1FYWA

Crystal structure of the tir domain of human tlr2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
145
Chain Sequence
b'SRNIYDAFVSYSERDAYWVENLMVQELENFNPPFKLLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TOLL-LIKE RECEPTOR 2
molecule tags Signaling protein
source organism Homo sapiens
publication title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains.
pubmed doi rcsb
total genus 34
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1fywA00
2Z5VA 4C7MA 5H3CA 3OZIA 4FZ5A 2J67A 4C6SA 2JS7A 1FYXA 5KU7A 2M1XA 4W8GA 3JRNA 4EO7A 3H16A 4LQCA 3UB3A 2Y92A 1FYWA 4C6TA 1T3GA 4LQDA 4DOMA 4C6TB 4LZPA 4OM7A 1O77A 4C6RA 4W8HA 3UB2A 1FYVA 5FORA 3UB4A
chains in the Genus database with same CATH superfamily
1MU0A 5TJ9A 4HWOA 1KO5A 1U81A 3SSMA 1IWPB 4CT0A 3GA5A 1P7ZA 2DBRA 4KPGA 3DTTA 3SR4A 3H5NA 2PSSA 4DY4A 1XLWA 4INAA 4NG4A 5JAQA 5FBWB 1GCUA 2OE2A 4BLSA 4WFKA 1ULAA 1CNEA 4ND2A 3G3EA 4BP1A 3K6KA 4JC0A 2KS6A 3N87A 5AK6A 1UEJA 1GRQA 2G07A 4ENSA 4MP8A 1UM9B 4WECA 2MYPA 3GD5A 5L4NA 4PPGA 1QX4A 4C7BA 1SC1A 1X0VA 3ZWVA 4HP8A 1CZUA 3A2LA 3CNLA 1I1OA 3I23A 3A0UA 1CQJA 4EB8A 5DWDA 2AN4A 4JHLA 1U1DA 2XDWA 3DBLB 2RFLA 1NLZA 2FOIA 2X0NA 4YFYA 2BGJA 3IXMA 1YRAA 3OCCA 4QDJA 4TKVB 4KYIB 1M8JA 4XJVA 2BFPA 1JHXA 2FSPA 3LYHA 4NDAA 1X7HA 2DUMA 1LRJA 1RZRD 3ENZA 1T2AA 1YK0A 3JRWA 3BKWA 5EWJA 1VLHA 1WM1A 1QU3A 2ZAYA 4G4SP 2GFHA 1OC4A 3FYUC 5K2OA 3JY6A 4FDVA 2GN8A 4MGYR 2FQWA 3A6GA 2UUAB 4IXTA 4M1YA 5IM4F 4LX0A 1UIRA 4XGIA 2WF7A 5BW8A 3PUWA 1W5BA 1XYVA 2O9JA 3FFAA 5LZ9A 5EJGA 1PK9A 2EFCB 3S5UA 4BFSA 1ZL2A 4OQXA 1EBFA 3OQJA 4MVJP 4BX3A 4EY8A 5BNWA 1CD5A 3AM4A 1YZTA 3GO4A 1QFMA 1U80A 4ASUD 2WAMA 1OIVA 2HBZA 5L3QA 2XNDD 3TW4A 3UMGA 1N6LA 1T8UA 3CRNA 4P0QB 3GQBA 3NHMA 1YBAA 1MFPA 2HIGA 2X23A 4ZT2A 5F3WB 2X76A 1LI4A 4GLLA 4YJ3F 1PZEA 4OH1A 3UWSA 4BVAA 3ZLUA 3LUAA 2Q2WA 2IS6A 3ICQB 3ML1A 5EMJA 2CLCX 2JZNA 3VKWA 3PWZA 1WKCA 4ZXPA 3PTLA 4ZD6A 1CDOA 3WOHA 4ZOLB 1NPDA 3T0IA 5I8WA 2YYSA 2O8FB 4URHA 1B16A 3UTDA 1GGEA 1Z4IA 3DMFA 3H18A 4R05A 4QYSA 2VHXA 1DWPA 4WLFA 4LJ4A 3AYXB 4DSAA 4OLAA 1HBJA 2QMEA 2IPXA 3ZKWB 2BUCA 3BXPA 5K8IA 3QJGA 4J1TC 1THGA 3A3YA 5IAGA 4DG8A 3BJEA 4NXNB 2X8BA 3LCJA 4G1CA 4GKJB 2JLZA 3MEQA 3AFIA 4E4TA 4EUSA 5BSKA 4GXTA 4AK9A 4L02A 1NBME 2NZ2A 3PFWO 3DGFC 5GZ1A 2REXB 3OSUA 2I6FA 1Q0HA 2XDQB 3IX7A 3VYUB 1HEYA 1N2CB 3QUSA 4HEA1 4LIPD 1K6EA 3NHPA 3QVJA 1L5FA 3R4CA 5FBZA 1KHTA 2JVJA 1QQBA 2E5LB 1MOQA 5CFNA 4BHTA 1STOA 5D87A 2ZCUA 3GH1A 1MZPA 2FP4B 1JHOA 1TYAE 3CX4A 2CNKA 1AA9A 3C6ZA 2WPDA 3GGSA 1U7DA 2FFHA 1YZQA 2YZGA 3KAPA 3CX6A 3L43A 1YOVA 4AP9A 2VWGA 3EEFA 3OBIA 1SCDA 2PSEA 4YMTA 3OT5A 2XYVA 4HH0A 2CXSA 5BW5A 1HLFA 4DA7A 3PHGA 1VE3A 2VF7A 3H8SA 4TSKA 3G5UA 1XCPA 3OT1B 2DZDA 2HNAA 2ZRJA 4JT4A 3R5KA 5THXA 3ADCA 2WTNA 1UUFA 4L8LA 1FTSA 1QC5A 1WIWA 2YCLA 3C6YA 3CH6A 4LXTA 4RNCA 1MXFA 1Z06A 2CUKA 3KTAA 1SXJB 5HKKD 3EJWA 4JBHA 3M3HA 5JDCA 2RGXA 3TSAA 5E2AA 1PX0A 2Q9AA 4BNDB 1P29A 3GUYA 4YJGB 5IJZA 2XXAB 2FLKA 2WHYA 1Y9JA 3FYTA 1CE8B 3E6AA 1LA2A 2WYVA 3HU2A 4L2IA 1Z08A 3AHDA 1YT5A 3CJRA 1DRKA 3DZCA 4WY8A 3ZJUA 2WFLB 3CIFA 2G4LA 1WXIA 3EFOB 4KO2S 4RM3A 2OHJA 3GC6A 4WVFA 3UATA 1JBKA 3EZYA 2PGJA 3IBCA 3L7LA 5BORA 4ZI2A 3RUIA 1B2LA 3MTQA 4CVNA 3UB2A 3VR2D 3NHZA 1U3UA 1ZVKA 1OV4A 1RHJA 2JZOA 4EJMA 2Y99A 4ZN6A 3KXLA 5KTNA 2SHKA 4H17A 2HOQA 1VTKA 3OZWA 2HIAA 1HDGO 1GPKA 3GMTA 4UBIA 1G42A 4JIMA 1X7DA 3K4PA 4NQRA 5IJ0A 2XCTB 1VL6A 3O8QB 1VZ3A 2WR8A 4QOGA 4B2YA 2QV7A 4EWLA 2KYRA 5F77A 3NDJA 3DMPA 3SF8B 2W6IA 4MYUA 4TTVA 5D2CA 2QTAA 2JI4A 5IRCD 1KDOA 3H8WA 5I4CA 3W5CA 3GNQA 1BXRA 1AF7A 2XT0A 2GDZA 3R6TA 3LSYA 4KODA 4D9GA 5J23A 2Y1KA 4LRWA 3JQQA 4JI4B 1AQUA 1YBHA 1GTVA 4NV1A 3B85A 1J20A 2F2TA 4HQRA 2QY6A 3TLMA 2HGSA 3M5DA 1U0NA 4PF1A 4DZRA 4DLKA 2GQ0A 1VL2A 1E3MA 2I1WA 3OQHA 1PLKA 3OWXA 4OJKA 1DEKA 4EI9A 4EG6A 3AB3A 4L1KA 2AK2A 4XLLA 4QPJC 3W34A 3E1SA 5CFZA 1ACLA 1W44A 1Z63A 3TM4A 3V33A 1VCMA 1QBGA 3THSA 3NDRA 4CMIB 4DLLA 2HDNB 2D1TA 4PVCA 3ETDA 1NNLA 3NYQA 5EUBA 3LYUA 4ND8B 4Y7DA 4FBGA 3QXCA 1XNHA 1IM2A 4H59A 1RC8A 3RU7A 1YS7A 3DVSX 1LX7A 4YP0A 4BNHA 1E4YA 5BQ3A 4C30A 3EFBA 3OOJA 4DPLA 5IJ9B 3ZV7A 4E11A 2VAVA 4EX6A 1T0BA 3GJ3A 1ESZA 3ZC3A 4G5HA 5JANA 1C80A 2YXDA 4HDQB 4N01A 1D2CA 1JA9A 2DQYA 1FMJA 2H5JA 3JQDA 4N3NA 2JAUA 4UUBA 4TKUB 4PFKA 2XCIA 2JARA 4E07A 3SZOA 5KOHB 3CNHA 1OGYA 1BVHA 3DA8A 1T6NA 3UWKA 2OAP1 3OFNA 3PLRA 3OX1A 4GM0A 2Y0CA 1SMKA 4RTRA 3KT3A 3EZNA 2VQEB 1HH4A 3O8CA 5FI3A 3SDZA 4L4ZA 4P33A 2ORYA 1G8PA 4WNYA 3VC1A 1PR6A 2HSGA 1S4MA 1TUBA 3NBXX 4LYGA 1F4VA 1LLCA 3E23A 3QVXA 5DBEX 5JSHA 1D7OA 2NVBA 2H6EA 4KR0A 4PAGA 4DBVO 1QGUA 4C21A 5DYNA 2M6SA 2BMDA 4DBZA 5KC8A 1Y4ZA 5BNZA 4M6WB 1PNOA 3RKSA 3UKOA 1KDZA 1E9CA 3ABOB 1UFOA 1CFJA 3P26A 1DPGA 5CA0F 5CB8A 1W93A 4S04A 2BMAA 2V7XA 3U17A 2QVBA 2W2NA 2I87A 1G2PA 1WXWA 4AUKA 2HA5A 4TLDA 2BFDB 3BVPA 1F8GA 4HFJA 3W2FA 2OHGA 2M9MA 4NECA 2O8VA 3EZ7A 4G9GA 5DXJA 1PT9A 1RPTA 3JQAB 5L3SA 4ESHA 2G8LA 5BNTA 5EHZA 1TVKB 2GAFA 2O57A 2RHBA 1D6SA 1ETUA 1YQWA 2C9DA 3D3KA 1OWLA 4JVSB 2M6RA 4BB5A 3A36A 4RIFA 2MMCA 4M4SA 