1FYWA

Crystal structure of the tir domain of human tlr2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
145
Chain Sequence
SRNIYDAFVSYSERDAYWVENLMVQELENFNPPFKLLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TOLL-LIKE RECEPTOR 2
publication title Structural basis for signal transduction by the Toll/interleukin-1 receptor domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 34
structure length 145
sequence length 149
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 1fywA00
4OM7A 2M1XA 2Y92A 3H16A 2JS7A 4LZPA 4LQCA 4LQDA 3UB2A 4C7MA 2J67A 5FORA 1FYVA 1O77A 2Z5VA 1FYWA 3JRNA 4EO7A 3UB4A 1FYXA 4W8GA 4C6SA 4DOMA 3UB3A 4FZ5A 4C6TB 5H3CA 4C6TA 1T3GA 3OZIA 5KU7A 4W8HA 4C6RA
chains in the Genus database with same CATH superfamily
4KN6A 3EARA 3E84A 3HNPA 4P53A 5ALGA 3QFCA 1N2IA 1GPAA 1ONSA 1K0UA 3T7JA 3EWIA 1U4NA 4TKUB 4D9IA 3Q2IA 2JJYA 2OK7A 4GOXA 2R0QC 4MQEA 4BLTA 3GJ8A 3ZXUB 3MAGA 1MT0A 3QWHA 1OILA 1AHPA 1F7UA 1STOA 3N75A 1NKTA 5EJ7A 4BV9A 4NBRA 1WUIS 5G1PA 2IA5A 4IQ0A 5DWVA 1OU0A 3GAZA 4ITRC 1D4OA 4EKIA 1R8SA 2W11A 3H0EA 3MWKA 3OZBA 3L0SA 1SKYB 2VNHA 3HRIA 3NOQA 2H52A 4HFMA 1K9VF 2ERCA 4WLEA 1CD5A 2B98A 4HNTA 2JGDB 1DO8A 3KLNA 2G8NA 3C8MA 2GA8A 4JUIA 4P3PA 3ESQA 4F4IA 1RLOA 1W52X 2JI9A 1VIYA 2RGDA 5BSUA 4AO8A 1I2CA 3ABSB 3IRVA 3OIWA 4O8ZA 1DBQA 2UUAB 3D2AA 3QKTA 3DLBA 1TJ3A 1LA2A 1V2GA 2Y0BA 2BD0A 5A06A 1PYOA 2AYZA 4HH1A 3Q11A 4MQLA 5FUVA 1EFTA 5FOQA 2GCOB 4IZOA 3I76A 2VDUE 3IV9A 4U7DA 5CEJA 1QIGA 5DW3A 2QUBA 1YRAA 2DWPA 3RU9A 3S6JA 4MEBA 1QAMA 3B3JA 3EEFA 4V0ME 4NS4A 5SZHB 1Q0RA 3SPXA 5AFSA 2RBKA 4KPEC 1ZD3A 1EUZA 4LYHA 1GAWA 5AM0A 1LBQA 5DNUA 4FOPA 4I08A 3TRIA 2PMKA 2E4VA 4MJ3A 1BTOA 4IIHA 4PTZA 4MGEA 2QL9A 3UY4A 3E81A 1KI6B 3OD5A 3L18A 4QOSA 4XLTA 3KAKA 4G36A 2XY4A 3MD9A 2OZPA 3FCXA 4HAZA 5I9MA 4B3IA 1XALA 4WVLA 5AKGA 1XDDA 1SCKA 2C4UA 2R4TA 3BK2A 4WZZA 1PV1A 1N9KA 2QX7A 4E12A 4M1QA 2YXPX 1GVNB 3NASA 4J2TA 4QHTA 4BFZA 2DKNA 4E33A 1QFJA 5KNCA 3VXKA 4B80A 3GFQA 3DF9A 3AVXA 4WERA 4PNHA 1AF7A 4MUFA 3FDJA 2CW5A 5TY0A 2HT1A 5EGNA 3JQGA 4IDBA 3F67A 4ZARA 2VPYA 4AC9A 2OKCA 5ALLA 1DT3A 1HT2E 2P9FA 5KWIA 5EAIA 3U7EB 1G9XA 2WUGA 3V7YA 1W47A 2JCYA 4J3JA 1JKJA 1IQPA 4ARAA 5JTUA 3TM4A 1FMJA 3EDMA 3SZ3A 1KXZA 1R6VA 4FS8A 1JR2A 1VKJA 3ASYA 4N54A 4RF3A 5FPHA 1EZ1A 2LWIA 5EPUA 3B5IA 1EJ6A 1RPJA 2IHZA 4MV8A 4TQUS 1YASA 3OFND 5EKXA 1Y3FE 3FZEA 4CM1A 3GT0A 5M5BA 4Q47A 1HDOA 1Y1KE 2IGBA 3RJTA 1TTQB 4E88A 5G4KB 3K6SA 1SUDA 4IMJB 3E7WA 2G88A 1WIWA 3RC1A 1D2AA 4C4TA 2WF9A 3NCHA 3DL4A 2I7VA 1GYQA 3KX2A 3TAXA 4ZOAA 3CQ9A 5EXTA 2HF8A 2IPXA 2QNIA 1LPAB 1YF3A 5F1OA 5EKSA 3DNFA 2ZBPA 1T4CB 4ESEA 3BWMA 4A2PA 1WZCA 