA 3RVUC 2HVJB 3QUML 3IFNL 4Y5VB 5EWIH 2FHBA 4P4KD 2NX5B 3RTQB 1I8IB 3KPLB 3QIBC 3STLB 4P2YA 1ZGLM 3VGHA 1ORQB 1BD2E 5I1KH 1FORH 5IK3B 4P3DB 2JCCF 5BW7C 2IJ0C 3ZKXB 1UB6A 1F4YH 4PJXE 1IL1B 1KTKE 4OSUL 5GS1A 2NW2B 3N85L 4H88H 1RHHB 1MNUH 3AS3A 1DJSA 3D3VE 4KJPD 1CLOH 5K93A 1FNSH 1G7HA 3B9DA 5DD0L 4R90L 4JDTH 3CLEH 2CDGA 4X4ME 1I7ZA 1YUHA 1Y6KR 4IMLA 3U46B 3GIZL 2B4CH 3X3GL 3AFLA 4Y1AD 5KAQF 2ZUQB 3UYRL 4KQ4H 1CLZL 5I1LB 2P42B 2HAZA 4Q2ZA 5GS2H 5DJ8A 4LCCB 5F6HI 2EEBA 4WHYG 5JOEA 3O8XB 4M1DH 3WIFA 3C6SA 4HUUB 5DJ6B 4LDEB 4F7PB 4PRPB 1IRAY 4XX1E 4YWGH 4GSDL 3OPZL 4HHAB 3CD4A 4RAUA 4KGJA 3B9KA 3DIFB 4AQ1B 1YPZE 1LO0L 3OXSA 1BOGA 1XCTB 2N7BA 2DYPD 1CGSH 3T09A 3I6KA 4HIJB 1HNFA 5E5MA 4JB9L 5GRZA 1QKZH 2AJYL 3ILPB 2F74A 4WGWB 5GGQH 5CBAA 3W5NA 1JHKH 4WO4C 2PO6A 5FUCE 1RUPH 3G5YB 3L3KB 1Z0MA 3C60C 3SCMA 4JJ5B 3QIWA 1C5DB 2SEBA 4Y88A 4MNGE 3H0TB 5CLTA 3G5VB 1N59B 2NLJB 4PUBH 4EI6A 1B6DA 1SJVA 3MRMA 5CZVH 2B1AH 4PJCA 3S3PA 3S34H 1JTPA 1BZ9B 1CFVH 3L6FA 1Q9KA 4ODSH 1IAKA 2ADGA 4EUPB 3IJSB 2FYYB 1NJ9B 5DJZA 4AIZA 1VADB 1FCGA 3VD4A 3T0EE 5FEBA 4JZJC 4JR9H 5I73B 4NUJA 2F8XC 5CIPB 4YK4B 4U1MB 2CKNA 2X10A 3ULUC 3EFDL 1T4KB 4U3XA 5IB5B 1GL4B 4OCRH 4PTUB 4WI5A 3TBSA 1OCWH 2EDKA 5SV4A 3QAZB 4XTRD 2DYPA 5JZ7C 4JRYB 3BSZH 1I9JL 4PGBA 1G9NH 5D5MF 1XF4B 2EDOA 4FZEH 5HGHA 1U8NB 4K7PL 1L0QA 5KS9A 1J8HA 5DT1L 4HUKB 4QXUH 4NC2B 4UQ3A 4JRXA 2EO1A 3FAXA 1IEAB 3QZWA 3QHTC 3QCVH 4KTEL 3T0BA 2YEZA 4C4KO 2YXMA 1TJHH 4MJIE 4PBWD 1T03H 5CJQH 3I2CH 4MA1C 5DYOB 2EKSB 1DL7H 2BZDA 1A7RH 4Z7VE 4NNYB 2X1OA 5E8NA 4FRWA 2V5MA 4POUB 3O2VH 3N9GL 3CSBA 4ONGL 4LSRH 4M7LH 5E00A 1TJGH 1KN2L 1PW3A 4TVPE 2LU7A 5GGTA 3TH3T 4ZQKB 1CWVA 4WNQB 3T0EA 3WJLC 1UJ3A 4I48A 5I15H 3VGBA 4NZRL 3WHXB 1DBAL 4P46D 4KJQD 4ZNCD 4HIIA 3L5XH 5HVFB 3SE3C 3P4LA 2GTZB 1HZHH 3NGBC 5C09D 1KEMH 3K8KA 1NLDH 3BKYL 5DD5L 4DGYL 5MEOB 3TO2A 4EN3C 4ZNEA 4MNGA 3MRQA 4JFEA 5AWNL 2D0HA 4NO2A 5D6CB 1U0QA 2AJZA 2F53E 3QDME 2YKLH 4GAJL 5F6IB 3VGAB 4M4PA 2XV6B 5BRZB 1HH9B 5K59E 1AHWA 5FB8B 2CRYA 2Y06L 4LCIH 3OAUL 1A7QH 3BW9A 4E41A 1HSAA 3QH3A 3QNZB 1E27A 5T5FH 1RJZB 4JHBA 3O0RL 5IMMB 4I3SL 3ZYOA 5L2KE 1CU4L 4FFYH 5EO0B 5EO1B 2IADA 5E8DH 2GT9B 4JO3L 1NDGA 2YD1A 4U1HA 3H3PL 4BFIB 5F3BA 4NP4L 4DEPB 4HUMB 4CVUA 5IKCA 4OF8A 1PYWA 4Q9CA 4IIQB 4MWFB 4P3WA 3OWEA 1K8IA 3O2DH 1ZHKB 4Q2ZB 3SDCD 1LGVA 2HFTA 4DWHA 1QEWA 5HGAB 4ODHL 3VFMB 4DAGH 2EYTB 1F4XL 3OKDA 4OKVB 4DN4L 3OKEA 3VWKC 5GGRY 4NP4H 5HTSA 4EBQH 5AZEL 1F97A 4X4MA 2VABB 3F5WA 1DANU 1IC1A 3QULA 2V9RA 3O3AA 4W6YB 4P2RD 1KBGH 2ATKA 3OAYK 1TZIA 4UTBH 3RY6A 1IL1A 5IB2B 4QHLB 5GRJL 1U3ZA 6FABH 3CH1B 3JTSA 1BBDL 5I71C 2FB4H 1L7IH 3HPLB 3IKCB 