1O94D 3PJDA 5IVIA 3WSVA 1JWAB 1QFXA 3L9XA 1XGKA 1WKBA 3N7TA 4F60A 4AMGA 1UM8A 2P62A 4W5HA 2L0XA 2R2GA 4K8RB 3B1YA 9LDBA 3GPBA 5I4IA 3KOXA 3UK7A 1FZQA 4FD3A 4F2GA 4B74A 2NO7A 2RBGA 3W0LB 1QIIA 2O2YA 2HYIC 4GG1A 1NVFA 5FWXA 3AIMA 1NMXA 4WFJA 1FFEA 4EITA 2WZBA 1Y8RB 4EDFA 3O0TA 1V9SA 1Q16A 4UEOA 3ZW8A 1JQAA 4I0WB 4POOA 1IQ0A 2W2OA 3ZHVA 3I9OA 3JRXA 3P4XA 2R66A 1MJGA 1F20A 2V97A 3QPVA 4KMOA 1EWTA 2P2GA 4N8SA 4NCIA 3HADA 4TVKA 5AQEA 3LX4A 2GBIA 4QDZA 1HYGA 4TYNA 1ZO8A 3OJCA 4HS9A 1DX4A 2HF7A 3QW4B 3A37A 3LZDA 2JD1A 5D1NA 1FBNA 3DWEX 1J2YA 4DMMA 4B73A 3WGUA 3AI7A 3D4IA 4PG4A 2I03A 2OM6A 3TKLA 1E2KA 1EK6A 2JGDA 4FC7A 1GZUA 2RGNC 4M9SA 5F2EA 1J6UA 2RH4A 3RVPA 4BVHA 1F3OA 1ZZGA 5F9HA 1THZA 2VDUE 4FNMA 2R2AA 4R7GA 3ETNA 3RV3A 1A9PA 2HFKA 4O4IF 4C6HA 2V0CA 3CNQS 1DXQA 1GPDG 3H5OA 4I55F 1DBSA 2GPAA 3ZXYA 1DC6A 1D2EA 1M7BA 1YR8A 3CG4A 3IPYA 1NHWA 4H4CA 4MARA 1GNPA 3LT5A 1X1DA 3E7DA 1G17A 4GGPA 2IVFA 5BXYA 4J3JA 4Y2RA 1A4UA 4KR2A 1P0CA 3W1WA 1IZ7A 3NHYA 3GJ7A 4RUKA 1NYQA 3FSJX 1A88A 2DFDA 3KFVA 5IJXA 1YE5A 2BWJA 4R31A 4Y2GA 1YZYA 1S3FA 1WD7A 4CV0A 4IF6A 2QLMA 5G41A 4L16A 3KV1A 3H99A 4E3ZA 1TJ3A 4JB0A 1LNZA 3VHLB 1TD9A 4W9NC 1PX2A 2PYIA 3LBIA 1QIJA 3KDPA 3O38A 3UK2A 4HRAA 2D4HA 3B6EA 4BZPA 2XKBA 3UW3A 3PEWA 2B4TO 3FR7A 1LKZA 2AI2A 2P6NA 1WVMA 2PJUA 3GJ5A 4PR0A 4F91B 5JAUA 3HO6A 5CM8B 2YWRA 1H9BA 3JVDA 3ZDFA 4H1HA 1LDBA 4EGJA 4EO9A 1XB2A 1DINA 2YBDA 3IUMA 4HO1X 3LPMA 4BWFB 4EYSA 1NM5A 1CJCA 5EHGA 3BK1A 3GRUA 3B5IA 2PMFA 4MWTA 4O2RA 1RC1A 1TM1E 1ZD5A 2X4GA 3AXSA 4CR8A 5EZYB 1OD6A 2JL1A 5C7OO 4OLFA 3CH5A 1OA0A 3G17A 1S01A 4V0ME 3OE4A 2EBFX 3X2SA 2JFYA 3GAZA 2P8JA 5FF9A 5HFNA 1OZAA 3D6UA 3FWYA 4DLZA 2EQ5A 3HH8A 1RHQA 1WL8A 1U28C 2WHEA 4W1SA 3RSSA 5TJHA 1R0ZA 3GT4A 2C3PA 2P9QA 1BKSB 3F6EX 4JYCA 4U7DA 5HK9A 4BO3A 3UEOA 1U2PA 5CITA 3OQPA 2QXTA 3SC6A 2P2YA 3V4FA 3HKCA 1GL6A 4UM5A 1ISFA 2P2CA 2JH3A 4ZCLA 1PV1A 1N5LA 1XMSA 1QIGA 2OESA 4X54A 1TT5A 1G8FA 4JKYA 1IFXA 4UJ5A 4O08A 4DCGA 1PSWA 1AUPA 4HD8A 4YRSA 1K9VF 1QNFA 5A4AA 2FFBA 1Z68A 2RB5A 1P1RA 4LOHA 5GM1A 3LLMA 2BP7B 4E2FA 4QJ3A 2NN3C 3MELA 2IIVA 3O3CA 1V8PA 2ZJOA 3B1KA 4PG6A 1REQB 5CT6A 2NYUA 3PVCA 4R7TA 4X93A 2B36A 4M2LA 4R6XA 5SV2A 1Y4AE 1JWBB 3IPRA 1IBLB 2GR9A 4FWIB 1ACJA 1ECPA 3HJFA 4D42A 1OXSC 2DERA 2AUNA 3V2IA 2LCQA 2F4VB 3P4UA 1EGVB 4DMCA 5ELMA 4P3KA 4ER3A 1KAGA 1PTKA 3EWAA 2HA4A 4KKXB 5CT9A 3WK7A 3HPQA 3D8HA 4E12A 1MTZA 4EENA 1FYVA 2ZBQA 5D7BA 4DG9A 2V6JA 2EGUA 2WUFA 3RFUA 2AFIB 1H65A 2FWRA 1L1QA 2W4IA 3PBKA 5FUWA 1ZU4A 1EXDA 4MYRA 1GG9A 1PYOA 2ZAIA 1D1SA 3X1DA 4ZZ1A 1G5IA 1TRHA 2BKEA 2A4KA 4B8WA 2V7WA 1XOIA 4RMNA 3QH4A 2AC4A 4FXPA 1EIZA 3LECA 4XFKA 1XZBA 3FROA 2VYND 3DAYA 2O05A 2NZXA 5H02A 1REQA 4EG4A 1KMNA 1D07A 4CE6A 3GR6A 2OB1A 5JD6A 1EVYA 1ZJYA 3AUSA 4Q48A 1U4NA 4MW5A 2EIXA 5AI8A 4BEBA 1ISHA 2Z3WA 1IBMB 2V7EA 3HUEA 4Z9YA 4HN9A 4HNUA 3PA6A 4MGIR 2CEKA 1J8QA 3KKOA 5KZMB 4J3NA 4G0WA 5TX7A 2PKWA 1BW9A 2WJ6A 3ETJA 3ITKA 4QRHA 3GAAA 1YBFA 1R74A 2QM0A 1N1DA 2WJGA 3CUUA 1C2YA 5GONF 5HFJA 3NCTA 1QDUA 2X6QA 3VZQA 2XMQA 1YIDA 1IXSB 1TCUA 4U4AA 2A6PA 2AQIA 3Q3EA 5KSWB 1KORA 2GBLC 4QGAA 3H9BA 2O3JA 1E4EA 1XD2A 2OCXA 4V2IA 1W4ZA 4QTTB 3ZOZA 4F3TA 5CLQA 3GLVA 3V4VB 2ZJ4A 2FPRA 2ZATA 1OXUA 2OTCA 1JL3A 4MYSA 1TQ8A 3CA8A 5HKOA 2VDLB 4HUQB 1LVGA 1N1MA 1DLJA 1J5XA 2PVPA 2VJKA 4NBKA 3WK5A 3L1VA 3ESYA 4WXYB 4N5IX 3TYXA 1RAGA 1K0UA 1VXRA 3F8WA 4ZK2A 3WLOA 2JJYA 2R6HA 3AI3A 4KIFA 3U0VA 1SEPA 2GCOB 4E2YA 4OYLA 4MUIA 4ZANA 3OZIA 1YRQA 4BRWA 4L9RA 4Q82A 3DWFA 4JB2A 3P2OA 1PFVA 5KINB 4B0OA 5EKXA 2PAAA 4PS0A 1E96A 1RD4A 3EC7A 1DV2A 4BGDA 1ZR4A 3JQ8B 4WESB 2C78A 4QBHA 4DXAA 3HBLA 2ZIUB 4B84A 1CUVA 1ESMA 4AMYA 5JC1A 1PK8A 3JYNA 4JASB 3BZBA 1ZM2A 1CEYA 2ODAA 3FKJA 3DDSA 3HUUA 3L84A 4Q7MB 4LVUA 4ZVTA 1CJKC 3RSQA 3HJTA 5CB0A 4QLBA 1HKHA 3ZU6A 3ZYZA 1PDVA 1JP7A 1VQ1A 1HE4A 5EP2A 4A0RA 3VZRA 3S5JA 1FXWF 5JVDB 2OBYA 3CG0A 4G07A 3W78A 4BBJA 2RHHA 2FJPA 2DPYA 5DEIA 1ARZA 3ILVA 5F3RA 2XITA 2C94A 4YRDA 4ZAGA 3PJEA 3JTEA 2OFXA 4WZAB 4J0CA 1POWA 2ZIEA 3UGQA 1GL3A 1NBMD 5K0GA 1T9DA 1HY3A 2O8DB 2QRUA 9ATCA 3IEXA 5FPKA 5SICE 4GUAA 2V4MA 3AW9A 2ZBPA 1K98A 2BELA 2ZWMA 3KZNA 2V9ZA 3LO5A 3QWHA 2SKEA 4KXUA 3I30X 2QHXA 1I2BA 4IICA 2JI8A 4QUHA 4BNTA 4BVJA 2X41A 2QRKA 1QVWA 2ACVA 1GPMA 1QFYA 2A3NA 2ZBUA 2R6DA 4KWIA 1RI1A 5EXPA 4MYCA 5BWBA 3MPOA 3PGVA 2HA6A 4NPHA 1O57A 3MJVA 4ISCA 2DSTA 5GIPE 1ETHA 3L8HA 3P2KA 1RQNA 3QX3A 1T29A 2XF8A 3BFVA 1D8AA 1Y5MA 4HLQB 4OH7A 1PSDA 2AG5A 2V5VA 2ZIZA 2J6HA 4LY0A 1LEHA 3BUSA 3I83A 2IOYA 1IJBA 1FS6A 2ERYA 4MUMA 4X64B 4ZHQA 4BX2A 3GF4A 4OQMA 1VJRA 4AS3A 1V41E 3HO8A 4WZBA 2WIAA 4Z1MD 3F47A 4QUJA 1HL7A 5HZKA 2IYRA 1N78A 1DCFA 4ZRDA 2QTLA 5HOEA 1HE2A 5B3JC 1OH8A 4YO8A 1ZS9A 3SP1A 4H1VA 4B7UA 3F78A 1LXCA 1INLA 1EFHA 1KDTA 4NYIQ 4BGIA 2P6MA 3V8VA 2BKVA 2OCAA 2ZSHA 3MJTA 2QUBA 5DNUA 3C5VA 1UEXC 1ZD9A 4RLSA 2YQ5A 5EWLB 2F1OA 1V5WA 2GPWA 4EGQA 2QTNA 2VH5R 4CTMA 2HQOA 4OJMX 4PSDA 3JQBA 4R9NA 4UUMA 5CCBA 2WJPA 4OA5A 3OHPA 3T52A 2EFDB 3G2JA 1AT1A 3C3MA 4AMVA 2XPCA 1FP6A 5JD4A 4JJFA 1UQRA 5GGYA 3RW9A 2I3AA 4BKMA 3HS3A 