3EQ2A 3DTTA 4RLFA 3N58A 5ESDA 4KOEC 3E2PA 1BG6A 3EW7A 4OK6A 4RO0A 2VUSA 1PTJC 1Q1EA 1TQ6A 3MLAA 1TO2E 2WIBA 5LFAA 2IIVA 5KEIA 3V4PB 1NJ1A 2I22A 1SPXA 4OQPA 3NO4A 3U9LA 4LIPD 4JL8A 5IAJA 1X1CA 2NYUA 4W1SA 2MYPA 3QU4A 4Z7NB 1JU9A 1EKXA 2QUKA 5IW8A 1SCIA 4I8XA 1VC2A 2W2OA 4CF5A 2JLAA 3KYIB 1QMGA 3CLKA 1ZUNA 4E4TA 2EJWA 3QWFA 4HWPA 2FEKA 4LISA 3VVLA 4B40A 1YR9A 4IOLA 4BNTA 2XQKA 4JB3A 3ONWA 4G6ZA 3DT9A 1AK9A 6ABPA 1CUSA 1R9JA 1WEHA 3PSHA 1R0RE 1ZJZA 2ZB4A 1VG9B 4INPA 4W1RA 3L7NA 4OKNA 5DHQA 5KHAA 2PS1A 1REQB 5KOHA 1CY1A 2D54A 4ZODA 1IQ0A 1S02A 1VCIA 4Q1DA 2GEJA 5KSPA 2AS0A 1NSFA 3L0BA 3UJAA 4KK3A 5IJ9A 5ADUS 3BWYA 3UMFA 3VJRA 3GZTB 2LVBA 4KEAA 3DL0A 1KSGA 2AA3A 3EASA 5G1NA 4YX9A 3NMUF 1ENZA 3ISJA 5HOQA 3KB2A 2NUPB 4ZV7A 4F4JA 2CSXA 4R51A 3H2HA 2VDLB 4KQCA 5HOEA 1MG0A 4IIFA 4TWAA 3JATA 1L5VA 5BO5A 7AT1A 2GWRA 4RVNA 3N2ZB 1Z2PX 3LJKA 2R8ZA 4MPJA 2XWPA 2GOYA 2ZUDA 4TOIA 1B0UA 2W6QA 2KI5A 2XMPA 3LQ2A 1CSEE 1GUYA 2A67A 3VNBA 1J5EB 3FKQA 2A92A 4II2A 4N03A 4NECA 1XU7A 1JQDA 2XXBA 3QFTA 4ZAXA 1TQDA 4XIFA 3RRXA 1ZUWA 4JUFA 1TXGA 1VFPA 2BRUC 5EMNA 2JJ2D 1I5RA 1V5IA 3IXMA 2HQRA 4D57A 1IY8A 1KIMA 3LQRA 4GKAA 3EUAA 4MW7A 3TSYA 2JDIA 1UOOA 3AEXA 3H9QA 3DV2A 4UPVA 3NNSA 4KN5A 3FUUA 3M4ZA 1XTRA 3AILA 1Z15A 1XRPA 2HMWA 4ZYUA 4KVGA 3L0CA 4M3NA 3VNSA 2AMLA 2AN5A 2DPHA 3HUFA 3HFJA 5HFJA 4EA9A 5HNKA 3GG9A 2PL9A 5AM2A 4IKEA 4PC6A 3THYB 5EZYA 3L1VA 3L4SO 3TJRA 1LDMA 1PT9A 3BAFA 2IPMA 2Z08A 2O6LA 5FA8A 5FLEX 1EEXB 3A6FA 1IN6A 1XYYA 1SCDA 1ULAA 4NCKA 1FZQA 1IDN1 1T0UA 5JD3A 3MWEA 1OA1A 3RROA 2HA3A 2JLRA 1YOBA 1PWZA 2VPXA 2GPTA 1ZP6A 4QTZA 1R6XA 1FRNA 3G2OA 4XASA 1KH2A 3T4XA 3BKWA 1XRNA 3BDAA 4WNIA 1HKHA 1PX2A 2CUTA 2R00C 4TV8F 4D8YA 3FNHA 2DLDA 4FOLA 4N7RA 2ZYUX 2GI4A 3TJZA 4AU1A 3O7MA 4H1WA 4P9NA 5EQFA 4FHFA 5EIEA 4PBSA 2P41A 2JEOA 2CKMA 4Y1GA 2IYVA 2KE5A 3UK0A 4EF6A 4I1RA 4O59O 3U4GA 1U7DA 2GETA 2FN3A 4FLEA 3HTXA 5KWJA 4W9MC 1SY7A 4OSOA 1D6JA 4RF4A 4DLLA 5LC1A 5JAZA 2UUPA 5FR1A 5FNVA 1GQQA 4J0CA 5D5HA 2GUWA 1I2AA 1UK7A 3EA4A 5FI3A 2D2FA 2G9ZA 5ER6A 1E9EA 1U4OA 2GK6A 2QMQA 4R1QA 4TSRA 1JG4A 3ST7A 1NXPA 2ZJAA 3T9BA 2YBEA 4CR8A 2QX4A 4ZAWA 1L4GA 3LAWA 3EPLA 1SKAA 2FMHA 3UEOA 2WHQA 4NZMA 1QB8A 3MBIA 4GG1A 1MMFB 4CNBA 1QKIA 3OPMA 4A8JC 1PWXA 4KYIB 5EXEA 4O3MA 3B85A 4ZP1A 1UBOS 1ORHA 2BKVA 5T6MA 4NU0A 3JVEA 4BO3A 1KTIA 1IATA 3GGPA 1CIJA 1H05A 1K2WA 4J8PA 2P30A 2J87A 3SS8A 8LDHA 5TT0A 1RXCA 2J5BA 3TLGB 2NYAA 1YFJA 1XTUA 3KB1A 4JVNA 3N39C 4UQLA 1FUUA 1E2EA 4Y0VA 3C8HA 1DVRA 3G9TA 4NR0A 5J43A 1YS7A 4JY7A 1Z39A 3AY0A 4LXGA 2LDBA 1X7GA 3DQPA 2O57A 3FCAA 1TJYA 5BSTA 3ZDXB 2C54A 2CMKA 2HBRA 3CZRA 3LM8A 3AVWA 1E5DA 3GJYA 3FPBA 4E5DA 5IFKA 4TV9B 