4WU5A 3PDOB 1TCMA 5EOTA 5FUZH 4Y5XC 4YC2C 1MHHB 3KPRB 3JV6B 1WZ1L 3BIAX 5MENE 3EO0B 1D5MA 5EC2A 1WT5C 2DLTA 1IAIH 1ORQA 3M1BA 5I1IH 4EXPX 4N0RA 1RU9H 3RZCB 4UT9L 3K8LA 5IWLA 3UBXI 1TJIH 1RMFH 2V6HA 2OR9L 2VLMD 4UMGA 3GSNB 1JWSA 3HPJB 3W2DL 1FCCA 4JZJB 4FA8A 1WWCA 4TN9A 2VZTA 4G8GA 4JVPA 2WLZA 3MLTB 4RGOL 1CLOL 3ARRA 1FZMB 3VRIB 3BH9B 3MLZH 3VXTB 4DTGH 4XH2A 4MDIA 2GITA 5IOPB 5IFJA 3C60A 4WUKH 4PP2B 2VC2L 1TCRB 4P57A 1SMOA 4YGVB 5IFAH 3VD3A 3PGDB 3LEVL 3T77A 1IBGH 4QCIB 3ULSB 4M93C 5MEQA 4KV5E 5H94B 5GZOD 1D5MB 2H8PB 5IM7B 2AK4D 5A40E 5ADOL 2B2XH 4ESKA 1IM9B 1CDHA 1OGAB 5ANMB 4OZHA 5CHNB 4GRWB 2R56L 1JZ6A 1VB9A 2WBWB 3OJVC 1H8NA 4WEMB 3DECA 4QNPF 4M48L 3IJHB 2XQYG 1RIVL 4R4FH 5I1HH 4IM8A 4M6OL 5D1ZB 2BSSB 4MD0B 1KJVA 1RJZA 1T89A 4ODTL 4WWID 4OCXL 5DZOA 4HZAA 4GAYB 1QBMH 2BXYA 3C9NA 4G43B 1G9MH 2ERJC 1RZKL 3I50L 2IPUK 3IDXL 5A2KH 4HF5L 1ZLWH 4LCCC 1WWAX 5L0QC 3I02A 5HGHB 4LLYB 3OKLA 5B21A 1QRKA 4WCYH 2V5RA 5T5NG 5LBSH 4BKLA 1L6ZA 2DQIH 3EOYG 4PTUA 4U1HB 4OCYL 3DYMA 2Z92B 3QDMD 2DMBA 3UDWA 3DJ9A 4OLWL 2HRPH 2Q3ZA 3T4AB 3UPRA 3C8HA 3DHMA 5GGQL 5IF0A 1MSPA 1CGYA 1WGOA 3PWUA 4NHUB 1O5DT 5C08D 5K9OA 1OAZH 2DL9A 1PG7X 3MCLL 2FJGA 5HY9B 4JRXB 5E00B 5L2KD 3CFDA 4UIKL 4GLRI 4GQPH 5FYKD 5KSBF 3CSGA 3GBNH 5ALCH 3EOBB 3REVB 3V6ZA 1URLA 4UILH 3NZ8B 1MCPH 1GPOL 4UOW0 2OX5A 5HDQL 3TCLA 1NJ9A 3DTXA 4AIZB 3U7YH 2YEZB 2N1KA 2VZUA 5GSVB 1JPFA 2G75A 3D85A 2DJUA 1R3JA 4OB5H 3MA9L 3SJVA 2FEEL 1CK0L 2VLLA 1KPVB 4FQXC 3QIWC 5D1ZD 2B4CL 1Q72H 2V9QA 1MFAH 1UJ3B 4FQHA 5CGMA 2BOBA 5E08H 2AI0H 5T3ZL 4PJHF 1B3JA 3L3JA 4DFHA 2PYEB 1EMTH 2Z92A 4YXKL 3OKMA 4P23D 2EDLA 4RCAA 3UYPA 3MV9E 1UWEL 2A9ML 4CVZB 4D3CL 2QADC 3O3UN 1SVZA 4G6ML 5I6XB 4RMRA 1FL3B 1W72B 1E4KC 4H26A 3U4BL 4UDUB 2B4CC 1JWMB 2IMMA 5FUCC 3VD5A 3DX9A 3MLXL 4L3CB 4LAQL 1XCTA 4X5XB 3ULVL 2CSPA 1IC5L 1T21B 1JV5B 3WNMA 1FAIH 5SV3A 5CJOH 3MLXH 1UB5B 3FL7A 4MS8D 1A0QL 4EOWH 2Q8AH 2FSEA 3QUXB 2LU4A 1OT1A 3CFJA 3VCLA 2R0WL 5H2BB 4RWHA 4KVCH 3OXSB 1I8IA 3ESUF 3NCEB 3STLA 3WJJC 1FFNB 5FYKL 4MQ7A 1FNEA 5DXWA 5ID1B 1SJEA 5HI3C 5FKPA 4NQEE 3VG9B 4M6NL 5HGGS 5JHDA 4DZBB 4B5EA 3R8BB 4M6OH 1M05A 1ZSDB 5F44A 4TNWK 3CFEA 1HOCA 5E99L 3C08H 4Z7QE 2AK4E 3W0WE 2ZPKL 1IE5A 1S5IH 2NTSP 3STZB 1Q72L 1QA9B 1AXSB 3LDBC 4BSJA 2AJ3A 1BVZA 4F80A 2V2WA 1G6RL 5C0RL 3BZEA 4LQ1A 3O6LL 2VRAA 3NA9L 4KZDL 1I1AD 4OGAD 5ANME 5I2IA 5J13B 3GMQA 5E1HB 1S9YB 1NMCC 2EIBA 4OLXL 3IDGB 3WDIA 3UZEA 1PSKL 4RAUB 4XXCC 1N6QL 1CE1L 4RGNE 1GGBH 4LNRA 3RZCA 4FQLL 1OW0C 1BREA 1ADQA 4PJFE 4NQCE 1DBMH 4YX2L 3M1BB 1F4WH 3LPWA 3QUKB 4NSKA 3JTTA 2ICES 1UM6H 4QTIL 2CRIA 2EC8A 2X4TB 1PKQB 3TN0C 1QLRA 2N7AA 5KSAC 3L9RB 2D9QB 3I3DA 