2A7QA 4BWVA 4YQFA 4PZZA 1IZ0A 3C3EA 4FPXA 3PE3A 5B36A 1X8LA 1OF1A 2AXEA 1HPLA 3L06A 4HQ6A 1IB6A 2R68A 3PRYA 4O4IB 1W36B 5DYIA 2NXNA 4TQ9A 3NT2A 5L3SB 3GP5A 4G36A 3UC9A 4B0PA 4EHHA 1CY1A 2AXPA 2R25B 1IIBA 3EZFA 4DXHA 1HZJA 1YRBA 1GQQA 2OV6A 2HU8A 2WKWA 3DBHA 1MP0A 3H83A 1T6BY 3U9SA 4B35A 1N0WA 2B21A 2C00A 2W6QA 5EFZA 3RARA 2ODPA 2QL6A 4MAMA 2GNPA 1RKQA 3LGAA 4XZ3A 1F1JA 2F7SA 4MJLA 3U81A 4DB4A 2QUZA 2WKPA 4HGNA 3TJZA 2IXFA 3NOOA 1KI1A 1P2DA 1T8RA 4BDSA 3AY0A 1A8UA 2HDOA 4UHKA 1M74A 3IJEB 3SQXA 3N2IA 2O1XA 2QU8A 2H1VA 3I6IA 4BO2A 2QJTA 5IDQA 2BP7A 3OZCA 1K2VN 4WH0A 4A2CA 2KLBA 2O2EA 3OJWA 3TRKA 5H68A 2JFVA 5AK5A 3PTZA 1P2FA 3K20A 1RHRA 4KQKA 4UAJA 4A2WA 3ZY4A 4D02A 4EA8A 5IN4A 2ZOSA 2C8KA 3CWCA 1FJ2A 4Q7JB 5DT2A 4XX0A 4HN4B 3CTPA 1JT9A 2O7NA 2PJZA 4QUAA 3TXAA 3ONNA 5C8YF 1HRDA 4DYHA 3GZNA 3DDZX 5IJ9A 1AHNA 4MV7A 1VDZA 4K05A 4PN7A 1RM0A 5G0UA 3CURA 4NMWA 2VJMA 1Y3BE 4S3MA 3O8LA 3WQBA 5IFLA 2IS2A 1KJWA 1QH0A 4H9GA 3T3DA 3NH6A 1L5GB 3OCVA 1HLDA 2NTYC 3QU2A 4YBRA 1LBTA 4MS4A 5ALWA 2OV2A 5A9TA 5KCZA 3FH0A 1V3VA 3LL7A 4YT2A 4UMVA 4QXOA 2CNWD 1EEHA 2X9NA 2XAAA 5CDYA 4QXAA 1V1MB 1Z6YA 1T2CA 1V9CA 4BWYA 4C4RA 3AV0B 1H5UA 4AKSA 3H65A 3QYAA 3W2IA 2RC6A 3VJKA 5JSZB 3QU7A 3D6JA 3CINA 2YMQA 3UFXA 1OLXB 1T2UA 5BOSA 5CEFA 4RABA 1DC5A 2HHCA 1LGYA 1JECA 3V8MA 2P6RA 2HK6A 3VUEA 2Q1TA 1V4VA 1Z13A 3OQIA 4LBWA 3SAJA 2YHIB 1IY9A 4I81A 4KV7A 4QAJA 4QNRA 1PWYE 2NLOA 1V25A 3AOEA 1R0WA 3ZEAA 1G20A 2R751 5JO0A 2DFPA 5AKIA 3W2TA 4UEKA 1KH2A 2HCBA 3IOCA 4MGHA 5TB5A 3WLIA 1JN0A 1EDEA 4MHTA 1H1LA 1GUBA 1Q20A 5KTOA 1USVA 4K6GA 3QEAZ 3VKFA 1A2OA 4UBMA 1I14A 1NE2A 3E2IA 1K5HA 5J43A 5HF5A 3V7WA 1LPSA 5HVNA 5AVVA 2R8EA 4JNKA 3B3JA 1O5OA 3AETA 1F4LA 3KEFA 1UZLA 2WWRA 2HM7A 2NUTA 2QV0A 2V0NA 4C3UA 2BTQA 1Y3CE 1OLUA 2BN4A 1M6VB 1MH9A 1W1UA 3ACBA 1DKMA 2GN1A 3FZYA 4RXMA 2OUIA 1P2TA 2X0KA 2ZRLA 3AC0A 3DYVA 2CXHA 1UAGA 3JQFA 4M8SA 5FQOA 3SXJA 3U80A 4KTTE 2WV9A 3SXUA 3F8TA 3VU1A 1M5UA 2WTUA 2FPIA 4PZUA 3PC2A 1F17A 2HT6A 2Q1SA 1I80A 3UOAB 3EBLA 1PAUA 1W49A 2AG8A 4EA9A 5DWVA 3GFVA 2BGTA 4I8XA 2VJBA 5E95A 3W9BA 2NUPB 3I05A 2XUGA 4RFLA 4YR9A 5T7BA 1V5FA 2PH3A 3ZVMA 2BH2A 4MW7A 3I2GA 3ELWA 3P0FA 4M89A 4EY4A 1QHSA 1G3IA 5FOVA 1YIOA 1MMFB 1A27A 1P8AA 1ZIYA 4Z7QB 3ZDEA 2ONKA 1PR2A 1K92A 2P91A 4A8JC 2P0EA 2BMWA 2FRVA 2GUGA 4V24A 3F4LA 1TEXA 2V6GA 1J9ZA 1U8TA 1ZITA 3UGJA 4TX1A 3HDQA 3ZDRA 5JCPA 4B7ZA 1XZQA 1IJFA 1OWMA 2H1WA 2FMKA 1UJNA 2XB2A 2GAAA 4EHLA 1ZVQA 1GUAA 1VKNA 4ILEA 4B2LA 3IIJA 5K1ZA 5JSQA 2O06A 3CLTC 2BLNA 4Z0NA 1E7QA 5EIHA 5FR2A 1NUTA 3JPWA 4X7PA 5DHTA 4X66B 1CEEA 3CY6A 3AFGA 2QUKA 2PANA 1SCUB 2YC4C 1T13A 3P2EA 3SN6A 2A59A 2R84A 4AJPA 3UA3A 4AZ0B 4R40A 3MIZA 3AKEA 4RVCA 2V74B 4RV4A 4XVRA 1FDVA 3QX7A 4IUYA 2XMRA 4S1PA 1U63A 3D02A 2P9HA 3ZGLA 3AF6A 1XT6A 3T3EA 1T43A 4ZVOA 1ZI9A 4RY9A 5G3YA 3MW8A 4L73A 4E4YA 3SWWA 5LA6A 1Y8AA 2B4RO 5BRAA 2MSDB 3G8YA 2ZBGA 4WXEA 1CFZA 1GNLA 1TA4A 4YP5A 4PCAA 3A6HA 3KKQA 5ITZA 2OM2A 2JEOA 3E9RA 5D5PA 1SIUA 1U3VA 2VWPA 3HNPA 4YRNA 3L4BC 1PQWA 4P82A 4Y9TA 2ZIFA 3HWSA 3V7FA 3VQTA 1CZLA 3UF0A 3VTZA 1S6YA 2WJWA 1SK8A 3AP1A 4JT2A 3IQZA 3SHOA 4GRDA 3VSAA 2H07A 4ZTBA 1D1TA 3E61A 3WLEA 1K08A 2QNIA 1TQ6A 2WKQA 1NJGA 5E7IA 3KYDA 4JITA 5B30A 5CK4A 1QGUB 5JMWA 1WXFA 3K31A 2L19A 3IBSA 4DJAA 4XWWA 4D26A 2QEQA 3ZU3A 2FY8A 3GQBB 4DJFC 4HR7A 1U1CA 1NP6A 1U99A 4WRRA 1ZH8A 1BFDA 4U7WA 4X90A 2X19A 3IAM6 4L6CA 4AZ3B 3CX8A 3ZK9A 3TUZC 1IAQA 2EOAA 2I2BA 1AKQA 1X94A 2Z2KA 1QP4A 4FN5A 2YVUA 5CFQA 3S1SA 2XMGA 3TFOA 4HPWA 1CZRA 1SN7A 2I7VA 4KVAA 4QEKA 4TKUA 3GFFA 4RAQA 5IS2A 2MSWA 4KE6A 2ENUA 1OY1A 5CA0B 5E7MA 1KFBB 1DL5A 2BCEA 3KXPA 5DSZA 3FLMA 3LGXA 3NTUA 5AHOA 4DL9A 3QE2A 1XCMA 3RUEA 5IYZA 5FHQA 1PD1A 2FH5B 4CXMA 1G5HA 2FMXA 1I5EA 4PNZA 2GA8A 4TRNA 2Y1XA 4K6CA 2JFWA 3AESA 1T9ZA 1IWOA 1ZGGA 1QYCA 1FDUA 1PJTA 3GFBA 2C3OA 3LXXA 3WX0A 1NUSA 5ALUA 1JEDA 1F2UA 2APJA 4BV9A 4Z3KA 1ZFNA 1T5SA 1WUKS 3JZIA 2Y68A 4C5CA 2VDKB 3K2QA 5ES3A 4ETMA 2VTBA 2XZLA 1DCTA 1THMA 2W4QA 3BJMA 3DBLA 5CLHA 3GT0A 4K9MA 5BN1A 3LF2A 1XP8A 5JRZA 4W5WA 3VH4A 1Z2DA 1RKBA 3R1IA 4JENA 4DNXA 3BFJA 3CZRA 5JAMA 3HXQA 5AJVB 3RBAA 1E7WA 5KC9A 1IXZA 3C3WA 3AJAA 4QOIA 4RZHA 4IJUA 4TLEA 5IG2A 4B7AA 3LCCA 3IO3A 3O94A 3QNWA 4AF7A 2VJQA 3V4LA 5CLFA 1ENZA 3ZXSA 3DFIA 4AY3A 3B53X 4QFCA 2P90A 2LR0A 3KOZA 5BMVB 2YKGA 4PSUA 1NPYA 4XOIA 2EF0A 3QKWA 1U28A 1BQ4A 2G72A 4OHUA 1WCXA 5CTJA 4N5DA 3LRTA 1VHQA 3BRQA 2IYZA 2R85A 4DEXA 1ZESA 1FLDA 1ZGAA 2H06A 1AKTA 2VATA 3O8QA 4M36A 3GROA 4JFRA 1K8XB 1HOXA 1U04A 4MVJI 4BBPA 5BWNA 3GJ8A 2B5VA 2PV7A 2VP2A 1U3GA 1JEQB 3O3NB 4JLMA 5FORA 3ZH2A 4CTJA 3KPWA 1AQJA 3O8RA 2D6FA 3UK1A 4DR4B 1DJOA 4DLBA 2FPPB 1TU0A 2ZRDA 4MTLA 4EFKA 5GOTA 5CNJA 3FFWA 2NU6A 3ZHTA 3L6UA 3AO0B 4QYIB 2I6UA 5FQNA 3NEJA 3O8OB 3G2MA 3WYNA 2C7OA 1SBTA 1A82A 3CVWA 1G3UA 4GRIA 4JZKA 4KFTA 1V5IA 4BVKA 4D4LA 3PNYA 1P6UA 2Q3FA 2CK3A 2WFLA 3WYGA 3G9QA 5HIKA 4GX5A 4Q3DA 1DIBA 3AXTA 5IBQA 2EJUA 3E8XA 5C37A 4L2IB 5IULC 4A0SA 1MFZA 1MTOA 3RAPR 2GBLA 3OQMA 1O4VA 1M6HA 2WILA 3E81A 4YJGA 3S2YA 1KO8A 1Q17A 4FWBA 2JFZA 3CZ9A 4YAFA 1ZGJA 