1XP8A 3KALA 1TJ4A 4GMHA 5DT9A 4TS3A 3D1VA 2Q5QA 1GCAA 4WI1A 2J3MA 2VPTA 1LTKA 4OL0A 3O4JA 1DQNA 1NRIA 1MXFA 4KH0A 4GIBA 2CZCA 4N3CA 5AM5A 5FO0A 1E2NA 4HH4A 2V7QD 5G41A 4EUEA 1Z6AA 4MS3A 5KKAA 3S2FA 1XDWA 4A5OA 1XPOA 3F46A 2WFMA 3BQ9A 5TS3A 5MGBA 3N1UA 2Q0QA 3JTMA 2H48A 3K9QO 3FUVA 5HA5A 4D9MA 4NG5A 3AVYA 2NQ8A 4I9GA 3KT6A 4FYVA 3ETHA 3FDIA 2B1IA 1Q19A 4GLOA 1RRFA 1HDRA 1U6JA 4OJMX 1U8EA 2CB0A 4CLXA 1E5LA 1HI9A 1L5ZA 4R69A 1Y4AE 3AR5A 4NOLA 1T0JB 2FPUA 2X22A 2VLIA 3GRUA 4ROTA 5BMVF 1PDOA 1KMMA 2VBGA 2VNIA 3OE1A 2IU4A 3W7AA 1J9GA 4YRDA 2ERXA 3O4FA 4HY3A 3KXLA 3N6RA 1V4NA 4XWTA 3PHGA 3VV2A 1U1FA 5HIJA 3UJDA 4BZQA 4DCMA 3H8SA 3HJCA 2GFQA 1R4AA 2KB0A 4C0AC 5JLAA 3BORA 3QMPA 3UHOA 2JARA 4EDFA 1OBOA 1V5EA 3X44A 4FJ2A 1R9GA 2HI0A 1S8OA 2Y9MB 5CB0A 4HB2A 3OQBA 2NG1A 4OSPA 3TD2A 1KOJA 1X9IA 1E1CB 1AO3A 1HQDA 1OXSC 4B7AA 4BE7B 3K8YA 4XUCA 1IAQA 4BO5A 4II7A 3A4IA 3PDWA 5CP8A 1FJGB 1MC5A 1A8PA 4TTIA 3C8ZA 3WMXA 1QH1B 3CUWA 4HAVA 1GUDA 3VDQA 3BSYA 3I61A 1YDFA 1MOQA 2GCNA 3TPFA 2PUJA 1D1QA 2N1BA 5DWQA 3REQA 3QBTA 3VR6D 2BHNA 4OLHA 2XRFA 2DYKA 4QUKA 1YR7A 3I4FA 3NAZA 3OZIA 2FPSA 5K6TA 4BAUA 2OPHA 3VH1A 3JQBA 3NHSA 3WLAA 2GZ1A 2IOHA 3O9ZA 5T6BA 3ZDDA 2H1SA 4BV8A 1BZYA 1O9GA 1N0VC 4QBIA 2H7XA 3QVKA 1Q1QA 1WSAA 4J29A 5G0WA 3V8VA 3NDBB 3H1FA 3NETA 2X1MA 4GQIA 5M7EA 4KR2A 3DC7A 1SHKA 4KR7A 5JFTA 1JALA 3RSLA 4ASUD 2C0PA 4CU2A 1X3LA 3FOCA 3A6JA 2QN2A 1JJVA 1R74A 2C96A 2Z2ZA 3PGLA 5TX7A 5KYKA 1I4WA 2BFDA 2GEBA 5HIIA 4WX2B 1IJKA 3LOPA 3T1TA 1W25A 4BJ5A 4IG4A 1QIMA 1SELA 1WUYA 2CD7A 1PJ2A 3JASB 3ELUA 3L7JA 4N1AA 1GAQA 1O1YA 1BXGB 1XZLA 2YQ4A 4N6NA 4R4JA 3CEJA 5EE3A 2CBZA 1E2FA 3OLVA 3ZGLA 3CLSC 3HDVA 2FWBA 2VVTA 3KUCA 1EUCA 1XD8A 1Q7RA 1CUIA 2GAOA 3OJWA 3OZDA 1RJEA 3T41A 4BDTA 3KWJA 4DV1B 4CHGA 2O1SA 4ECEA 4ZCPA 1E9VA 1E0KA 3FVVA 5LMCA 4E46A 5CNMA 1M1YB 3R2JA 3E15A 3ED1A 4ZEWA 3L5KA 1ZJ5A 5A5FA 2EJBA 1AUXA 1KI8A 1NQXA 1QHNA 1XZQA 2WV7A 4NZNA 4OTZA 1ZVKA 1Y8QA 2DFDA 3OU7A 4DTCA 2HQSA 4G5HA 3DE6X 4H6XA 2O2GA 4O5AA 2IIPA 2FFRA 4OY3A 4URYR 3RH0A 4DZZA 1GGEA 2CL6X 2EFGA 1ODJA 2TSYB 3IBCA 1NQWA 4EI8A 1Q2XA 3GELA 3AHIA 4OI1A 2C0QA 2WFLB 3N2EA 2Q1WA 3HZRA 4BKOA 4QLAA 1R5BA 4QL3A 4YCLA 3LA8A 4ZVMA 4YYZA 2HRZA 4HNRA 4LW8A 4MXDA 4PF1A 4DSZA 2CUNA 4RHTA 4D3ZA 4D4KA 3OQOA 4MW4A 1E5TA 3V55A 4EA7A 4YN3A 3OCUA 3LHFA 4DVJA 2QXTA 4HNVA 3Q8LA 3R9XB 3CLUD 2ODTX 3WVNA 4UHEA 4IQ8A 4PAWA 2UZ3A 3MJHA 4NENA 2OCBA 2ERYA 3GJ5A 3GNLA 3UC9A 4RTQA 3PEEA 1NVXQ 2XNJA 4GP6A 1IJBA 4B79A 4D9FA 2QUHA 3VOBA 4EW6A 3QOXA 5B1IA 5JR3A 3BERA 4YXFA 2HWKA 3A06A 1E4EA 1NNUA 2E4ZA 4CG2A 3QW4B 4NCNA 4QRDA 3HU1A 3IAEA 1HDEA 4MLPA 5COBA 4P35A 2Z09A 4TSFD 3GEEA 4RETA 1U9YA 