5JIKA 3AU1A 5DUBA 5I8KL 4G6JL 2DLEA 1M7DA 1WEJH 4KDVA 2APXA 2W0LA 3L3OB 5EBLA 3GSWA 1JWUA 4WV1B 4AT6A 2R1YA 3OR6B 4I0PA 1T7ZA 4X7SH 4GRWE 1NLBL 2XY1A 3VMOA 1WBYA 4PY7B 4ZO9A 4OLZH 2GIYA 1J88A 3OR7A 3FT2A 1Q38A 4G7YH 4OQTA 3MV7A 2QHRL 4ZUUA 2GTWA 3FN0H 5DTFA 1M4KA 3V52L 2J8UF 3B9AA 3VDAA 3S35L 4JG1H 2YPLD 3BKJH 4LLVA 3O3DA 5DK2A 1ZXQA 1E4WH 1ZHLA 2DS4A 2E6PA 2R56H 4R7DA 2E7HA 1UT9A 4YDIH 1JN6A 2C3VA 3STBA 1VSCA 1A7OL 4U33A 2OM5A 2P46B 3WFHA 5JXEA 1TVHB 3VXSA 3ARUA 5CGYC 2BHUA 4MA8L 1UEYA 5AZ2L 4QRPE 3IFLL 4YXLH 1AQKL 5CD5C 5EUKA 5KSVB 1EH9A 1A8JH 4IDJL 4N0YH 4FNLL 3KPOB 1YN6B 4NOFA 3RNQA 2R1YB 3OR6A 4P2RE 3V5KA 5DC4B 5FO9A 1JNLL 1I3GH 1P5UA 3AM8A 2P1YA 1EXUB 1I9IH 4BSVB 2BY1A 1QSVA 4GRLB 2IAMA 4RFOH 3UTZA 4TNWF 2D4FA 3QUXC 5CEXB 1NCTA 3MBXL 1PKQA 4CDGC 3GKWH 2QKIA 1CVSC 3L3IA 1Z6JT 3DX8A 4MNHB 1YNKL 4JY6A 3QIBD 5AYQA 3R0NA 4HGKC 3NFPA 4LF3A 4ZQKA 2Y4SA 3MLWH 4XMKL 3ZE2E 1JK8A 4C58B 2VE6A 2DJSA 3WL9B 1IC4L 5HHOA 4D0BB 1RJYA 3P9LB 1MCSA 3RUGF 4G9FA 2HLFC 3G6JA 3LSOA 3T0AA 4CNIA 3FQXA 1VHPA 3FRUA 3MRCA 3MV8A 5CKGA 2BVQA 3RDTB 3CFIC 3J7HA 4U1GB 3H9SE 1G0YR 1YPZF 3WNKA 1C16A 1A6PA 1JHTA 4LLWA 1IGCL 3MREA 4KTDL 3O9WA 4WEBL 5J1AA 2O61B 4UIMB 3PF2A 3QG6A 2AEQH 5KAQG 4U1LA 4XNQA 4N68A 5B8CC 1OWWA 4HWBA 4JFFA 4O5LL 5HD8C 2IGFH 1QLEH 1WIUA 2VDPH 5GPRA 4LARL 4KI5D 5HI5C 1OTUC 1P6AB 3QCVL 4KQ3L 3MOQA 5B39A 1G6RB 2XXMB 4HH9B 4JVWA 1AQKH 1NCUA 3MJ6A 5KTEH 5DJXA 2X4RB 5D2LA 3RNKA 4GMSH 4OFIA 3DO7B 1RK0A 1YEJL 3MUY1 5D1XC 2X41A 1E6OH 4CVXA 1T0NA 2XIDA 4EI6B 2AJVH 3WS6C 3V95A 2NLJA 3JWOC 1OD7A 4M7ZB 4FXKA 2VWEC 5IJVB 4KH2A 3MRDB 3WFDL 2AV1B 1ZTXH 1KF9B 1M7DB 2A74A 4PB0L 3CCHA 1Z3GH 3OAZK 1MIEL 4GS7C 4I9WD 1KB9J 4JR9L 4NO0D 4PJFA 4LRIC 3A6BH 3HN3A 2PR4H 4HAFA 3NGBB 4Y16A 4S1RH 4Z7UF 4KGLA 3W0WB 1J1OL 2R2CA 5DFVD 3INUL 1F6AB 2JJTC 1D5IL 5GRVK 3JWOH 5GJSH 4B53A 1VFBA 4PRPA 3QXAB 1QSFA 4XP6H 3W0WA 3F58H 4APQB 3BZ4A 4ONHB 3BWUC 3JUZA 3QQ4B 1AO7A 4DOHB 5DWUL 4AEFA 5K9QI 4HGWB 1HHGA 3HE6C 3WO4C 3OX8A 4KKAD 1VFBB 3QIUB 5I1LA 5T1DL 3RKPA 1A7RL 4AMKH 4JFDA 2EYSA 1U8OA 4GG6B 3QWQB 2EXYC 3DTXB 1BJ1J 3I2CL 2RGSA 5F9OL 1U92A 2D03L 4YE4L 2KDGA 4FQLH 5EOCJ 5F6HJ 3VWJC 3B3IA 1YMMA 5DD3L 1YN7A 5IHUH 3QDGD 4RISL 4JPVL 5DR5H 4PJBB 4OLUL 2UUDK 3PP4L 4MX7A 4WENB 4LSVL 5C07A 2X4NB 2P5WB 1A14L 3MJGX 3KPSA 5SWSE 5D7JA 4DCQA 1A2YB 1WBXB 5FYLH 3QO1B 3T3PF 1RK1B 3ARGD 3L95B 2X42A 2J4WL 1NBZA 1QFUH 3VFSB 4CUCA 3O9WB 4AYFA 3ILQD 4AM0A 5DMIH 4OLVL 5E2UL 2CUMA 4PTTB 4N5EC 4O58L 4TTDD 5GISL 5EUKB 5KSVA 5IEKB 4OIIL 5F3HA 1FN4B 4XCCL 3LCYA 1AKJD 3PQYA 5I1JH 5JORA 1XR9A 5GRVL 4OQ1A 2GW5A 4HK3J 2A6JA 5MENB 2E7LA 4AEIL 1WVZA 3L3JB 4RAHA 2AJSL 1MUJA 1E0OB 