1MW9X 1UADA 3KU1A 3ZQKA 4EJSA 3ELBA 2AR7A 2VDNB 2AMLA 2XNCA 1Y1LA 5AJZA 2QTWB 3WBBA 2XA2A 4BQFA 2AG1A 1RADA 3DQZA 4XYMA 5I7EA 2ZT7A 4M7WA 2PL9A 2QDKA 4IHAA 3RYIB 4MWCA 3R5FA 5HKBA 5ILOA 3ZG6A 2GBPA 2W6OA 2J9FB 3LFTA 1KWKA 4MUAA 1Y5IA 1I4EB 3DM5A 4ZEXA 1SU8A 1P17A 2IPLA 4GQIA 4A91A 3EDQA 1G21B 1J7JA 1PZXA 2ZFUA 4ZHSA 3DC7A 2P77A 4C0HA 4DGSA 4EELA 5KEIA 1E1RA 1SKBA 2O2ZA 2JGFA 2MMGA 4OYHA 5FP0A 1GGVA 1XPOA 3CJQA 1TU3A 1OBVA 1U3WA 1Y1QA 3L0OA 3CC8A 1CG6A 2IEZA 1OXMA 1SKYE 4K8OA 4JDPA 4F4IA 3ED1A 1X1CA 4HNRA 4I8DA 5E4TA 4G63A 3FPHA 1UMBA 2GXUA 4CMCA 2DPGA 3CR7A 1OV6A 4I5FA 3GEGA 4XH9B 3ZPXA 3GLGB 1K7FB 1RU3A 2BJWA 1VECA 3P96A 2ENWA 4MHSA 4ZAVA 2EX0A 5TQJA 3SFTA 3T1QA 1QQTA 3WXMA 1WBJB 2EEPA 2G5PA 4MQBA 2OBNA 4ZMRA 4M8LA 4DFDA 3KVOA 1WF3A 5E3JA 3FMGA 5DZSA 5IYZF 5JE8A 3WKDA 4DCPA 4G6ZA 2BGLA 4RF5A 4L4RA 3Q11A 3HB0A 4KQFA 1OAKA 5BN3A 5AHKA 5E7QA 3MJRA 1D2MA 3L8MA 1OWOA 3I12A 3DG9A 5B5SA 3NFYA 2QXYA 1T0PA 3W6PA 1LX6A 1X9GA 2I2DA 2OZLA 1XZCA 1N2OA 1K5GA 5LN1A 4N4AA 4MWGA 2C59A 2CL7X 3O4RA 4B3DA 1NONA 5DK6A 5EE1A 1P9NA 1UMCA 4GL2A 1Z37A 4RTMA 3M3DA 4XR4A 2I54A 3DR3A 1MD9A 2QL5A 3OZVA 1JFLA 2V55B 3EXFB 4FMCF 2DVMA 2GSWA 3LK6A 4Q03A 2JAQA 4W63A 2B1RA 4H0CA 4BNNA 4EUFA 2PGXA 3S1AB 3GVCA 3PB3A 3AJDA 4Z7JA 2SCUA 1JMYA 2X9GA 3G0GA 2JIDA 4BCCA 3MILA 4QASA 5C3MA 1A9ZA 4GECA 3ZBQA 3E53A 4ABYA 5DJ5A 1L9XA 1U2QA 2MYUA 2WEKA 5J5AA 1P2VA 4ZVUA 1LUAA 1U3TA 1IN8A 2GF9A 3MGCA 1CR2A 2AXQA 2I4NA 2Z5LA 1KR5A 2M1ZA 2XUOA 3UZUA 3KIPA 2ZJ0A 1TYBE 1EFAA 1QJ4A 2WJIA 2FEMA 1W0KD 2XNKA 3QV2A 4I50F 4ZQGA 5CVTA 3FPCA 4WADA 2FCAA 2P78A 1Y4SA 2CK3D 3DZIA 4YJHB 3UFBA 1I6LA 3NHWA 4MVJF 3S1LA 4O4LF 2ZE8A 4RC9A 2WSSD 4BASA 4D9BA 1W19A 1U8ZA 2W83A 2DTDA 1PGPA 2NAFA 2IX3A 3WL6A 1C3OB 2AN5A 3D5EA 3EVGA 2HPZA 3D64A 5A3RA 3B2EA 4FSXA 3DTVB 3DYBA 1O6FA 1SC4A 2HMVA 2HL6A 4DIEA 1QFSA 2ZI4A 2ZRGA 4OQZA 3B1XA 2QMOA 4UCXA 2IEDA 4IIGA 2FU5C 4FOSA 4PZLA 4HNAA 1HNNA 3I9JA 4AUNA 1AXEA 3DDUA 3EVNA 1USWA 3LVFO 5DX0A 3STVA 4TKVA 5JYDA 1CJUC 3CUVA 3EN0A 4C5BA 2F8SA 2H2WA 1N2IA 1JNYA 1Z0ZA 1SQGA 2HJ9A 2ID8A 3VTAA 2E85A 4D6PA 3NW9A 1N9GB 4IR7A 5C80A 2HZBA 5FI1B 3TLJA 1CP3A 4B6JA 4OG2A 5F4ZA 2BR5A 4RCVA 4ARAA 1YVRA 2VDVE 3K1YA 3B6MA 2TYSB 3L6BA 1KRHA 1KEZA 3Q5GA 4GMXA 5J2TF 5CFRA 2CHGA 1UM9A 4GX2A 3UGKA 3R5SA 1I36A 3TVYA 3NVDA 2CLMB 3FSEA 3PJGA 1L7BA 3IL2A 2DSNA 1DU4A 3RS0A 1U6JA 1OHHD 2YVKA 3MOSA 1IM5A 1BWPA 4DMKA 3LOUA 4WJZA 1E8DA 4ZVKA 1VFNA 5CBKA 1H3NA 1QUFA 3NBQA 5E4YA 3USZA 4BQPA 1K86A 2MYNA 1E3LA 4N0DA 5J2TA 5C8DA 5BY2A 2PWZA 5M34A 3RYHB 3VR5A 3MS2A 5IH3A 3WGGA 2PKRA 1X7ZB 4NTZA 2K6GA 4M0MA 3ZE2B 1SZJG 2VXBA 1MABA 3PCRB 2PWPA 4I5IA 4FEEA 3T61A 1XXHA 3ZTWA 5KVAA 1QRUA 2GZ3A 3P45A 2E4UA 2CXXA 4ND1A 5H4GA 3NOXA 4KN5A 3BMCA 3JS5A 3CH7A 4G9BA 2YYAA 2D5CA 2VZ8A 2HTFA 2HDWA 1IXYA 2XMBA 1F0YA 3PQCA 5MF6A 4BQIA 5ERYA 2BFMA 3ICWA 1YZ3A 3DPIA 1NMEA 4TVOA 5DTIA 3VNRA 1CUBA 2HWUA 1UBCA 3O8NA 3E8SA 1J49A 4BO4A 1NW6A 3RVSA 2XLBA 4YMUA 1I7LA 5KDOA 3GP8A 2MSLA 1O6BA 4E6PA 3MRXA 4Q9JA 3ZUPA 3KU4A 3IAEA 4H77A 4BRZA 5CFLA 2WSBA 5AUPB 3K1ZA 3H4TA 3GNTA 1PKXA 3I9V1 2VPIA 4HAUA 4RO0A 4ZVSA 5DI9A 1OXVA 1OTYA 1ZH0A 2JD2A 3HP7A 4G5YA 2PWBA 4RQAA 2DUUA 4RS3A 3EEYA 4ODIA 2XVXA 3K0AB 3PC6A 3JD3A 3QYFA 2OV3A 3PR1A 2Q3DA 1HDYA 4GUDA 3TNDA 4CV1A 1G0OA 2GLTA 4CQMB 4AYXA 4CKBB 3O2SB 3L7AA 4OIMA 4RETA 5TS3A 1A4RA 4PSAA 3OBBA 4XFDA 4EUKA 4UTZA 1KMIY 3BCSA 1CRWG 3SHWA 3AHGA 3AVVA 1AGNA 1Z5PA 3DMTA 5I5GA 3UMYA 4ZVVA 2C4MA 1I0LA 1TK2A 3EZLA 5H9VA 3RQSA 3M6UA 4R1QA 3W5AA 1RFLA 3UMFA 2P2DA 2QZPA 5EERA 4XI9A 2ATEA 4L8GA 2B0CA 5EGNA 4EY5A 3OZXA 1UPCA 3NEYA 2BSXA 2CVPA 1D2GA 1EM8A 1JJ7A 1UR5A 1YR7A 3IAAA 5AH0A 1XZKA 2VOJA 3P97A 4DYVA 4AURA 1XVAA 3FN4A 2FK7A 2VDMB 4U39A 4MKGA 5K6TA 4G8BA 4OHFA 4Y2QA 3EVDA 1H0RA 3Q4GA 3QPAA 2FAXA 5DCYA 5H81A 4C89A 4X85A 4O4HF 2R6AA 1WHSA 4L08A 1NXPA 2D13A 2OECA 1MRZA 1YBVA 1HKUA 1B8OA 3UJCA 4C06A 5A6SA 4G4SO 1X19A 2QN6A 1WU7A 4LKOA 1U7WA 2EFEB 2Z04A 1R6AA 4FFVA 1EHCA 4RH3A 2VPZA 2BM0A 3MT9A 3JWJA 2R97A 3FLAA 5KOJB 5HJ5A 4D4JA 5CA1A 1T5LA 1KYVA 1YJBA 2VP0A 4Z0HO 2Z2JA 5B37A 1KOLA 4AO6A 2XT9A 3BWEA 3GMIA 2YL2A 3HEAA 3WGHA 3TIXB 1L7EA 2FMIA 3LD9A 3T12A 5C5EA 5F98A 2F3QA 1HDZA 3I2YX 1Z8HA 1DKPA 4WY2A 1Q1GA 4AXXA 3LPLA 2WG1A 3PTAA 4ROTA 2WWXA 4TLCA 5EMKA 4GEKA 2Q1WA 3BJIC 2XODA 3NDIA 4CIBA 1RIFA 2PBFA 1M2OA 1L7VC 3FOAA 3UAGA 1XTBA 3NAQA 4B3JA 3ZS9A 1M10A 4RWZA 2OHFA 4ZQEA 4U7FA 5HW0A 2NV6A 5LLSA 1Z3CA 5KQPA 2C7GA 3BEDA 3BIFA 4AS1A 1ZMTA 4BL5A 1Z88A 1WCIA 5KX5A 1HDRA 3K15A 1BDJA 5FO0A 1RXVA 2O8BB 1OZFA 3OEHD 1L9KA 2XVMA 1N6NA 1I33A 3U5ZB 3RWMB 4OBBA 5DHSA 3RH0A 3W1VA 2CJWA 4JYBA 1QWSA 2QLTA 4DCOA 5DM1A 2VC2B 3X1XA 4E2XA 1XFDA 5F1KA 4ERXA 4GT1A 1BD4A 2DP4E 3Q8MA 1QKIA 1U31A 5JAOA 1ENPA 1NI4A 4Y6LA 5JAIA 1M34B 4EPTA 4G0YA 5I9SA 4ND4A 4BVBA 1K5DA 4YWJA 3V32A 3GRPA 1CW2B 3DDWA 5CH8A 5BSVA 4CL2A 3O82A 4R69A 2OK7A 2DX7A 4BFWA 4C7VA 2I3BA 2ZWOA 1P5FA 3OD1A 3EUFA 1V3TA 3D81A 2Y1LA 1U2DC 4DUYB 3KZKA 1TKAA 2EJVA 3BM5A 5JDIC 1TTTA 4U0JA 3EDMA 4S12A 1U1EA 2P6UA 3IEVA 4X97A 4BMSA 1QLHA 3N6VA 4CM1A 1T3GA 1WDMA 2QXUA 