4REQB 4EDHA 1FX0A 3PU6A 5BR1A 1TUBB 3JWPA 4E07A 5ITZA 1N2XA 4DCCA 1IN5A 1DQRA 1GTG1 1XDGA 2PIDA 3NHBA 3NU1A 2QTZA 4J03A 2C1XA 5LZ2A 5DNAA 4JVSB 4WZAE 3NYRA 2A86A 3SE7A 4C4XA 2ZR8A 1EZ4A 4IHJA 4R83A 4BCCA 5CFRA 3QVXA 1ACLA 3Q85A 1C7QA 2YINC 4OVKA 5L3RA 3ETLA 1V5WA 1XWFA 4FEYA 2GXSA 2ZU0C 6AT1A 4NMMA 1TNDA 3G9QA 1QHXA 3VFDA 1N0IA 1AGNA 4I4TA 4IX9A 4TS4A 3FSGD 1K97A 5D87A 4Q3DA 1P7YA 1TVMA 4ZV9A 3P0HA 3BHJA 2AI2A 3EC2A 4UHKA 4R2LA 1OT3A 4NYJQ 3M89A 3PHHA 2NU8A 3PLRA 5AJWA 5TMEA 1FRZA 1T4GA 2PFKA 1AHNA 2VTEA 1I24A 1VP3A 3DSRA 5G2OA 4IIJF 5BT9A 1P0PA 2VP3A 1DOHA 2VK4A 3KQLA 3J7AC 2L2QA 3GCGA 3KZOA 4KP7A 1ADJA 4KWHA 1L5NA 1Q7BA 1XA3A 3RB8A 1NN3A 1LKZA 2QM0A 2WWIA 4B3FX 2VJLA 2LIVA 2OBNA 2J7PD 3ZY2A 1ZN7A 1RWQA 4Z0HO 1UFVA 2BH9A 1GGHA 4CLOA 3WZMA 4O2BB 4JLVA 1GSIA 5CD9A 1I4OA 5B2EA 1VSVA 2H18A 5KHLB 4L8VA 3ENKA 4JJZA 5KDDA 4NPCA 2HDHA 2QW8A 2XNDD 2BKXA 2I4IA 4RABA 4Z9BA 5P21A 2PZGA 4D4HA 5A04A 5CAEA 4M49A 2W7TA 3GH1A 4RY2A 1T5DX 1JKJB 1SEVA 4Z9FA 4G81A 1G5FA 2ACKA 2VBCA 3BTUA 5A9SA 4EQ6B 1CYEA 5T5QA 4YDHB 1ABBA 4M1TA 2QQGA 1K7SN 3HNRA 3K0HA 1PQPA 3L43A 3OKFA 1UFRA 2WJAA 3NYWA 3OOJA 4OBXA 1S3IA 4DLWA 2DBQA 4UM9D 4EUKA 3T9CA 1NW7A 5IASA 5KCZA 4CT4B 5AVSA 1ISSA 1SC1A 1LDNA 2E48A 1W48A 1XVUA 3FROA 3BWBA 4OQDA 2ZXFA 2C20A 3W5BA 4E31A 1MOSA 2KM1A 3L8DA 2C2YA 2BSXA 6NULA 5AI6A 5AVQA 1KA9H 4DXAA 4Z49A 2EKQA 4B82A 3L0ZA 1V7CA 5WRFA 2X8JB 1JAZA 3HUDA 4FMDF 1PK9A 2AMFA 2Q3CA 3D6VA 4M0MA 2GKOA 1G55A 4MVCA 5B2FA 3RIYA 4TN1A 4M0PA 1BGXT 1K6EA 3NHJA 4PM4A 4KZPA 3LQ4A 2OFWA 3F2VA 1LWOA 1C0EA 1T8UA 4ARUA 2P75A 2ZIEA 4H6WA 4R3UC 4E5UA 4CPDA 3U44A 2G8LA 3CZ4A 3U7FB 4R8MA 3K0SA 1E3DA 3D2CA 4MCIA 4J7CA 3O2QB 3LZCA 3ENVA 2HCRA 4NI5A 3W9SA 4OXYA 4ZQEA 3QSGA 3ZQ6A 4AZ3A 4G1FA 4I1VA 3K2QA 3R6WA 4MRPA 1X9HA 2ZJOA 2ZWMA 2FEXA 2OQRA 1NI4A 3JQ9A 2I0FA 4QU9A 1HSZA 1RZ3A 2GCGA 4DGSA 1UBSB 5DM60 1FTYA 3FRHA 4JLMA 2O05A 4KE9A 1H0RA 1VE3A 4G0QA 1T4MA 3GRKA 4E5NA 3F6CA 1Z4OA 5CX1B 3LUHA 4OREX 1NYRA 3NVKI 2FUNB 4UTNA 4OATA 1T91A 3KKNA 4S1OA 3RS5A 4H4CA 4Y7CA 3GQBB 1O03A 3QPCA 4B5LA 3D6NB 2YWBA 2Z2YA 3L8EA 4WZBE 3S5JA 4HMPA 4E51A 5KVCA 1KETA 1W2GA 2HZ7A 2X8LA 3STWA 1ADCA 4KQHA 1BX0A 2XI4A 1RM5A 4BX8A 5H16A 2G6BA 3G17A 4A16A 2Z6AA 1Z34A 1FTSA 1UBNA 4HDOB 4WTOA 2XMRA 4XUGB 1HYBA 2WMYA 4RZUA 4QUDA 3A2LA 3TKYA 3BSWA 2W2QA 1E59A 1R5JA 1WVGA 2E6KA 3MFYA 2FW7A 3ED5A 1ULBA 2FR1A 4RA9A 4H16A 4UEJA 4BN0A 1QTQA 1BOOA 2HSDA 2DR3A 2X5JO 5JMWA 2G3YA 2WZBA 1XDUA 2FJUA 5EWJB 1PVDA 3IUPA 3X1ZA 1B8NA 3MJRA 3ETCA 3MMXA 2D00A 3OT1A 5DOZA 1L8OA 1RXSA 1E2IA 2H57A 1JIJA 5AVJA 1M67A 4K6OA 3VKVA 4N48A 2EW1A 1Y42X 2JA2A 2OYSA 2P5UA 3ODPA 3RVMA 3WKAA 3HUEA 3JSAA 2J3LA 3FTCA 