5ICXA 1C5CH 3OAYH 1SYVA 3ARFC 5I71B 3DMMA 3S5LG 4JY6B 1T22B 4NNPH 5EPMA 5EG6C 3RWGA 5AZEH 4KRPC 4WHCA 4JPIA 2RFXB 1GIGL 4OM0L 4GFTB 1U8MA 4Y5YA 4LMQI 3HKFA 1HI6A 3GNML 4U2YA 4M4RA 2Z31B 3OPZH 5C0JB 5FECA 5DQ9B 5IVXB 4F7TB 4AIOA 3QEGL 5D2LB 3RNKB 3ZT7A 2H9GA 1V7ML 3RWEB 2DIAA 3RWCA 3P0YL 2FX9H 3DVIA 1ZOXA 3UJTH 3FO0H 2AABL 4OI8A 4RQQA 1J9CT 1I9RL 3EYUL 3RY4A 3FQTA 4KQ4L 4FFYL 1ITBB 4I3SH 3LVEA 3D25B 2VDKL 5D7KD 5ILTL 1IGJA 5CMAB 3S3SA 1AGBA 4YHOL 4JDTL 4OB5L 2LU3A 2R8SH 1KTDA 4M61B 1OAYH 3N1QC 1T5WA 2C3XA 4YHKL 3VH8G 2Q86B 5CFHA 2FJFA 2VLJD 2CMRL 1RUML 4YX2H 1QR4A 5AWNH 4OCMC 3G6DL 3QZWG 5CEZL 4NZTL 3MRPB 1MFCH 3MRRB 3NACL 3GUTA 4Q9RL 5EB9A 5MEPB 4L4JA 1FO0L 3W11D 5FV1L 1KCRH 3KAAA 4KK5C 4NM8L 5DFTA 1KYOK 1B6UA 3O41A 2OZ4A 5C0JA 2EXWC 1ND0B 3EGSB 2BVOB 3HNTL 4NM4L 2X05A 2DBJA 1A6TA 4WW2C 1K4CA 5B8CB 3CK0H 3KLAA 2PTUA 1MCNA 2EDDA 5EA0H 4UNTA 3ZDZE 4KMQA 1NCAH 2IFFL 4OZHB 4F8QA 5I8CB 1TITA 2EH8H 1T20A 1DFBH 4OGXH 2BSTB 2NY3C 3U36A 4I0CC 4YEEA 1JWUB 4WV1A 4AT6B 1U8IA 1RZ8B 4LFHG 4PG2A 2JE8A 2Z35B 5DT1H 5HGBB 2R0WH 2V2WB 4L8BA 5HYEA 4ELMF 4OJFH 3LN5A 1B90A 3GHBL 3QG7L 3HS0A 4H5SB 3VWKD 4QOKE 4HGWA 1IGTB 5JW4M 5IVOA 4U6VL 4OCRL 2ZG3A 1H5BC 2APWA 2LVEA 1NANI 2BVPA 2H45A 4LHUG 2VLJB 2B2XL 2OL3L 1O7VA 5DHYA 1DSFL 3MC0A 3SKOA 4NZJA 2BJMH 3WBDA 4GMSL 4QLRA 4MD4B 3SO5A 1W72L 5BOZG 3TIDA 2HKFH 5I19L 1AGCA 3VFVA 4QY8A 3CJJA 3C6LA 1KFAL 4KQ3H 3CFJB 3P77B 4D9QD 1RUAL 4Y4KA 3KPMB 3KPSE 4H8WL 5SWSA 1IMHC 4K8RC 2EE6A 2XNAA 2YS4A 5D1QB 3KLHD 4NKOB 2D4DA 2F53A 4LCYB 5EZJA 1A22B 1HCVA 3ARED 2Z0BA 1AQDB 5ICZB 3ZDXE 3CFKB 4F7CB 4WEBH 3S35X 4X6CE 2OJEA 4EI5B 5DVNA 4MLSA 1IKFH 1W2KT 1A7PH 1N3NB 2FCBA 1TETH 4NJAH 2K9UA 1JNHB 3GBLA 3HUJE 4WW1B 4PS4L 3WNOA 3PWLB 5J9PA 2ICWI 4CJ0A 3MACL 4N8VG 4NWUL 4Y4KD 4NO3A 3U2SA 4CN4A 4J6RH 4M1CC 3GBNL 1EJOL 4PGCA 2EDFA 3QUZA 1WICA 4FQXB 4MJIA 1NUDA 1OAZL 5D9SB 4PRPE 1J8KA 1X5IA 3P2TA 1ZLVK 3O6ML 3TJEL 4KKAC 4PJDA 4Y4FD 5JUEH 5DJ0A 2HRLA 1UKSA 3VRLF 4FFZH 2ID5A 1VKXB 4ZFGL 3E3QE 4JG0L 4NO0B 3MOBL 1R5VB 2WBKA 4OZFA 2CLZB 4X7CC 5DEFA 2C3GA 4PJHE 4F3FB 3EJJX 2FIKA 3MRGB 4BSWB 5FM4A 3NN8B 1W0VB 3CVHL 3BIBX 1Q0YH 2ENYA 4C56A 4BH8B 3BGFB 5E2WH 3LKSB 3Q3GA 4F9LC 4JM4H 1NGQH 2IBGA 4PV9B 1AI1H 1DQMH 3FB5A 4OIBA 4J7RA 4PRNB 3HB3D 4L8CB 1WK0A 3TESA 3SQOH 2DB8A 43CAB 3L7EB 5AZ2H 4IRJD 3T65B 3DRTA 1MFBL 2AKRB 2XTJB 3VCLB 1REIA 2I9LA 4C83A 1KLGB 3HR5A 1V3LA 4UZGA 5GGRB 1BLNA 3WHXA 4DK6A 2QL1A 3CC5A 5D2LE 1MHEA 3B9VA 3QEHB 3QNYB 1OW0A 1TVBB 2HN7A 1VFAA 3BHBA 3DOSA 3VFRB 3IFOA 1MIML 4WI7A 1A1NA 1OSZA 1EZVY 4OJFL 3X12B 3EOBA 5DJCA 5DJ6A 5I6XC 4N1EA 1FAKT 4PJEA 2IAMD 4Y2DC 1S8DB 1JMXA 3GK8L 3VWJB 1SJHB 3MV11 