3D5QA 4BB0A 1P1FA 4OUKX 4ETNA 3KQLA 4BNXA 3BIWA 2EFJA 3F6PA 3JR7A 3H9EO 3MAGA 4N9QA 1EX6A 4MUKA 1I1NA 1VHDA 3FCCA 2QJOA 3KWLA 4QXRA 3SMVA 3VHXA 2C9ZA 3KD2A 4E1VA 2VP5A 2VHJA 5CJPA 3FNGA 2EKQA 4Q1DA 1KRWA 4BTLA 5CD9A 1PS0A 2JJ2D 3WI7A 3WKCA 1VMAA 2N9UA 2ORED 5M7EA 1AUVA 2I8LA 5MN4A 1FFDA 3BAFA 4MV0A 3TLXA 4HRVA 5K01A 1KFJB 4JI6B 1X80B 3C1OA 2XR1A 4NYJR 5FT9A 5G4LA 3LKDA 2O59A 1QWOA 3AM5A 2CJXA 1VSVA 3TCXB 1LQUA 4OYYA 2C4TA 1QG0A 3FPAA 1ECCA 4XCQA 1ZRNA 2QUAA 4FCWA 4YAOA 4Z0PA 3ER6A 2OHHA 4BNWA 2Q2NA 4Q3EA 4LN1A 4MQFA 4A27A 1I6KA 1U0EA 1SB8A 1K7CA 1WDWB 4IIDA 4OB7A 1KO7A 2WJYA 4LDRA 3RK0A 2FLVA 2DY1A 4HK4A 1JXOA 2ORVA 2YV4A 1T1EA 2M6KA 3PGKA 5BNIA 5BWOA 1FF9A 2Y1EA 3HB5X 1UK7A 1XEXB 2A5YB 2EJWA 3BCHA 3NNDA 3TQRA 4CFSA 4MNTA 3RVOA 4HAYA 2MTBA 1R50A 4X20B 2YHBA 2HIHA 1Y6QA 1BAPA 2HRZA 3TQIA 3DC2A 2ZQ5A 4BFZA 1KSJA 3QOWA 4QUIA 2F3RA 2ZUUA 4JLPA 3GPDG 5GADl 3FTFA 1YR6A 3BL8A 1A76A 3PUZA 3JZAA 3TJRA 3ERCA 2GEKA 2JFHA 1ZOPA 4X3OA 3REQA 1K3UB 1TZKA 1ODFA 3U4AA 4YPOA 4UCQA 5C1BA 1PZNA 3F67A 2ZBEA 5GINE 1MC5A 2ZZKA 1TL7C 4RV9A 1BVYF 5REQA 3DD1A 5IEJA 1E64A 5G0VA 3MRVA 2WSLA 3BJZA 2A67A 3B6JA 1IBKB 1X1AA 2ZEJA 4M7OA 4NJMA 2QRLA 2YV5A 3IMCA 4QFDA 5ECWA 3ZIAA 4JWTA 4AP6A 1FPQA 3LV8A 1WB5A 3KE9A 1IH8A 1JA1A 2JGJA 3AY3A 4TZTA 2Z95A 3HHPA 4ZV7A 5DWQA 4AJ2A 4BJ6A 4LF6B 3ES9A 1N2ZA 4IKPA 3HKDA 4AZVA 3T99A 4Y1FA 4KUHA 2WWIA 3UK0A 2IXTA 4AT1A 2XQIA 4RTJA 4QTXA 4JY7A 2XCQA 2AW5A 1IJEA 1C7JA 3GYGA 4PW0A 1CQZA 2QR5A 2O2DA 2JFXA 3BFKA 3TTUA 3IAHA 3EUEA 2R8XA 4INJA 3EXAA 1EI9A 4QODA 3NWBA 3HN2A 1BXGA 3PSHA 1NQXA 1SBIA 2PS0A 2VQ6A 1C9DB 1S2NA 3QFFA 2O5EA 4HTAA 4EW1A 4LKRA 3F6YA 4WZAE 1IY8A 3AMVA 1O58A 4GZ5A 1SVNA 2C3UA 5JRDS 3I4FA 2XTMA 3CCCA 1IXRC 1FSFA 3KQSA 1YFJA 1PSZA 4N3AA 3A70A 4I1YA 1E9VA 4QREA 4URZR 2YYYA 4F4HA 5CDGA 3H5RA 1TNDA 3KAJA 4E15A 1TJ5A 4TN5A 3GEDA 5EKUA 4TL7A 4AG3A 1JWLA 1DJQA 3KQMA 3EPHA 3K9QO 3BOSA 1M8GA 1VKHA 4H4EA 2L18A 2G0AA 2R96A 1ENOA 4PPYA 3C4QA 4U3JB 4KBYA 4FW9A 3A14A 1NMSA 3OG9A 1M7HA 3OICA 1COWD 1CUUA 2AK3A 2BOVA 2OAGA 3F6CA 2I2XB 4NEQA 4WDRA 3VPGA 2B7CA 1B2RA 2Q28A 5CIWA 4C0KA 1MV5A 3OH8A 2BHSA 5CX1B 2G77B 4HQOA 2FF5A 1BN7A 1NQVA 1VKJA 2VNSA 3AF0A 1DFHA 3D6HA 2P69A 3EIEA 5COAA 2AEFA 1QHNA 3QOXA 4IJQA 4BVEA 4UNRA 4KRFA 3VRHA 1YDHA 1ZCFA 3ZDXB 3ZWKA 1YQEA 2QN7A 3C14C 3PCTA 4Y7CA 4DR6B 2BEVB 5EJ7A 2I4MA 1U2RA 1EKXA 2PT6A 4CLRA 2R7KA 4MUBA 1E79A 5H0IA 3WSWA 4DWWA 4Q4JA 4GRAA 4JYAB 1MENA 2QVCA 1F06A 4MR7A 4MEAA 4FUQA 3QXHA 4G5RA 4B3CA 1JFRA 5JCJA 1FJGB 1X8KA 1G4AE 1PBTA 2CFOA 3ORRA 1QKKA 1TZMA 2AW3A 1YE3A 2DE0X 2R6CA 1XK7A 3CLUC 3L7JA 1E2MA 3GJRA 4ZP1A 4KXWA 5FPHA 1XO1A 3D7LA 3UNXA 3DHWC 4ZO6A 1LPAB 4JGBA 1P3DA 2XUZA 4J9UE 4B31A 3K35A 5EJ6A 1ZHFA 5BYBA 3D6AA 4HWRA 2V7TA 1X1TA 3FVWA 1USUA 5A5EA 2HY7A 2VZ0A 3KOWA 4F9FA 3UBTA 2IF0A 3QMWA 4G1MB 1RI4A 3HGMA 3V42A 1CSEE 1I94B 4E5PA 1F1BA 2P5YA 4CQLA 1JHAA 4F56A 3LK7A 5JC8A 3SLGA 4FHEA 3HVIA 1F51E 1XU4A 3SDBA 1S2DA 2Q7XA 1A69A 1SVOA 4M1KA 4XJSA 3UCXA 3G9ZA 2QT9A 3F5FA 3EIHA 1A4IA 1KP3A 2OAEA 2Z8ZA 1XUOA 3A32A 4PINA 3E5RA 3RJ5A 3TD9A 1L5MA 3EYAA 5DIZA 1F6BA 1CUGA 2B99A 2OLEA 4DRYA 3AIKA 4ENTA 5K7SA 2GJKA 1PRYA 2C57A 3RTDA 2L2QA 3K6JA 5KNBH 2B3DA 1W52X 4Z4HA 2AN3A 3UT0A 5A62A 1B00A 3CB4A 1KXJA 3HJBA 4IV5A 1KDPA 4RK7A 3RD5A 4DDWA 2KBFA 2X8LA 2IOFK 4QECA 1U98A 1L7DA 1ULHA 3A6FA 1EJ0A 3FD8A 1T1JA 3O95A 2I67A 5GVRA 1O95C 3FAZA 3TLYA 1EP3B 1NRXA 1T2VA 3IQHX 4FI3F 1LFDB 2CWDA 4IDNA 4MVCA 3GL9A 2FSHA 1DDOA 4YCCA 1BRMA 1SBQA 3RSHA 1GTL1 4YPVA 1KC1A 1KOJA 1RHMA 3S27A 2GTPA 4ARZA 3UJDA 4JR0A 5TMBA 2YVLA 3V4OA 4A6PA 4LJLA 3WLPA 1Y1PA 4QEZA 1K7XB 4R0NA 13PKA 2I5PO 3TLGB 1T5HX 1GTJ1 1PVOA 3QEMB 5ALKA 1I4DD 4UU1A 5DGHA 2WUWE 2W37A 5F7JA 1CQIB 4DHEA 5FYQA 5FYDA 5CGZA 3A25A 4EQ6A 1T1SA 1U0GA 2AVNA 4JELA 5C9ZA 3QBDA 1U1GA 4P80A 1CUIA 3WQHA 1A2KC 1N2EA 4WBNF 1O77A 5BSHA 1H2XA 4W8HA 1NI3A 4UVDA 4UUAA 5FWNA 2EJBA 4BNGA 1E79D 3G8BA 5F51A 1VLLA 5DBOA 3STUA 1CJTC 3E3NA 3TRFA 3LP5A 1P60A 3Q7RA 3AR5A 4RY0A 4F11A 4G1UC 1F8XA 5DTQA 5REQB 3STWA 3V55A 4XUCA 2OBBA 3I2KA 3H13A 4H16A 4XCXA 1SUIA 2CBGA 1OC2A 3DPSA 4XB6B 3ZY6A 2YH2A 2CLIB 4FI3C 4HYYA 4X8OA 2NMVA 3P9CA 3FMVA 4URXR 3D1LA 1LWOA 1Z25A 2Q4DA 4DE5A 4DLNA 2R6GA 2C2GA 1TOAA 3K71B 2CVZA 2HRRA 1CDDA 2J5XA 3C98A 3WNQA 5JNLA 5FTNA 5JZBA 3EPKA 1KZGB 4JU8A 3LKZA 1W25A 1MUUA 5DTMA 2VK4A 4X20A 4PC1A 4C7KA 1M5TA 1XCGB 2JCVA 4MIOA 2X2EA 1DUIA 4CCWA 1FS5A 8ADHA 1G63A 3AWDA 3FLBA 4ZQFA 3I32A 1U9YA 1ZI8A 2GO7A 2QUIA 3N8NA 2GWRA 3N2ZB 1GPBA 3GEBA 4IFTA 4OPMA 4C14A 5KSOA 3H75A 2MINA 2VPWA 3PC3A 3LT1A 4UOQA 1DQPA 4NP6A 5FD8A 5FTKA 1QIFA 2F43A 4IZ6A 2C31A 3P8ZA 3T5MA 2J6CA 5E8JA 2P3LA 3H4IA 3KQQA 4YUAA 5HKAA 1Y8ZA 4OJYA 4GPAA 3N7UA 1Z6XA 1M0SA 1XVIA 3FPEA 4QOSA 4MWBA 4M99A 2DGDA 2GK4A 3LZCA 4JGIA 4Q3LA 3ODGA 2IEAA 1WSWA 3H19A 5EUQB 2EKZA 1J8VA 4PGMA 4K9PA 2GOYA 3QITA 4HNTA 2GWHA 2XTNA 3EEBA 3EIWA 3L8GA 1S8AA 1EWKA 3OMLA 2H92A 4HATA 2WY2D 3HCBA 4ALNA 4EX7A 1QH8A 3FY4A 3PD1A 4EG1A 1IN4A 2FR1A 4JLDA 4FIDA 2QWXA 2EFHB 3TZEA 3NHUA 3AWIA 1ZA1A 4K88A 1G8AA 3TIVA 1H2ZA 2OD2A 2ZUVA 4DDKA 5SY9A 