1ABFA 2X1HA 1PLLA 5JWOA 5TXGA 1P4HA 3PYMA 5BXYA 2PCJA 1EX9A 4CMEA 3O2SB 4P80A 2QSJA 1KK2A 3OFVA 2HHCA 2F9FA 2FZ4A 2O5VA 2HJVA 2Y92A 3AUUA 3PVSA 3Q7EA 3GFSA 4YFVA 4L4RA 4LJLA 3F78A 5J4LA 4LZPA 3TZLA 4CIDA 1DAMA 4KG7A 3ZIAA 1KEVA 1JQBA 2EW8A 3TW8B 2B8JA 1T36B 4DKJA 4C2UA 1K4MA 2LCIA 8ABPA 1IK6A 1ANKA 5LB4A 2Z1NA 1XCLA 5FA5A 2HIMA 4S35A 4IKOA 3I1YA 4PWZA 4EL5A 3G89A 1FJHA 1JDUA 3RTEA 4UE6A 1WUJS 3WIEA 5MF6A 2PDAA 3OTOB 4DB4A 1O2DA 2WHRA 3EVNA 3RGGA 3L1IA 4I36A 1G7RA 2ZR9A 5C4GB 4AQDA 4F3KA 4GS5A 1C14A 1ZOIA 5JH7B 3U60B 1H3FA 2HMTA 4MWCA 1UKZA 4P98A 1PKXA 2CDRA 2NPIA 1Q16A 2BTOA 2VJNA 2OZLB 1JDPA 5KNBD 4PQFA 1U04A 4D98A 5I7SA 1G21A 1XAGA 5KTRA 5B57C 2VKTA 1YDMA 1C9JA 3I28A 3N8KA 4UXIA 3ILVA 3QHPA 4NFSA 1YBVA 2IYQA 3SYNA 3SEQA 3L46A 1C3JA 2VHXA 2C5LA 3N76A 1TEVA 3AOEA 1O94D 1XTBA 1P2BA 2XE4A 2YFHA 3P94A 1V96A 4KWIA 4ISBA 3E8SA 1SIOA 4JLDA 4RKYA 3PWKA 3D8BA 4EABA 3GYBA 4RS3A 2P2LA 2O5RA 4RE5A 4G85A 2VDRB 4LK3A 3DZBA 2ZSDA 4J94A 1CXZA 4GT1A 2PVPA 3EXEA 3NNDA 1ZOSA 1B2RA 4ZRMA 5T64A 2M32A 1RI4A 5HCUA 1H5NA 5FOVA 5CFZA 3UN1A 3I3OA 4KITB 1V71A 3I34X 3MK31 3LNTA 2QROA 2XBMA 1L8QA 4D25A 1RKUA 2Q3HA 3IQDB 1SXQA 4QPNA 2VYVA 4OL9A 1ZUHA 1LUAA 1XMXA 1P6XA 5AM1A 3WGQA 2ECFA 3OPYB 3DE7X 3WB0A 2OEPA 4YFYA 4HVAA 3Q5GA 1GCOA 3A0UA 5C7LO 4B48A 1N3YA 1X42A 1IY9A 2YJTD 2C2KA 4DZTA 5FX2A 3B2NA 3C3DA 4COOA 1OUMA 3VYUB 2PZLA 3C5EA 4FYKA 2P6RA 1JI3A 1KR5A 4CM3A 2WWFA 1NHGA 1Q0HA 2P78A 5JYEA 2ZI6A 3G8DA 1PN3A 2R65A 3KPJA 4WBXC 1RWMA 3OTGA 1OWLA 1UQRA 2HGZA 4HNSA 3DULA 4RK6A 5JAPA 5JD5A 3OZFA 4CR6A 4C03A 3K20A 1QHHB 1TVKA 3UKDA 1NL3A 2H54A 2GHTA 1UH5A 2IDKA 1DNPA 5IVIA 3W2IA 2VZLA 1TW3A 2W9XA 1FFHA 2ECKA 4KIGA 1JMVA 1D7OA 1FFAA 4KXLA 3GUYA 4D9CA 1IXRC 5LZ9A 1IUNA 2AZ4A 1XRQA 3V9PA 1P5JA 4DS3A 3T34A 4OMUA 4ZVLA 4MS1B 3VOAA 4DGQA 2JANA 3X1YA 3ND5A 2B61A 4ENWA 1Z4KA 4EYKA 1TC1A 3R6DA 4W5WA 1TA0A 1KYYA 3G02A 4JROA 4U00A 3KU4A 2CVFA 3PA8A 4JXJA 3PQ2A 1FNSA 5C8ZA 1N2CB 4YRJA 3ORQA 2NYVA 3OLWA 2ODWA 1KEWA 2REQA 4Z8YA 5LB2A 2IBMA 2QLLA 2IEGA 3W3AH 4JHXA 2HY7A 3DHWC 2MINB 4F91B 5JJKA 1W36C 4IDNA 4RKQA 2J32A 5LNK1 4BLRA 1LLDA 3GLIA 4B4DA 5LWQA 4HQLA 3FE2A 5IUNC 1DFHA 2JC3A 4G8JA 5L40A 1EK1A 2C7PA 3H3XA 2BR3A 3EAGA 4I5IA 4UATA 4X8MA 1Q3KA 1S3SA 3AB8A 4HX9A 1TRKA 1WM1A 3NJ4A 4E2ZA 4QOJA 4JBYA 2ZTUA 1U2SA 4KQJA 2O8EB 3VDMA 1JG1A 1H8HA 1MJNA 2J4CA 3NP9A 4OD0A 1PGOA 2QLFA 5EYPB 4M38A 4M36A 4PLFA 4P7BA 1E9SA 3L7DA 3P2EA 3OTIA 1YKGA 2Y77A 2R6DA 4KX5A 2FPMA 1C7ZA 3QI7A 1WW8A 2PSDA 3BHNA 2ONCA 3D6FA 2B3DA 3AHCA 3HHEA 3N2IA 1XZGA 3N28A 3P9XA 4YJ2B 4QZVA 1P9OA 2GBPA 2GEKA 3DFUA 4FEEA 4K9QA 4L4XA 2OMKA 4HB4A 1E9BA 2GDZA 2Q28A 3SFTA 4A6DA 1N0WA 4XCQA 