1TVHA 1P7KA 1U3HA 5KVFH 1ZS8B 2OR7A 3SPVB 3ZKNC 1V8HA 4RMQA 3MRHA 4GOSA 1A7BA 5H37G 4TPRH 4HFWB 2NXYD 4X6DA 1JFQL 3CK0L 3HPJA 4I18B 1GCFA 3C2SA 4MJIB 4IRJA 3MV8E 1N2RB 3RVVC 3E2HB 1ADQH 4L9DA 1TDQA 4P2RB 1QQDB 2APFA 3VJ6B 5DRWA 1K5NB 1CN4A 1GGCH 4JREC 5I1DB 3A6OA 1MJ7L 2V7NA 5ESAA 1PD6A 2PUQT 1LP9E 4Y89A 3HZKA 4HJ0D 1UVQB 5CHNA 2Z4QA 3GJFH 4LSTH 1K85A 1F58L 1WFUA 1KEGL 4YGVA 1HH6B 3QFJE 2IF7A 4HH8A 2GFBB 5SWSD 2WWKO 2DLFL 4LCWB 4I0PB 1N6UA 2X4PA 4FZEL 2MHAB 1CTOA 3QCUL 5FGBC 4CL7A 1QRNA 5IB1A 3HE7B 3BP6B 4K3JL 5E9DB 5GRJH 5IV2A 3QUZC 1P4LB 1OGAA 1EJ6A 1LO5B 3VMNA 3W0WD 5IJKC 1PAMA 4L3EB 1KBGL 1G7LA 2DDQL 4QYOB 4JLRA 1HHJA 4KXZI 2YPLE 3NCFB 3NPSC 4FXGB 2NZ9D 2NY1D 3K1DA 4X98B 3OG4B 1U93A 1B0RB 2IPKB 2PXYB 1HYSC 3LRSA 3HRPA 1J05A 2D0FA 2CUHA 1H8SA 3GSVA 5CZVL 3LAFA 3I02B 4LAJH 3U4AA 4F7PA 4JANB 4PJGF 5J6HA 3TNNA 2EDXA 5L6YL 4WRLA 4PLKD 2YRZA 3WN5B 1AD9A 3S6CA 2Q8AL 4LSUH 2V9TA 4NNPL 3WCYA 5EU6A 2Z8RA 5C6TH 2PCPA 3C6LD 1MF2H 1WAAA 1I7ZB 1YUHB 2UZYB 4PJXA 4NQCB 1UYWH 3EFFA 4NCC2 4IOIA 1KNOA 3WO4B 3UTSD 1NC2A 1SBBA 3NPSB 3GRWA 3S96B 3T0VA 2H8PA 5IM7A 5I8CA 2GY5A 1UA6H 4Y4HA 4NC1E 5C0NC 5LKNA 1BD2D 1VPOH 3I6GA 1OHQA 4OKDA 4XP9H 4GS7B 3QUKA 4Z5RA 4C55A 1HZHL 5DJAA 2FSEB 3BD5A 3PG2A 5I75C 1L6XA 4K55A 3TCXA 4CU8A 4F58H 1OM3L 1NFIB 3QNZA 5SX4H 1HE7A 2CXKA 4PJ7E 3FRPG 3O4LD 3BDYH 4XAKD 4O2EA 1OAKL 4OCSL 2GK0A 5DI8A 5E56A 2YD9A 2HH0L 2EE9A 4X83A 3BQUB 1P7KB 1U3HB 4PJ8B 3NMEA 4ZO7A 1N0LA 1IM3A 1CDYA 5FKAA 3MCG1 2PXYA 2VZVA 4PJEF 2HKFL 5I19H 2I07B 3L3HA 1T6VN 4YQXH 4LLDB 4MAYD 4XVSH 2F15A 1AR1D 3SGEI 2O5XL 4XBEH 1KIPB 5GS2D 4ODVL 4LU5H 2ZOKB 1HH6A 1WTLA 1EO8H 3AREC 4P2QD 4FP8H 3VWKB 3TT3L 1LK3L 5D7IE 4OZIF 1DEEB 3BSZL 1HWHB 3RWIA 4BZ2H 3PWNA 4PV8B 1B9ZA 3RIAK 3V6BR 4P23A 5EH1A 4QRRE 4ZFFA 1P7QD 1DLHB 4IOSD 5DRWB 5JHLH 2ZUUA 3P73A 3MRFA 4QHKI 4GQ9L 4OCYH 1FC1A 2ATKB 2GFBA 2P5ED 4MA7L 2H32A 3WFCL 1CBVH 1GSMA 1YJDC 1Q1JH 4EQ3A 3LS5L 5IVXA 5GJSL 4S1DC 1FL6B 5DRZB 1BZ9A 4XCNA 3VGDA 2IWGA 2X1QA 2Q7YB 3GMMA 3DV4A 3VXSD 1DP0A 5EORH 5I1DA 1NGPL 2EC9T 3UTTE 4M7KH 3ROOB 5KOMC 4DZ8B 1HQ4A 4MWFA 4ZXBC 1R5IB 3M8OH 4Q6IA 4LVNC 2XN9E 4FZ8H 5E2JA 3WEXA 1WEJL 1NMAH 3NVQA 1A1OB 5CIPA 3LKRB 4N5UA 4M5YL 5CMAA 1KB5H 1R5IA 1RZIA 4R3SA 3KJ6L 1P4BH 2J5LC 4H20L 5JXAL 4OZGE 2EIZA 2CDFB 4G8EB 4M8VA 1OAUH 3WIFB 4JPWH 4MJ6B 1QTYT 3OL2A 3WNNA 1HSBB 1N6QH 3RY5A 3QB7C 3L7EA 1S7QA 2UWEB 4FS0A 4GBXD 3MLUL 3PGFH 1AIFA 3TCLB 2Z31A 3CDFA 1CDUA 1WBZA 3BUYB 4NUGH 4PGJA 4H1LB 4TOYH 1F90L 4I2XB 2FH6A 4PY8J 2F54E 1WZMA 5HHQA 4JCLA 1VFOA 2E9BA 5CBAB 5GHWL 3QEUA 3EDFA 2I9LB 4WI9A 4LLQB 1T22A 3VJ6A 2ZPKH 2OZ4L 4JM2D 1A6WH 1Q0XL 3HNSH 1JFQH 3DGGB 3QEHA 4GJTB 