3JWHA 1KNQA 2HV9A 1KP2A 3CW8X 1KFCB 3QBTA 5AI9A 4JVMA 5FBHA 2X4IA 2D2EA 3HLKA 1GL7A 2PPLA 5IAJA 1S8NA 3DMTC 4HLUC 3BXXA 1XZIA 2XRYA 1T9AA 4DA8A 3OZTA 4ITUA 4HMPA 2DWPA 4K9NA 4KWHA 3AB8A 1M6NA 1XHFA 1GPLA 5E6SA 1VBNA 2WG2A 1HMPA 3COWA 4GO1A 3PE6A 1JHZA 3I45A 4RGQA 3NXKA 8LDHA 3IERA 3D1JA 2AOTA 2X5JO 4BQNA 3DAHA 1YJAA 3LYLA 1X70A 1TM7E 2L69A 3CYFA 3HXOA 3BILA 2X0EA 4MKXA 4C20A 3JQCA 4PIPA 2BR3A 2PLNA 4JEUA 1DSSG 4YCJA 5EXTA 2GXAA 1XIVA 1WMBA 2EV9A 3JYLA 5FEUA 1CUAA 1YR9A 3GLTA 5EXSA 5B4VA 3TG2A 1V11B 4G23A 3HDYA 4HB0A 1JSXA 2XQVA 2W2LD 3EAQA 4MUJA 2GZMA 4YMVA 1VJDA 3ZZNA 4JFAA 3FETA 3A1UA 3I53A 1JR3E 3TZHA 1BQEA 1VG0B 3K70C 4IVRA 3UW1A 1FLNA 2GYUA 3DYIA 2O8EA 1P45A 1T35A 3CUSA 3KPVA 4D4HA 3DDOA 3RUPA 4M8IA 1G5TA 4KH1A 5EZ5A 3GFSA 2QPTA 3J81A 1LSUA 1Z5VA 4J90A 1ONNA 2Z2YA 4OHYA 1GKIA 4GLOA 4YCDA 3WGVA 4DLYA 1LQTA 1PL6A 4KZKA 4QQFA 3ZNOA 2R44A 2ZI3A 1K4YA 4NZYA 4FFOA 1A95A 3D0QA 3G2OA 2WB4A 4J94A 3CRMA 4K46A 2VDQB 1GSOA 4CCYB 4ZT6A 1H6DA 1ORIA 1TZCA 3FPGA 4ZV4A 5B7GA 4R9SA 4XTCS 1J2RA 3IUPA 1G8JA 1DE0A 2H8KA 3CLHA 3GOQA 3IDOA 3ADKA 3QKRA 4K2HA 3S8YA 1SOMA 4HVCA 1XJ5A 4X95A 1IN6A 1SBNE 5JPDA 3R6LA 4OJQA 3DAOA 4WCFB 3HBNA 2QRQA 4NPCA 4MICA 5J3JA 1GRNA 4N7RA 1Q2XA 2G1UA 2P9YA 1ZONA 2VG8A 3F0TA 3FMPB 1D1QA 1SQ6A 1VI6A 1JDNA 2A9RA 2GEJA 2RGWA 4B3FX 2AG6A 4HZIA 3I0MA 3G0IA 5ECDA 3K1JA 4YRAA 2A84A 5G0WA 1OJ7A 4J8PA 4KYUA 2OB2A 1TF5A 3EQ2A 4C2UA 1Q6YA 5A6SB 1AN0A 1B6GA 2JLQA 2RGYA 1W8DA 3GA0A 4XASA 2V7QA 3JW8A 1R8SA 5B6IA 4Q7KA 2QW0X 2SNIE 4J7CA 1DTEA 1RM4A 3CN7A 4FJ0A 3PWSA 3HACA 3N74A 1H2EA 2XMZA 3F5SA 5EQDA 5CXQA 4ETIA 3OLCX 3ZWQA 2XQGA 4IO1A 4KNVA 3KVRA 4KITB 1MIHA 4M1MA 4UREA 4UFOA 1XQ1A 2JK1A 4E22A 1E0JA 1EH5A 3OQ1A 3PLNA 3Q85A 5B1SA 1DI0A 4IIEA 4QHYA 1HF3A 4YO7A 1N5JA 2Z8XA 7ABPA 1L7QA 1P2GA 4DDUA 2DXIA 4EJSC 1KSGA 4MDHA 3KD3A 4G01B 1N8SA 3NEPX 2F17A 5CPFA 2FHSA 1MHTA 3WKBA 1T0JB 5ENDA 1S8FA 1MDBA 1IE3A 3ZDDA 1SPXA 3GH3A 1RPAA 1GRRA 2XNJA 1O5TA 2ASEA 3BF7A 3CO0S 3V1YA 4CQMA 3BIXA 1E2DA 5LP6B 4EFMA 3H5VA 5HSGA 5F64A 3TUJC 4A26A 3K0AA 5LZ2A 4YMHA 2ACWA 2FZ4A 4DYDA 2QG6A 4GE0A 1W4CA 4Q9IA 3PUIA 4C7XA 1LWNA 3ZIUA 1WB6A 2PUAA 4PYQA 3TO5A 4YAKA 3O8BA 3K70D 1V95A 2ECOA 2JIOA 1HNZB 4KVGA 3DP7A 2JGNA 3K9FC 3EG9A 3AKZA 3G9XA 2ODWA 4LOKA 1U65A 2ZBDA 5FUVA 1PJ3A 1VCHA 2PMKA 4J1NA 5B55A 4REOA 3CVVA 3IMEA 2YXBA 4F71A 3WS7A 4FVTA 1Q7RA 3PHCA 1I24A 2IUSA 1KIFA 3IP1A 1EE2A 2C84A 1Z8DA 2JLBA 3FTDA 2JAXA 4YAUA 1KAQA 4JIGA 1CY0A 1GDHA 2P9CA 2FEPA 4JVLA 4N5MA 2VUSA 1L5SA 1C9MA 3D6TB 1HT1E 3KJZA 4BMYA 3BORA 4MDFA 1X8JA 2OA0A 1QHEA 1Z5ZA 3LC7O 5A2GA 1EK0A 2HGZA 5D3MA 2RJOA 2CDCA 4NBWA 2ECFA 4IMPA 2C95A 1M73E 2RGCA 4TTSA 1MRNA 3ZZMA 3TZQA 3MD0A 5TLSA 2JF0A 4D3YA 4RGVA 4IBOA 5AXBA 3CF0A 2J0UB 4EI2A 1VL1A 4XWAA 3IP7A 2B37A 2EXXA 2HN9A 3ZU5A 2VUUA 3R7SA 2DUNA 3CX3A 5IT0A 2VBCA 4KE8A 2P41A 1ZN7A 2NZJA 4BUZA 2C42A 3HU3A 4ENVA 3HCFA 3ROKA 2CL5A 1EMDA 5AKGA 2M2IA 3R9XA 1IN1A 4OHRA 4QPPA 1RLOA 2DPHA 1JG7A 3TE7A 4GI3A 1DKQA 4EO4A 1TVEA 1XAGA 1RQGA 3A7DA 2AOUB 3E58A 4LY6A 3AI2A 4PC6A 4KDEA 1H9AA 2DKOA 2D1YA 3AVOA 1PJLA 5DYGA 3O2QB 3FSGA 1WB4A 2WQZA 5ALSA 3WLQA 3FZEA 4R68A 5DMXA 1YQTA 5EJAA 3L7BA 1C9YA 1FNSA 1YJ8A 1QRTA 8OHMA 1N5KA 5KTRA 5TE9A 1DAIA 2C4NA 4HAWA 2ZWPA 2UZAA 2AS0A 4UUOA 1Q1BA 3ND5A 2QQGA 2H4ZA 1U6IA 2Z1DA 3FOCA 3N3BC 3ZGNA 3A2MA 4XWOA 3ACDA 2DU8A 2D7JA 2FR0A 2C5HA 2PS3A 2ZYVX 3PDIB 5AIBA 5CCEA 1MC1A 1ZCJA 2C4WA 2WT4A 4OXIA 3M49A 1P91A 3BWCA 5DI3B 3T7CA 3HFGA 4UJ3A 5FUYA 3QLJA 5LYJA 2X1MA 2XYGA 3QVUA 1JTFA 1XYYA 3W8EA 2PJDA 1ZN2A 1Z8NA 2OQRA 2XMPA 2BZ0A 4A2PA 2HF2A 4ZODA 2AZTA 1EGHA 1PTJC 1QHIA 1QMPA 3R0IA 1WPGA 4I66A 5TS2A 3GXBA 2WUVA 1N2CE 1C3OA 2BFCA 3PRHA 4UVEA 2A5JA 3LAWA 4YA6A 3LW8A 4CUZA 4W4TA 2W4MA 2X9LA 1NZJA 4LXGA 3QPUA 3VR3D 1O97D 1GZ5A 4HADA 1I32A 4BMVA 4EB6A 3N6RA 4PYIA 5KAPA 1PQYA 3IV9A 3L4SO 4E5MA 1MORA 1P7WA 4FFBA 4LE2A 4QU5A 4PU0A 4B81A 3CEHA 2HMTA 3NHAA 2VF2A 3GLGE 2IE8A 1HUQA 1DO2A 3B78A 1AMNA 1G5QA 1S9DA 2PL1A 3D2LA 3WGZA 1NYLA 4JJIA 4E5SA 5JSUA 5LMNB 4GM1A 3SJ7A 1I13A 2HO5A 2QSZA 3DHNA 2ZYGA 4DQLA 3QWAA 4CQNA 2D5LA 2HXYA 3UKJA 2CB9A 4GD3Q 4JA2A 5HYVA 5AK0A 5AOBA 4BYGA 4JJ7A 2FTKE 4XB2A 4CLOB 4JBLA 4OHWA 5LYJB 2QVLA 3IKLA 3ULKA 3USCS 4AL4A 4EK9A 2HB6A 1QZZA 3PDIA 4KRYA 4G41A 1SC9A 1SULA 2PZ8A 4TUYB 1GGKA 3GLHB 4UCWA 4FLMA 2B7LA 2A88A 2GZ2A 4BQOA 5TC4A 1NLYA 1P8JA 3ROPA 1JTVA 4C0AC 5FBVB 4BZZA 2J85A 1N5IA 3EQ7A 3JWPA 1GPUA 2RBEA 1YJ5A 1IBCA 1Z62A 4G5QA 5D84A 3HA3A 5EPEA 4IMIB 3KETA 2G76A 1B8NA 2C0PA 3LO8A 4PLVA 1UJ2A 4D8XA 5BWCA 5HRAA 1IC6A 2RI0A 2VTDA 3FRJA 4JLBA 3WWPA 4DBLE 2FG6C 2X2OA 5T41A 2VNIA 2IU0A 3MCAA 3R5XA 3D0KA 5HCIA 3WV4A 1B76A 1ECBA 3K4HA 4RK0A 3S3TA 3IV6A 4NCXA 4Y6GB 1XCOA 2VF5X 5F2KA 4KO4S 3WAKA 1NG9A 2IV7A 4HQNA 5SYMA 4CR7A 5A0TA 1ZUWA 4ZVLA 3MNFA 3G8CA 4TTQA 4E5KA 3IA7A 2HPVA 1BWSA 1UBJS 3AJ9A 3IQIX 3OI7A 5AOAA 3MMZA 2PXHA 2JW5A 1D7AA 4O4HB 1E5DA 3HUFA 3P0HA 3FHJA 1NASA 1J0BA 3BXHA 4LJYA 3IOYA 2IZ1A 2V6FA 4JGGA 3IP6A 2W11A 1XK6A 3IKMB 3LBHA 5DXAA 4ZVPA 5L7YA 2VDJA 4GQBA 2Q4BA 3ESZA 4US1R 2FSUA 5TVGA 1GVHA 1PGQA 5G1NA 4L0QA 