5C0OE 4ZK6A 2FEWB 1XJWA 2OBMA 1FFXB 4G0YA 4PHFA 2J0SA 2QTAA 4P3YA 2QTGA 1RZUA 1V45E 3R7FA 2QJTA 3FZGA 1JHQA 1G8YA 1QANA 2M1XA 3QA9A 1N1DA 1NLMA 2X5OA 3EISA 5CJPA 4S1TA 5AM3A 4NOMA 1ZQ1A 4MPRA 4G01B 4M0KA 4NHOA 4EG0A 5KX5F 1J0CA 4AP9A 2QUZA 3FTQA 4UDOA 2FMXA 5FBVB 5CT8A 4UHDA 3BVPA 4E5KA 1Y4ZA 4BNUA 5C4IA 4ZVOA 5E6UA 1N6IA 2FNAA 2PUHA 4UBIA 3IAAA 4BBJA 2B4AA 4Q9JA 4YAFA 3IKLA 5HBRA 1T3ZA 3OOWA 5T4EA 2FOIA 4MQ5A 3LGSA 3OZRA 3FPGA 2JZCA 3NIFB 5K3EA 3O8DA 3T3NA 4M7PA 3R0JA 1Q1GA 1EIZA 1YRQA 1EUCB 3P4YA 5KJEA 3I04A 4PTLA 4QGAA 1RP1A 1PGJA 3G59A 1QQ7A 5IU6A 2NACA 4MNTA 4Z8XA 5HEKA 5MFPA 4FQ7A 1X7XA 3HRHA 4IIEA 3GUUA 3C41J 4KBGA 1CR2A 4MK4A 1KMCA 1H1LB 3BFXA 4FWBA 1JL3A 2D1RA 3KL4A 3KT8A 4JP1A 1W581 1WU8A 3EF1A 5DXAA 3PGKA 1WOMA 4XM0A 2FH5B 4NU6A 1NU8A 1Z7YA 2W42A 3CZPA 2MU1A 4JGGA 3TTXA 1DTWB 2CHEA 2OO7A 3HDTA 4K2AA 5HCIA 4AYWA 5DNCA 3N6XA 1Z17A 3I92A 1M2OB 3KYDA 1GQRA 4AG6A 4C5BA 2HIHA 4U02A 1FS6A 1WB4A 2AJTA 2VI5A 2C58A 2C2GA 2KJQA 1DUVG 3FY4A 3OECA 4MDYA 1TFRA 3QBDA 4QFMA 1BJKA 4TYMA 3JAKA 1KE2A 3QTTA 4XD2A 1OB2A 1UMDB 2IGTA 3AM3A 4C14A 1C4WA 1ST2A 1E8MA 3V8PA 4DZRA 3C43A 3WK9A 4INZA 1GSHA 4MKIA 4ZDJA 1Y1SA 3NRBA 1EFCA 1PZFA 1QS0A 2VF7A 4MKHA 3ACDA 5KVVA 1EE9A 5DE3A 4DUPA 3W79A 4I1PA 4GOOD 2X3UA 4L51A 1RWBA 1NNSA 1NFQA 3RWBA 2VA9A 2MJLA 3H5OA 3KZ1E 1WXGA 3NEYA 3F9IA 4NENB 4ZMRA 3WOVA 1CB7A 3UWOA 2F4NA 1TVCA 2PM8A 3IS3A 3VPBA 3H1TA 3WV4A 3VNUA 1M34A 2H06A 3IBYA 4RDIA 5A1JA 1R0KA 1P73A 1VCHA 1Z0UA 2HK7A 1G7TA 2XOKA 2YXLA 3PNSA 4ZRNA 1E2LA 3DGEC 1O87A 5F4BA 3C5CA 4CKBB 1MHTA 4PAMA 4FZVA 3GMDA 3NVAA 1R6AA 3LLMA 1E2PA 3LO5A 4JQCA 2FA9A 4GI2A 1GZDA 3I1JA 4U2EA 3ZC3A 3ZWDA 2MR5A 2J9FA 2ECQA 2IW3A 1X7HA 2OSVA 1KNXA 4FCWA 1P7WA 3KQOA 3A3NA 1IXKA 1XJQA 1SA0B 2H4YA 2PRYA 3BMOB 4MYSA 2MSDB 3EFOA 4U7TB 4OJTA 5E6SA 1XNQB 4MYRA 4I3GA 4YRZA 2YWCA 3HP1A 2VPWA 1NTRA 1N0UA 1PW5A 3O4GA 1AA6A 1VA5A 1RXVA 3TOSA 1ESMA 4X1IB 2UUOA 5JEDA 3UATA 4NBLA 4QUEA 4BEBA 3BN3A 3WGLA 1ETHA 3ZHYA 2PUDA 2C9MA 3U4MA 1IAVA 1RPAA 3L04A 3Q72A 3R23A 4GXTA 2Z1MA 2X1VA 4MB2A 4NV0A 4Y2VA 4KN8A 1CS4C 1KHTA 3I32A 5TEVA 3W4IA 2KX7A 1YQWA 2C7VA 2O0LA 4RENA 5KJCA 3VPCA 1GQ2A 1IHDA 3R41A 5I3ZA 2F43B 3LDUA 3RHTA 2RHOA 1QRAA 5J2UB 1U02A 2X4GA 4UCFA 4YCJA 2VDPB 1UKVY 2XR1A 3BTVA 4F71A 3RQIA 1HLDA 4W9RA 3HY6A 4G09A 4IDQA 5EKDA 3V2HA 1OOEA 2E4XA 2IBTA 1VTKA 4E15A 1N2BA 2DCMA 2EIXA 4GX0A 1P5HA 1CFJA 3PD1A 3KZCA 4LI3X 5FL3A 3ZE1B 7REQA 2AF4C 1TYDE 1U0LA 4P3KA 3ZR4B 4JXXA 2J41A 3H97A 3ICCA 1AKYA 3I58A 1DLIA 3IXLA 4W5JA 1TPYA 2BR4A 3IJPA 2HADA 3IT1A 4HR7A 5K0LA 2PEZA 3WWCA 5CB8A 1A27A 3BZBA 1J90A 1LSJA 1IWBB 4MO9A 3ICEA 1ENOA 2XDQB 1LV7A 3FCEA 5BSMA 1QFZA 4QLBA 