3UJTL 1FGNH 2ZG1A 1MQKH 1ITCA 3KYMB 4OI9A 3HAEH 3LKRA 5TE7L 1PLGH 1ZGLA 4MXVE 1ERNA 4POZD 3DRTB 4WW2A 2ICWA 2A6IA 8FABA 3ALWA 4G6KH 2WBJA 4TQEH 4K2UL 3IDYB 2NX5A 1YQ2A 3TIEB 3QXUA 1T1XA 3TJHD 5E4IA 3I3EA 5IOPA 4GRLC 3KG5A 5DK0A 4Y2DD 4YPJA 1S78C 3CUPA 4Z6AT 5D7JD 3MCKA 1TNNA 3FRPA 4QRQA 2J2ZA 2A9NL 3G04B 5T3ZD 1ZVYA 1MJUH 1JWSB 2W60A 3T3MF 3PNWB 1Y18A 3AB0B 4X9IA 2ZOLA 5EIIA 2FECL 3H7BA 4NO0A 2VXTL 5E9DE 4H0HB 5HSFA 3GJFK 2XKUA 1WCBA 4NC0B 1AQDA 4LIQE 5ICZA 1MRCL 2CIIA 4GBXB 3NTCH 2OL3B 1S9XA 3CLFH 5T1MA 5ERWA 1CFSA 2L7JA 3QQ3A 4NKIL 4YDVA 5EBWA 4QRRA 2I25N 5C0AD 3BEWB 1YN7B 2VAAB 1D9KA 4GW4B 4OZHE 1D5XB 3H3PH 2J4WH 2G9HB 2P5WD 4HXBL 3HNVH 5A1AA 1HQRA 4PGDA 4I0PD 2IC2A 4TVSa 4XC3L 1CG9B 1D5ZB 5D1QC 5ECJE 3RIFF 1DQLH 1PZ5B 2R23A 3NIGE 2XI9A 1P4IL 5I8OH 1J5OL 1RUQL 3LQZB 2NQCA 3HE6D 3S3JA 1S7RA 5HHVL 5BV7B 5EU6E 1ORSB 4WWKB 1MAJA 1G7JA 2IH1B 3M45A 4U6XB 5TDOB 4PJ5A 1CFBA 4OLUH 4QF1A 4RBPK 2W65A 1YECH 4ZPTA 5J7CC 3L3GB 1EERB 3VDCA 4NQXA 3VRJB 5F3BB 4PJ7A 3QG6B 1LE9B 4OF6A 4Z5RB 3V0WH 1HHJB 4NWTH 2O93L 1YEEL 1VEPA 5DHYB 5C6PB 3TZVA 4E41B 4LLAA 1IAMA 4KKCD 3E6HB 1E4XH 3BO8B 4AEHL 4ISVA 2Z8WC 5D7LA 1YEEH 3QFDB 3VFPB 3UTTB 1IGML 4MXVF 3VXOA 3GI9L 1U8KB 2NY3B 3P9MA 5HHMD 1X4XA 1MCDA 3ZL4H 1T03L 4ZO6A 2QQKL 1NCWH 4X6CB 4TRPL 4ZAKA 3HTLX 5DJXB 4WFED 1F8TL 2BSRB 4Z95H 3E8UH 3VGGA 1PDKA 2C3WA 3IKKA 4MMZC 5F89B 1U2CA 5C0RH 3K4DA 3LQAL 3X11B 4PFEA 4P2RA 4YFLF 5IBUG 1RULH 1N5AB 5L88L 1LP9A 4R4FL 4XP4H 3IU3A 2Z93B 1U8PA 2YD2A 4TUKL 2IPKA 2V7HA 4FMKA 4D2NA 4L9LB 4ZUWB 2XWJA 2IQAA 1YPZB 1A6TB 3MODL 1I1AB 2IALB 2DQUL 3VG0L 2P47B 3NPZB 1G7LB 2ADIA 1AGBB 5F1IA 4N9GA 4YR6B 2OJZL 3U0TB 1TPXB 1P4LA 4P5TA 4LLMA 4GAGH 4X8JA 2O5XH 2BY3A 1DBBH 3CLFL 1I75A 2FWOB 4NDMA 3HE7D 1KJ2L 1MQ8A 4PJ8C 3SDAC 3LKNB 2DQJH 1RZJL 1DFBL 4OGXL 4XNMB 2VDPL 4NN7C 5F97E 3SKMB 4JFEB 2GCYB 5E2WL 1YNLL 2X9XA 4LVNB 4ODUB 3O4LB 5HDLA 3JWDL 3KYNA 5T3XD 2H26B 1KC5L 5KVMC 4JAMB 2NXZB 4GUPB 1UKQA 4ZDHB 5CCKH 3L7FA 2NY1B 3VXRA 5D7JB 4AEHH 1P1ZA 5C0GA 1OAKH 2I60L 4NGHH 2YD6A 5E24E 1QKZL 2AJYH 3N1MC 3U4BH 3U9PL 5IMOA 4EZMA 4J4PD 1FG9C 5EBGA 1XGQB 1NMBL 4K9EC 1E4JA 2V17L 4RIRB 4PV9A 4NHCH 3J8F7 4Z78A 4R4ND 2LAGB 3VW3H 4JKWA 1WZ1H 1AE6L 3H0TA 2XPGB 2ITCA 1BX2B 3HMWH 2VN7A 3MRNA 1H3PL 4PJGA 4ONFH 1JJUA 5D7IF 3T4YB 1OAYL 4XBPA 1NBVH 2A2QT 2VDLL 5HHVH 1FH5H 2XWTA 2A73B 2C26A 5E08L 3JXAA 1MRFH 4Z0BH 4LDLB 3F7RA 3WIHA 3I6KB 4YBHA 4YHLH 3TBTB 4URTB 2F53D 4U05A 3O3DB 4UQ2B 5DK2B 3FQWB 3LB6D 4JRXD 3DYOA 2NXYB 5IB5A 5L9DH 4H8WH 3P0YH 3W9DA 2L0DA 1UQSA 1D6EA 3EZ8A 3ZHLA 5LCVL 3U0WL 4GKSA 4WDIA 2KQNA 4EIGB 4HFUH 2NY0D 4LHUB 2AJXH 5T1LA 4FQ2H 4IHOB 4LQFH 4CN1A 5A43C 