1E61A 1GU1A 4WZZA 1U5BB 3JRNA 1G21A 3V8NA 1J7KA 2O48X 1ZOOA 3BWBA 4OXRA 3IMKA 4KHZA 4TLLB 5ADHA 1C7QA 4HB4A 2XUJA 3QG5A 5A1TA 2RARA 4OLJA 2GASA 4DJ5X 4YJFB 4MKHA 3NHKA 4ALMA 5ER6A 5FOWA 1JR3D 2DECA 1ZW6A 3WTCA 4N12A 4ZO4A 4FKZA 4RK4A 1Y33E 1FMTA 3IP9A 4J43A 5DTEA 3U61B 4R2WA 2FN9A 2W7TA 3FFTA 4BE9A 4EL0A 4BJHB 4ND6A 4HPJB 3IQXA 5EWMA 2H59A 4OP2A 2WSIA 4XFJA 3WB2A 4G56A 4IH1A 2NPFA 2HRCA 3HO1A 3HRHA 4GWGA 4WT7A 1K89A 4YACA 4EYKA 1TMYA 3VDXA 4YMGA 5F33A 3DOEA 2V03A 5FHRA 1R88A 3LRPA 4ZAFA 5JMPA 3SXPA 3ZV5A 4QVGA 3QKSB 3F46A 4NCBA 1C3JA 2GGSA 1TRKA 3VKVA 5HTOA 3G0HA 1B43A 4BOYA 4A8HA 1IY2A 3ZWBA 2CHVA 4YB8A 5BVGB 5M5BA 2J9GA 1TEVA 3JVEA 3GVPA 5TDHA 2A1IA 3K0CA 1JEQA 2KE5A 4ZXFA 1G6Q1 1FB5A 4L8VA 5G0SA 5T8KA 2WYHA 2Y1OA 3IRVA 1P2UA 4DC1A 4I5DA 4CIVA 1RQ7A 1J97A 2JNWA 2QAJA 5I7OA 3ZDQA 3CVJA 3I6QA 4PXAA 1AS2A 1MA0A 2PL5A 1ONOA 4FU0A 2ZAMA 4FZ5A 2LXNA 1KVUA 5TPWA 2G9NA 1D03A 1AUXA 3WMEA 2KMLA 3ZZUA 2OQIA 1S1MA 3CLUD 4IIJF 5DGCA 2VWQA 5BMVA 4N03A 4P3PA 2AZMA 2PRYA 1CUEA 1Z7EA 5CA1F 3KKLA 2MYTA 2C83A 4MVWA 4WNAA 3TJMA 2GM5A 2QLJA 4I1VA 1RQRA 3GRCA 2P9GA 3KQUA 1JIIA 3B12A 4Z7NB 3MAAC 3OFJA 4OP1A 4CCAA 4K0RA 5B7NA 1BX0A 2WD8A 3ENWA 1YJCA 3JD1A 3KLOA 3RBZA 1H94A 5E6RA 1TC2A 1WE2A 4I8IA 1TB4A 5K4GA 3B51X 2BGMA 4BLUA 2WIKA 1BDBA 4G26A 1XDGA 4RA9B 4U7TB 5G4KB 1BJRE 1B3BA 3AHFA 4HX2A 4UNIA 3I1IA 1Q21A 3JAWB 3KDSE 2QRJA 1UJBA 4M7RA 2XMSA 1JLLB 5CT4A 3MWEA 3RC8A 4B6EA 3Q41A 1WO8A 3ZCXA 3ER8A 3MWYW 3L1JA 4N5NA 1HMYA 3BC1A 3NC4A 5LC1A 1QHXA 1QO0A 1VM6A 5H1YA 1IK4A 2A94A 2OGWA 4GM4A 4O5OA 4OAOA 3UJ6A 2IIPA 3U09A 4L51A 1S2IA 2VVTA 4MITA 3R0ZA 1NX6A 3GJZA 4OV6B 1CR4A 3IRUA 5AVTA 5HS6A 1WWKA 2IXDA 1M6YA 1Y3HA 4PO3X 2X77A 1M0EA 2HMYB 1H22A 1JFFA 1OMOA 2QN3A 4GPD1 2UYGA 1WSAA 3UQYS 4FDAA 4BO0A 4DIBA 5JH7A 4YV7A 4LYYA 3OT4A 4AAYA 2G71A 5A02A 1EUDA 4N6OA 4JHXA 2A9PA 4EO7A 2BF7A 3C48A 3ZYCA 3L8ZA 2VSOA 3S2GA 4BLOA 1RQLA 1OXBB 4NMHA 2Q45A 3ESRA 3EQ9A 3KVVA 2CLFB 2QZ9A 4HQFA 1QTRA 4RZQA 2A9QA 3ZXIA 4RPHA 5IKOA 4D9MA 3SC2B 3RRYA 5AUQA 1JHYA 1RVV1 4GNKA 2XBMA 2AOTB 2CJFA 5LXTF 2WIJA 4ZYWA 2ZS7A 2WF8A 4TV8A 2O0HA 1QU2A 3AOGA 3OU6A 5CVDA 2IPMA 3AR4A 5FLYA 2ZRFA 4RL6A 1UZNA 1UWKA 2LZ0A 1KQ3A 3O1IC 3T9CA 2QVYX 1E0SA 3E0QA 3TD2A 4OHXA 4CL3A 4DIKA 3WZMA 5D5QA 5I8PA 3IQDB 5BURA 4RLFA 1GZVA 4RVDA 4ZAZA 3OIGA 4HAOA 4M1EA 5F76A 1JRLA 2AHRA 1XE3A 3B9RA 4AJNA 2GBGA 4QE3A 5JJKA 1KJZA 1G55A 1W88B 3T3GA 5E9AA 1BJKA 4FMCB 5C3UA 5HR5A 4YP9A 4LAFA 4E03A 4Z8XA 1A72A 4EGSA 5GVSA 1JR6A 1RYFA 2VP9A 1PBNA 2Y0BA 2YZKA 1S96A 2HCJB 5L3RA 2P7IA 4DR2B 1Z28A 1UDRA 3C3BA 1X74A 4FDTA 2NGRA 4I4NA 3KL2A 3ZY2A 2VJOA 3DKIA 1U7TA 1ZQ1A 2IZOA 3CKYA 4RLHA 1YQGA 4U2FA 5A3VA 3WRWA 3QK7A 4F8JA 4WINA 4CV2A 3K6SB 1SUFA 1T5TA 1J39A 1Q15A 2IPNA 4REQA 2I3DA 5IPFA 2IRWA 1R7RA 3A3OA 3IQFA 4A36A 4DV5B 3TTTA 1FVXA 1UMKA 4NQZA 4BNMA 1EFRA 4OHZA 2C9BA 1N0UA 3E9CA 3F9RA 4EPRA 2CV2A 2VKTA 4QYXA 1CY6A 7YASA 1LSSA 1FRQA 1VKOA 5BQXA 1MB0A 2B9VA 4JKIA 3TRHA 2HTEA 2HLNA 3HCOA 3EG5A 3K7EA 4Z4GA 1T2NA 4ZO8A 3JR3A 2GPNA 3RQIA 3UMSA 4KNYA 2W6CX 2JLWA 3DDNA 4RSGA 1U7PA 4BFVA 3AONB 1U8YA 3K6RA 3U4MA 4HRYA 4CLDA 2I34A 4BE4A 4UUNA 1SOVA 1J4AA 4A8JA 1IOWA 3L02A 1UJ6A 1SD2A 2YWHA 1FW8A 2P5SA 3IE1A 3UAOA 3RS9A 2CCKA 4FEGA 2CXUA 2Z9CA 3L7OA 1HGXA 3OC0A 2X8WA 4G0XA 1E63A 2ZYWX 3BBLA 3N2LA 4UM7A 3ZHUA 4F45A 1M2KA 3TBFA 5C1DA 3LWDA 3BHNA 2XKKA 4EG8A 1XP5A 1R9GA 2P5UA 2WTAA 2P27A 3AETB 3UJHA 1L6IA 3VH3A 1XAJA 3DEHA 2X86A 3IEKA 4N8EA 4OHVA 3E15A 1DV1A 4OQPA 5DM4A 6NULA 1Q1AA 4HH1A 5JADA 2H1HA 2ORWA 4G0VA 3SC3A 5BV7A 3R75A 1NDUA 3HY3A 4R2HA 4LXIA 1ZAKA 4IVQA 3IH5A 4TSFD 5DU2A 3KWFA 3CEAA 4TSRA 3AP3A 5IDVA 4EY7A 2J08A 4LGCA 5EXEA 1EE1A 1FQKA 4ZO7A 1F0KA 1M72A 4JSRA 1LTHR 2DR3A 2PUTA 3N0RA 5F1OA 4QWMA 3RE1A 4JA0A 4MCHA 2YHIA 5EMLA 3UOWA 3TVTA 4B3GA 1CZKA 1V4BA 2VSYA 2XDAA 2OBLA 2GZ1A 2UVDA 3ADPA 4GL4A 4MS3B 4DIFA 1Z4MA 2ZE7A 1V7CA 3LKVA 3W79A 1DX9A 3BXZA 3KSDO 3PDCA 5HUHA 1QZ3A 1YL6A 3UFXB 4W5QA 3G85A 4LV8B 2N47A 5CJ2A 1RFGE 5HNKA 2ZZMA 4GPTA 5C18A 1RPJA 4NOJA 4AY6A 4HKTA 3GRVA 3MGAA 3OZEA 4ZGGA 4ZOQI 1NNSA 4TQGA 1JPJA 4D44A 5BSUA 2MSNA 3LZ6A 3NVMB 4KFRA 3VAYA 4LTNA 2G36A 5K3BA 3N2GA 2YIJA 5K3CA 5B1EA 3QE0A 2PKXA 2A1TS 2H0AA 2ZPUA 4Y0AA 2PZJA 1YMUA 3NUQA 2H1IA 2VCYA 3FDJA 3MBKA 1Q0PA 1R4MA 1SY7A 1SU4A 2FN7A 2O8NA 1SZCA 2VJMB 3EY9A 3R3JA 4JBXA 4V39A 2GHQA 5G2OA 4D3DA 2FSFA 4FT4A 4DTCA 5DYYA 3TF5A 4P4LA 3WBFA 3W2GA 3OA2A 5EJFA 4X62B 2FDCA 2Z6QA 3MCVA 1U2EA 1Q77A 2ZJ3A 3UG7A 3WLTA 1Y37A 4YV2A 4QO7A 2JIZA 3DZBA 3WB0A 2V7BA 4MTCA 2VUTA 4DCMA 3ZJVA 1FE8A 4YNBA 2W00A 2X1VA 3LFHA 3MTAA 1BCSA 4MR8B 4CKCA 4EEZA 1L5LA 5GQSA 1QHHA 9GPBA 2GYWA 1RP7A 1T4MA 2H2HA 3E3AA 3KKZA 3N05A 3QIAA 4HXGA 4MWDA 2Y1WA 5GWXA 1OGJA 1XNGA 1XYGA 4RS4A 4BBAA 2YZMA 1XTIA 3JALB 1X6VA 5INTA 3CONA 2ZR7A 4ZEVA 1IL0A 1P1BA 4AICA 4D46A 3EF0A 3ZW9A 3F3MA 3MCUA 4C0WA 1EGMB 3WMWA 2R1VB 4I4LA 4YECA 5KWSA 4LPSA 3UV3A 5L4SA 4ZPXA 5EGSA 3EMVA 3HDTA 2GM3A 5C32A 3H1TA 3KNZA 5FTMA 5U4XA 3UUFA 2BHLA 2FQ1A 5I9BA 2Y0EA 4AWXA 4KXMA 3DFMA 4RF3A 2G1PA 4OMCA 3RSZA 3R20A 4XARA 2WAAA 3RI3A 2BEVA 