3W6ZA 4DIOA 1K98A 4ZHQB 1FUYB 1P7PA 3H5RA 2GCEA 2W6JA 1P81A 3CUVA 1N32B 2OV2A 2BM1A 3MJDA 5F3WB 5HGJA 1K8QA 1T2FA 5BN1A 1KIAA 2AGVA 1KU0A 2G4VA 3RM3A 4YGYA 4X5OA 1XMOB 4QTUB 4QQFA 1EFDN 1YQUA 3G82C 5AIBA 5BOSB 4JC4A 1Y7TA 1OC2A 2GD1O 1FDVA 5F4ZA 1NBMA 2XSZA 3H11B 2B7BA 2HL6A 3QTBA 2FZEA 1J6UA 1JDNA 3O91A 3DWGA 4DOMA 2YDYA 4BATA 1D2CA 3QU9A 4B0PA 1DKLA 1EK5A 3RS9A 5CM8B 2FW1A 4DCSA 2QBYA 5AHWA 4Y2PA 3DVAB 5C34B 2ZYSA 1XVLA 3LY5A 3Q8KA 4F2DA 3G2HA 2IS4A 5AK3A 2B2CA 1E0DA 4LY0A 5ICEA 1V1MA 1NRWA 4N0QA 3WGIA 4IGKA 3ZZUA 4Z3DA 1DEKA 1O0BA 2BF4A 4F04A 1JJBA 2ID4A 5G53C 1RYMA 3DUFA 1Q20A 3AUJB 4EB3A 5L9AA 1VE5A 1QF7A 3JWIA 4HDCA 2C7BA 4HXFB 4LJ8A 4UCQA 2P40A 4I9UA 4RDXA 1C1HA 1IB6A 3F3KA 2NUAA 1AOXA 1ECJA 1SFRA 2ZCJA 5FLXA 3OIVA 2QZZA 4CM9A 3PUJA 2OAP1 1KSHA 4DDWA 5JQGB 1WZNA 4WCDA 2W2VA 4K9NA 1MPXA 3G0DA 1TM1E 2QLBA 2A14A 4AUNA 1MKYA 2N0SA 2YZMA 3WIUA 4OXNA 3WRYA 2V7VA 1VSQA 1T1IA 2I1QA 3N87A 4KSBA 1POXA 5ILGA 2EFDB 3FWHA 4F84A 4E32A 5EMHA 1BVYF 5FYDA 1GOTA 5CCXA 4B33A 5A3SA 1OROA 3FMOB 3VU9B 3BC1A 3FIJA 2AN1A 2QMOA 1EDDA 1U8AA 3PGA1 4PSCA 2AEFA 8GPBA 1OH5A 4BNZA 2QL6A 3I9NA 4WXRA 3F9RA 5E1DA 1TZBA 4BFTA 2FV8A 3EIHA 3EJWA 3K8QA 5KNDD 4ARVA 1SHUX 5U4QA 1YRWA 2G5CA 2ZEJA 1FQWA 1XI2A 3X2FA 3RANA 1KKLA 3WRXA 1UQUA 3VR3D 4Y9TA 1ZVVA 2JZNA 3EYAA 2O3SA 3D3NA 1MBZA 1K8YB 2WG2A 3O90A 3CZCA 1LK5A 1QGAA 1WXHA 2R6GA 4U0KA 5IKEA 1K6MA 4WXPA 4JI1B 4L9RA 4EBFA 5FWYA 1AMOA 5LMUB 1DC8A 2O8VA 4IFEA 2AKEA 3TIGA 1P3JA 5F1KA 4EHFA 5D1NA 2PSJA 3PTAA 4M8IA 1FVOA 4FFBB 4EY7A 1G59A 1NUUA 4UHHA 4RJJA 1NP6A 1JS1X 3VHQA 4WA8A 2JLXA 4BQPA 3VYRB 1DG3A 5AVRA 1PP4A 3VBCA 5EJAA 1PHRA 2HMSA 4HXGA 1Z07A 4RVCA 3TSZA 2IXTA 3FVTA 3AONB 4GRIA 2EZ8A 3JWJA 4OHRA 1D7AA 3OLZA 2BPOA 1CS0B 4LJ6A 1JZQA 2A7XA 3HR8A 3OF5A 3KOYA 4PAGA 3CF0A 1YNSA 2GASA 5BN5A 2PUFA 3KSAC 1QCZA 4TX1A 4FMCF 3D2LA 3U80A 5ALIA 4EHLA 2FPRA 3I6MA 1U28A 2BFCB 2JLUA 2BE9A 1OAAA 1V9LA 3TPZA 2R1TB 3U1VA 3D7NA 3ROZA 1W5EA 4X1YB 3PFBA 2PO7A 2D1QA 1LW6E 2R6R1 4CTJA 1GGJA 1N5LA 3RFUA 1B15A 1SGWA 3DZGA 1Z26A 2FCAA 4KBYA 1LVUA 3TL2A 3R0XA 1O8CA 3IVMA 1TM7E 3JQBC 4RM3A 4N76A 3HDQA 3S40A 5JRDS 5CPFA 3C7TA 1WRBA 2WJYA 3IKMB 3O8QA 4JJ7A 3AUAA 2O1EA 2VPZA 4M8LA 1O7JA 3DOEA 3W9YA 2QYTA 1SC9A 3CPEA 3DTVB 1WQ1R 3ZY5A 5K0TA 1R4MB 1H2AS 1FSZA 4JB0A 4F2WA 4ARCA 4DABA 4DN6A 1E94E 2H0RA 5F7ZA 4YCDA 4D6PA 2WHXA 3DM5A 621PA 2WSSA 2HSGA 1I9GA 1KMHB 1R16A 5IJAA 1U94A 3CF4A 1LU9A 1QIFA 3DFKA 1ZGBA 2YYSA 3WGVA 1YQ9A 1TCVA 1Q7GA 4NDNE 1A9SA 2HU5A 2J3IA 1BHO1 1U0NA 3DOHA 4URWR 1G4UR 3U4CA 4E1BA 5CB4A 3V7UA 3B89A 1HT3A 3OJFA 4PCAA 5LA6F 1CULC 1JF8A 4XGIA 5IHXA 5AW6A 5LNK6 2JEZA 1TCCA 2VP0A 1J56A 3M6MD 4YCCA 4FR5A 