4Y4FC 3SBWC 5ID0A 4JO1L 2QADD 1BVKB 5EDXA 4X6EA 2MCPL 3GMRA 3NFNA 1IFHH 2J8UE 2JJSC 1CICC 3O0RH 3DXAE 2NR6C 1X7QB 3KS0J 1V7NL 1DUZB 2VAAA 1NMAL 3HAEB 3AU1B 5C9KA 3X3FH 5C8JB 1VFAB 3DNKA 2A9NH 25C8L 2H3NB 3UX9B 2YA0A 4Y1AB 4UB0H 2X4QB 3M8OL 1OARH 3UAJD 1CXHA 1PX4A 1BLNB 1X9QA 2XQYK 4GBXA 1FG2A 1MJJB 4NQVB 2UY7A 1H0DA 1S7UB 5HJ3B 1AGFA 4M43L 3F7YB 3P4OA 3V0VB 1IVLA 4FQ1H 1ED3B 3QUXA 4PJHA 3U7AA 5J8OA 2JELH 1QFWM 3B8YA 5HYSG 4UDTB 2XA8H 5IQ9A 2JIXB 1KLUB 1KENH 1QP1A 1A9BA 1S5HB 3OKKA 1F3DH 2Q76A 4MJ5A 4LHJB 4V1DB 5I1HL 3L3DB 3C60D 3FONA 3MCKB 2OZ4H 3TP4A 2C3HA 3PJSA 2I5YL 1ONQB 4LHUA 2D7TH 1EHLL 1DTUA 1AP2A 3DRQB 5EIQA 1F6AA 4X7EC 1KUMA 3BZ4B 1D5BA 4KWUA 2ZKHL 5EFIB 4HS3B 1MCQA 4OFDA 2JLLA 4NRYA 3WFZA 1C7SA 3QA3A 3FJTA 4OGAC 4RGND 3VH8B 3RWFA 4GKZA 4Y1AA 3JVGA 1OP5H 3EO9L 1OVZA 3EKCA 4P3DA 3TN0D 1I7TB 3GSQA 5I1AB 2BXZA 2AV1A 4MD4A 1BM3H 1CICA 4X6EB 1XFPA 5JZ7D 1XF2A 4XBPB 4P5MA 5E99H 4YHOH 5DWUH 2Z91A 4JQVA 3QQ9C 3EHBC 3EFDH 1X7QA 1M7IA 4U7MA 4DVBA 2RHEA 3ARQA 4LOUC 4C56D 4D8PB 2AK1H 4OLYL 1BZ7B 2QLVB 3HS0B 3GSXB 2C9AA 2OBGA 1TTGA 1NFDA 4OD2A 2UVFA 4MXQC 4A6YA 4FQ1L 4QRSA 1NGQL 3Q1SH 1NSNL 1JNNL 1FZOA 4S1RL 1RZIB 4R3SB 3QDJD 1BAFL 1KPUA 2J8HA 2R0LH 4JPKH 4N9GB 5FUZL 3MV8B 3D5OF 1MCBA 4NFDA 1MREL 4LP4A 4G42B 4EN3B 1MCHA 3EYFB 4L8SA 3V4PL 5HI3D 2A6KB 4YHYC 2NZ9C 4L1HA 2UWEF 2BVPB 4KJQC 2K1MA 4K71C 3AXLA 3VFOA 2Y07L 1DN2A 5D7SH 4MYWB 3GMLB 3X14A 2QKIB 3U0PA 5ESQB 1WJ3A 2N4IA 3N06B 3ARDD 2B0SL 3MLYL 5IJVA 4L5FH 2GSIB 4KAQL 4ODVH 1I3RB 2MSPA 2Z9TA 2PTTA 4J3UA 3ZE0F 2K3TA 3U7WH 3FFCB 3R8QA 1AY1L 1B0GB 5KBNC 3LKNA 2RFXA 5GISH 3L5WA 5C08E 1A5FL 1QLEL 3D2UB 5KN5B 4OLVH 2PW1A 3W39A 2X09A 4ZODA 3IU3B 3C5ZA 1KJ2A 2WIIB 3BAEL 3WJJA 4AH2B 1RPQA 3MBEA 3HFMH 4XZUA 3LKPB 2A38A 1H3WM 2W9EL 1GC1L 2G5BA 5J12C 1X5HA 2Y06H 3QI9A 5E70A 1FVEB 5CEXA 5ITFB 4F58L 3DXAD 3HMXH 2DD8H 1JGUH 4PJIA 4AENA 4HEPG 4LLVB 2WANA 3O2DA 1ZLSL 1FYTB 4FTVA 2YD4A 1T2JA 1JZ5A 5I1KL 5A16A 1X5ZA 1YN6A 2VLRA 4DKEL 2IEPA 1UFUA 4EIZC 5KW9L 1I8MB 1NAMA 5INCB 5KANI 1E4KA 3R06B 3SDCC 2V2XA 1NFDE 2DL2A 3I3BA 3KWWA 4OQTL 1QR1B 1HN1A 2RQ8A 3OZ9H 3LKQA 3DBXB 1GAFH 5I1GL 3SBWA 1MF2L 3PWVA 3SGJC 3P9MB 1FSKC 4P2QE 4ZUTA 5INDA 1P7HL 3O2VL 3MJ7B 1N7MH 3QWRD 3QG7H 4QGTA 3AMKA 4D0CA 4HUNB 2WM0A 1KJ2B 5CJQL 3MMEB 5KVEL 1MHHA 3KPRA 4V1DE 2WWMC 3OG6B 1WAAF 2X4TA 3ULUF 1D5IH 5FGRA 1YYLH 3B3IB 4ELKB 1JRHH 3S36H 3BT2L 4NSKB 2CR3A 2Y25A 1BOYA 4L8DA 1XCQB 1A3LH 3VE0A 4G8IB 4ISVB 3NCCB 5D7LB 3QHFH 4FN0A 4F7EA 5FECB 4PGEB 1G9NL 3MFGB 4PJ9C 5BS0A 2WUBH 1HQRB 5FA3A 1FVCB 3JV4B 2VABA 2W9DH 2HFEA 3BQUD 3JWNC 3IAQA 4Q6YA 3TZVC 3IDJB 2DQFB 3SCMD 2YRPA 4RGNB 3MOAL 1LE9A 3QISA 2A6DB 