1V3UA 1XA4A 2LVBA 2WK1A 3HY4A 3L8FA 3M9WA 1N3YA 1NLUA 4OB6A 3I62A 5HGXA 1Q7EA 3V7YA 1LBIA 1OWPA 2ZT6A 3EJ6A 1BA3A 4O4IA 1XMOB 2CJPA 1QH9A 1ZWLA 3F97A 4DCUA 1TGYA 3ITDA 2QENA 5CYPA 3PJFA 1UQTA 4DADA 5AUOB 3K1AA 1DG3A 1Z7BA 4MHOA 5EKSA 1PEKE 1WNFA 3OWHA 4KQCA 1E69A 3TMYA 4FCTA 4K6MA 4DT1B 3SEZA 1FUIA 2A33A 2I2AA 1EXWA 2FDRA 1NZDA 2ZJBA 4FYVA 4I50B 3T7AA 4LZZA 4YV0A 3AUFA 3OCZA 4A92A 4M46A 5ALFA 1ZXXA 3DMYA 4HDSA 4RKFA 4O2LA 1MXHA 4RPLA 1GNSA 1ZJ5A 4Z4CA 2EKLA 5AW4A 4C2BA 1ODSA 3HI6A 4HNQA 4L5CA 2OVFA 4LJRA 4XYGA 4JJ6A 2GPYA 4IDAA 3FGPA 4LGYA 1JLSA 3NHBA 1OI3A 2JFNA 2JAHA 1Y9AA 1AGYA 5E3HA 4NU0A 1M1YA 4FR0A 4OU4A 4O2AB 2Y1GA 1J70A 1RVDA 4GZ3A 4UXJA 3WIBA 4ZHQB 1NW9B 3HVRA 1JHVA 4ZC8A 2WJVA 2IUUA 1OZGA 3KT8A 1YDMA 3QWBA 4LDQA 5LSAA 3V3TA 3DT8A 3I0NA 2I7XA 3PR2B 1XQ6A 3Q12A 3BHJA 2C07A 2V9PA 2Y6UA 3F6RA 4JJEA 4L07A 4OXQA 1BKYA 5FIUA 1YS6A 1U2SA 2A9VA 1ECFA 3KUDA 4FP9A 4Z9FA 3RNOA 1J1IA 1Z5WA 1UPBA 1I1HA 4QJ5A 3SU8A 1JTEA 1ZGHA 3EQ8A 3JWEA 3C45A 3QPDA 1WXQA 4FMBB 2BFAA 1XEFA 1DO0A 4GOND 2Z58A 2FSVC 1ZD2P 121PA 3SR0A 3AVTA 1FXSA 2VNKA 1U11A 5AFSA 3DEYX 2CZCA 2RMKA 5FPYA 2VJPA 4ZAWA 4DHWA 2BZSA 4MV3A 1QGDA 4JLJA 5J5CA 4JUAA 3UMRA 1SBCA 1YU9A 4H3KB 3ZK7A 5CURA 4CM3A 5DB4A 1KAEA 1NW7A 4HXFB 1B8PA 5JVDA 3REQB 3DXZA 3LT2A 1LDMA 1LSOA 1M54A 2NZYA 2OD9A 3EVCA 4S1NA 4TOIA 3RFXA 3T5CA 4AXBA 4EW3A 5ITWA 3MS7A 2IUFA 4X8MA 1HSOA 1P9LA 2C03A 3IFSA 5I7HA 3CIOA 4K6HA 5JAPA 2C5BA 4QULA 3SVLA 2Y8EA 3DE7X 5IBCA 5KNDD 4P22A 3GUCA 3OA0A 2EG9A 1X1BA 1IY0A 3ANNA 4JYMA 3W04A 1QG2A 5HQ3B 3VI4B 3KJNA 1N3BA 2C5SA 1IDOA 2ZJ7A 3P32A 3HB7A 4JUFA 3OZUA 5A3JA 4J4HA 3JPYA 3CTMA 4HF7A 2LE0A 4Y2UA 3EGVA 2VAPA 3A6ZA 2RAVA 1Y42X 2CMGA 4Y9UA 3V3KA 3S28A 2GCOA 3RU3A 2ZJ2A 3A6KA 1C4XA 1TW3A 4MQFB 2J8ZA 4AY5A 3S99A 1KI6B 3Q3HA 3EXEB 3DMNA 3B70A 5TY0A 2DPXA 4OFZA 5IP5A 3T5AA 4L72A 5FUXA 3OHMA 8AT1A 3DO8A 4DLSA 2REBA 1C8VB 4MVJD 2ZR0A 4UEQA 5DIFA 2DQ4A 1T8TA 1JJVA 1JVSA 2CDBA 2O0JA 4KOAA 1VHJA 1USKA 2D06A 1PVDA 3JASA 5JI3E 4V0QA 5U9CA 3DZGA 1OPRA 3JX9A 1M2VA 1E4EB 1XD2B 1CEXA 3RV4A 2A0WA 5LZ7A 3BWXA 5I7RA 1QO7A 1XROA 1Q74A 4JLNA 3E03A 2ZJ1A 4AP5A 5DM70 3NPMA 1QF7A 3OIYA 2G82A 2QMYA 4AG6A 5K0EA 2XNSA 3USES 1GAWA 1TYCA 2CUNA 3AEUA 5AK4A 1SUEA 2C97A 4LISA 2YV3A 4P4SB 5JJBA 4K87A 3DEFA 4M86A 3SQWA 5JS1A 3R40A 1AURA 1QG6A 1PFKA 2NSYA 1ECGA 2I33A 2IP4A 2P9FA 3H9UA 4IUDS 5LWHA 1RYDA 2VDPB 3NZEA 2XOXA 1NVAA 3MJDA 6REQA 1K2WA 1NV8A 4MVXA 2FWIA 3DL7A 3ORSA 4MPJA 4PXSA 3R7WB 3GLFA 1FW6A 2CNDA 2K2QB 4J1SA 3K0CC 1OI2A 1URPA 5I47A 2KPOA 4IILA 5JISA 4D4KA 1KIMA 3S68A 1RMYA 2EFGA 2A5GA 3H4VA 4KMRA 4A9AA 1E3SA 2Y76A 2Q2QA 4NBNA 1UKBA 5ALMA 2ZROA 1U9ZA 5HHTA 2OENG 2AC7A 4PHCA 4GYYA 4X1KB 1SG0A 4BB9A 3EH2A 3MXTA 1XDUA 1U7ZA 1FP2A 2EX4A 2LDXA 4Y8VA 4R84A 1VPEA 4M76B 1RYYA 5HA5A 2J59A 4P08A 4WOKA 2Y3IA 1L4FA 1YR3A 2XCUA 1Y7TA 4N6NA 4U02A 2Y93A 1SGWA 1NFRA 1DAKA 1Y0BA 2GRAA 4RHYA 2Q41A 1KKLA 2KBEA 3MT8A 4KRGA 3KSBC 3P9RA 4PSCA 2NZWA 4E1AA 1W73A 1CF2O 2DCUA 1AGXA 3F1KA 4ETWA 4O4LA 5DN6D 4X1IA 3VSBA 3S70A 4B46A 2GA9A 5ICMA 3OX2A 2WWVD 2PZAA 1CF4A 4Y6PA 4CJXA 2FZCA 2Y1CA 3KJIA 3ROGA 4EF5A 4H2DA 4MOWA 4QVKA 3I61A 3B1FA 1AKNA 3BWDD 3KYCB 1ZDMA 2Y4NA 4L57A 4YRRA 2BHTA 4ZRNA 4QOHA 4B71A 5JYCA 5K0FA 3K92A 2W70A 3OVMA 2UXBB 3UHJA 3Q8KA 4X94A 1M1NA 1D6MA 3PVSA 3ECCA 1Y7PA 5IK2D 3HKCB 1NBIA 1GEEA 4HVAA 2E1RA 1EQ2A 2XLCA 3BH6A 4ZGBA 1K6JA 2AYXA 2GZHA 1H2AS 5NULA 1XQVA 1W0JD 1DEXA 4NAHA 5JNVA 4OYRA 4BJ5A 2F55A 1MB9A 2AQ8A 4JP1A 3AV3A 3EVTA 4JB3A 4XWGA 1J2TA 1C30A 3PCXA 5FL7D 5FOUA 2OCBA 2WVJA 3QGMA 2GS9A 4ZYLA 1C1YA 4ML3A 4A23A 1XDSA 2PX8A 5TARA 5FOXA 3IHLA 3QWIA 5CDSA 4HI0E 3RIGA 4AZTA 2YHUA 1O0BA 3TTSA 3ZGZA 3U3MA 4FWTA 2EBHX 2H08A 4TL6A 4UBOA 1R8XA 1PR1A 4LXUA 5JZOA 1QANA 4QDTA 1Y98A 3PXEA 4W5NA 4B83A 2B8WA 2D74A 1CUHA 3O74A 4KX3A 4MZXA 3BA1A 1XNRB 4F2DA 4J2OA 4J0GA 4JCOA 2ES4A 3VPHA 1H6BA 2H9AA 4BAUA 3B36A 1PJRA 2FP3A 4PHGA 1FTQA 4YCMA 4CU5A 2W6ID 1GQYA 4PO8A 1SH7A 3EOAI 5FFNA 1DFIA 3SR3A 3ZQJA 3CV3A 5JPIA 1WQ4A 1LC3A 4Q1EA 3A1EA 2C1ZA 5BV0A 3PIDA 2DEUA 1VMDA 1FNMA 4LC9A 1T8PA 1JMKC 3VR6D 1EWQA 3BD9A 4ZVMA 3GA7A 3KE8A 5EZYF 1IB0A 2RGUA 3U62A 1I7DA 2QLFA 2F1HA 5DM0A 2E48A 4J6FA 4WK0B 3RASA 1UL1X 2JFGA 4L6IA 2Q7DA 4BEWA 3SHTA 3R7NA 1GDDA 2Q9CA 2QPLA 4DZZA 5E1OA 1T26A 3AY6A 1W35A 2I29A 1JLHA 3GN1A 4JOBA 3S2UA 2QX7A 1TD1A 1JHDA 5D5HA 3PF9A 1M3SA 4G0QA 4JJ8A 2RJNA 5AI4A 4ZWNA 1G98A 2MU1A 3COVA 3MMNA 2XOKA 5AKXA 3IBGA 4HGYA 5DN6A 1HNWB 1V1RA 2ZLBA 3R8CA 1H2FA 1IHUA 1FIUA 4EG5A 1GFWA 1P5JA 4DLVA 2C0CA 3R7DA 4BVGA 4LNUB 4NENB 3VYWA 1L7AA 5IDYA 2FMTA 3ZQUA 3GFGA 1B3RA 1WMDA 5LXTB 4QD3A 5LOVF 1K6MA 2NU8A 3X2EA 3IQGX 5DGIA 3CLVA 1GLGA 4NOMA 1EHYA 1F8YA 2LW7A 2ZAGA 2I1VB 1QYDA 3IDQA 2CDNA 4CEIB 5BN4B 4MI6A 4TXLA 5F21A 1Y8RA 2XE7A 3WNDA 1Q3TA 3P0IA 3M33A 2P9ZA 2PEYA 3AKYA 1F2TB 1JLMA 4II3A 4WD3A 1M5RA 3NEAA 5FCDA 1Z7WA 1ADYA 2X0JA 1G7CA 2VRCD 4PLYA 1T0UA 2HDHA 4MIYA 3IHTA 3LQYA 3ID6C 1TIBA 1U0TA 1DG9A 4PFSA 4RX1A 1UODA 4EGCB 1QF9A 1UOQA 3I1JA 2O3SA 4DCSA 1C4KA 3DOFA 1RACA 2WWYA 1W4RA 2VHTA 1GQ2A 2A0FA 1RP1A 3DAGA 1QIMA 1N34B