3BVNA 1GJIA 5DK3A 4ZFOB 3EYFA 4HBQA 2MFNA 2V5TA 5BV7L 3RUGE 4OTXH 1KCSL 3PV6B 3DRQA 5IFAL 3DETC 2BFVH 4LIQL 4OV5A 1Y18B 3GMQB 2KPNA 1AGDB 5FM8A 3GSXA 1VGEH 3P30L 3IXAA 5GGUB 4HPOL 3EDKA 5C2UB 5D8JH 5F7NC 3TWCH 2A74B 1CZ8H 2BNRB 5D6DC 4OGYL 1QOKA 4L4TB 2R1XA 5L2JB 1CFQB 5TDPB 4OIAA 4XWGH 5AUMB 4XNXL 4H1LA 3B2VH 4HUXA 1CFSB 1SEQL 3QQ3B 4GLRH 3DXAA 3FO0L 4P5TC 1J86A 3RGVA 4L4TA 4OD3H 3MNVB 3DMMD 4L29A 3HMWL 4Z7WB 3VXNB 5CZKA 1CCZA 3QR2A 1WZKA 5C07B 4M6ML 1O0VA 3PWJA 4OLXH 4XWOC 1KLUA 3Q48A 3H2WA 3B2UD 1RIUL 3V7MA 2V17H 3HAEA 2EDRA 3SQBA 3UO1H 2AXGA 1ZT7B 3TBTA 3B2VL 3RI5F 4MCZA 1U8QB 5GIRA 5KSUA 1Q9LA 4YHPA 4ZS6D 5FFLA 4K3GA 1J8HD 4KKNA 1GHFH 2VSDA 1YDPB 5BO1H 2DWDB 5T5NF 5I30H 2K7QA 2YN3A 2YK1L 4WTXA 2PN5A 2AW2A 4Q58C 4KPHL 1II4E 5JPNA 2BP3A 3QUYB 3C09C 3P30H 3K8MA 1DE4A 1F3DJ 1A1MB 3ROLB 1R5WB 5KSBA 5KVDH 3H9SA 5CBEA 3FQXB 3SHSA 4RGNC 5EBMA 4NN6B 3V4UH 2EIZB 1K2DA 1FFPB 1BVKA 3TYFB 2OTWA 2VXSL 4PJGE 4K9EH 3WJLA 4JM4L 3SN6N 1ETZA 3I6LE 2BJML 2DIJA 5IWLC 4XGZA 4D9LH 1E6JL 1Q0YL 5BJTA 3REVA 4AEEA 1XIWC 1KPVA 3CVHH 4A2LA 5H37H 1N64L 4TSBL 3TA3D 2BNQB 3TYGH 4AL8L 1YMMD 2JB5L 4PLJC 4JG0H 3TF7C 4FFZL 4XVUD 3DPBA 3PDDA 5HVGB 43CAA 4D0CB 4EEEA 1U3YA 3S35H 5L7XL 3DI2B 2D9CA 3BP7B 2HMIC 2MQ3A 4JGJA 3ULSA 1CF8H 1HKLL 4HIHA 2G75B 2F5AL 1ZV5A 4YC2B 4HLZH 1L9MA 3QWRA 1BFTA 1IM3B 3DO7A 4GXVH 1YYLL 4ETQA 1XGRB 5DGRA 3QT2A 4YXKH 3CDGA 2FDBP 4HH9A 4XC1H 4PS4H 3CFCL 3FO2B 1AGEB 1ZT1A 3V6OC 4V2BA 4G9FB 3HI5L 4PJDB 3QUMA 1XF4A 4JZJA 4DKFH 1N7ML 3DROB 3V9FA 3AVEA 4XNXH 3V4VL 4G6JH 2YPKA 4L3AA 1KJVB 4JDZB 4XPTH 5KZCB 3NH7H 3BI9X 3LEYL 2D7MA 1BZQK 3P73B 2ATPB 3CNKA 1P1ZB 3U48A 5I0DA 2Y7QA 1LEIB 3CXDH 4R8WL 1QZ1A 4XMLH 1LO2H 1QVOB 3UC0H 1H3TA 2GJ6D 1DEEA 3RWIB 3WUWG 4LLYA 9CGTA 3LV3A 4Z7UA 1BQHB 4OUUB 1Q94B 2HG5B 5K9QG 4U1IB 3T2NH 5DO2C 1LO2L 2P7TA 2NMSA 3VXOB 3ARBD 4LLDA 4PJFF 3O6LH 1CLYL 2A0LC 2GJZB 1KB5L 3B6SB 1Y6NR 2HJKB 5IMOB 3RFZC 1TCRA 4M7ZC 2ZSWB 3PHOA 4RAVB 3HFML 3T8XA 3B9KC 5ILTH 4YPGA 4I3RL 3BH9A 4XCFL 2X4UA 5D7LE 4A6YL 4ZFFB 4YXHL 1EGJH 5H94A 2LFGA 5B4MC 5DLMH 5MEQB 3I6GB 3T1FB 4WCYL 4I4WB 3CMOL 5M7QA 3GSNA 3SE8H 3RKDD 2Z93A 3PGDA 1N0XL 3S36L 4IJ3B 4KUZH 5CEZD 1MWAL 1JRHI 3VXTA 3DUSB 4F9PC 2IPTH 1U91B 1K8DA 3C6SB 4Q9QL 1X5FA 2E3VA 3MUGA 4U1NB 3NCBB 4J3TA 3O4OB 4G43A 5TF0A 2IFFH 2BY0A 2ICWJ 2XKSA 4K94L 3QP3A 5EU5A 4OD1H 2CLVB 2VXTH 1ZLUH 5CJOL 4XNUH 1HOCB 5EUOF 4P3CL 3RDTD 3S37X 4JQXC 5DDHB 1AD0A 3IJHA 4HX1A 4PRPD 4X80H 1G7MB 4CN6A 1U8HB 4QXGH 2VXUL 3IDNB 2D7NA 3E6HA 4W6WB 1MH5A 4MHHI 4DEPC 1GH7A 3QIBA 1RUKL 4PJ8D 5F9WC 2W65B 3V6FB 2ESVB 3CDYA 3QPQD 3V6OA 5C0CD 1QLFA 4H1LG 1JZ7A 3SO3C 1UH4A 4NPYB 4JY5H 3V5DB 3CVIH