1XJ0A 1T0HB 3GU3A 4BB6A 4GU5A 2W6PA 4OGKA 2JZOA 1Z4NA 2GGSA 2WHEA 4IHAA 5E4TA 2BVNA 4D99A 3DV0B 2AE2A 4IV8A 1P4GA 3FUWA 4PX9A 3IDAA 1FLVA 1U1IA 3KYCA 2IUEA 3HKEA 3KYBA 2W43A 4N5DA 4EY5A 2NVBA 1GKYA 1UBFA 2PX8A 1N4AA 5EA2A 5DN6D 2JFBA 1XELA 5FAXA 4C1NA 1T1GA 3DZDA 3PSAA 4B3DA 4KRXA 2OBXA 1ZG3A 2ZIXB 4NEQA 1W36D 2W2KB 3GLIE 4A6EA 3V5NA 3T5PA 4RTKA 4HRAA 1G3QA 4PQRA 3L7LA 3OM8A 3IHWA 2PU5A 3LHKA 5H81A 4OFBA 3GIDA 2Z2IA 2HLDA 4PSAA 3GRAA 5B3JA 5CYGA 1UP6A 1FPQA 3R74A 1RP7A 2V45A 2WIGA 4GGMX 4KLZA 1DT5A 4CM5A 3HBMA 1E2MA 5E7QA 5JECA 5ILOA 1P29A 1ZRSA 3FDXA 3TEJA 3VMFA 3CE9A 1XU9A 1ZYUA 3AT1A 2XCOA 2WDZA 3FYUA 4NNJA 3I9V1 2R6HA 4D4MA 4OAPA 1I10A 3K1TA 1C9MA 4ZEVA 5ALKA 2G70A 4Y6LA 4ZOQI 5HILA 4YRSA 5JZ9A 1G2OA 5I8PA 1IQRA 1OIXA 2FSPA 4KMOA 1GLNA 5JO9A 1E1KA 2P2SA 2QYHA 3WGZA 1V41E 1UK9A 2BM9A 3HBAA 4FI3C 1LJLA 2I6QA 4PYNA 1D2MA 1GFSA 1L7NA 4JBNA 4ABYA 5KI6A 5JAQA 2XWJI 2NWQA 3FKSD 1BRMA 3GRCA 3M1LA 2I33A 3EWAA 4FB4A 1YUBA 5B6PA 1QU2A 3LRXA 3QE3A 2JGLA 1R8JA 3AVQA 3I5AA 2UUCB 1UMCB 1PGQA 3EIFA 4UJ5A 2HMUA 4EG3A 1NE2A 1JE1A 3X1JA 4QELA 3GJ3A 2VDNB 3OIDA 1Y1RA 5ABPA 2EP5A 1NAIA 5A4IS 5ITVA 1DCTA 1XKQA 2PGAA 4B3JA 8AT1A 1PX0A 3QIAA 4A9AA 4AZWA 1A7UA 4M1MA 4X1OA 1IXYA 1JIKA 4QGGA 3L8ZA 3Q6MA 4UNPA 2FEMA 3HJBA 4EB6A 4YUYA 2ESRA 4XQEA 1JKMA 2QTWB 3ORRA 2XIQA 1PFVA 1YCHA 1NZFA 1RWOA 1YFZA 1JI0A 2O54A 3OZ7A 1H8ED 3V4SA 1MZPA 4RTPA 1ZM7A 1MIOA 1WCIA 4JLOA 4PLZA 4KWCA 2C2MA 3RSHA 5IZ4A 3B6ZA 4RZSA 2GBGA 1V16B 4UTXA 1U9CA 2CXPA 5CW2A 4ARIA 2NMVA 1UBUS 1U98A 4R8RA 3WICA 2I3DA 9LDTA 1HWYA 1XRJA 4O1MA 4EHHA 3M6AA 5A02A 2BAGA 5B6JA 4X24A 1UBEA 4YAJA 4JYCA 4CMBA 5HKKA 5HTKA 3MWDB 5ICMA 3LL7A 2XF8A 3OT4A 2R2GA 1X13A 4MHTA 4A8TA 4TXNA 4D79A 1RKBA 2EZTA 4UASA 2QMZA 1DBSA 2QL5A 1R15A 1ZAKA 2Y1CA 1L7DA 1WO8A 2ATXA 3OZUA 1OFUX 2PT9A 2OQIA 3LFHA 4KX3A 3OPNA 2CNWD 2DT8A 3IIEA 3L84A 4HYQA 4DMHA 5A1TA 4QDUA 3ID6C 3JQEA 2CLMB 2QOEA 1X8JA 3CRVA 3O38A 1QIJA 4Q34A 1KL7A 3T0GA 3HYNA 4UUQA 4C4RA 4HLCA 1F0YA 1C0LA 4Q15A 4PZEA 1PWHA 1JXMA 1E2HA 4K9RA 2IE8A 4KGZA 1LNZA 5F73A 4D26A 2MSLA 1WS6A 3IP6A 3IT0A 3T54A 4DCGA 3NHMA 3VZRA 3KQVA 3THOA 2JLSA 4F11A 4BLWA 3UGKA 1E61A 2C8JA 1KZ6A 1EH5A 3ES9A 5DCLA 2QPLA 5D6OA 4ATNA 1OJLA 3NOXA 1RYDA 4JODA 2XQVA 3A1NA 1DAKA 3EZ2A 4C0LA 4UNQA 3IEMA 1Q15A 3MRVA 1S2MA 2WC1A 1JHVA 1T1RA 1BGWA 3X3HA 2WJZB 3KQQA 4IZIA 3FGNA 4YI3A 3IL2A 3W6OA 4Y67A 1H3EA 4I4LA 3WK4A 5HJ7A 1MO3A 3BA6A 4Q1FA 3NDJA 4RHYA 4ZT5A 4GI1A 4ERXA 2XMGA 2P62A 1S7GA 5LR6A 2FF5A 3IP1A 4CFZA 4JZYA 1JDJA 3O94A 4O4IA 3ZTWA 4NZPA 4D8TA 1FSFA 1IHOA 2H59A 2RGGA 2G0TA 4UVGA 3TWOA 5F64A 1Z22A 3OZWA 1EA7A 2OZEA 3DAHA 3JQ9C 3LYLA 4PO3X 4EENA 4DSAA 5CFOA 2L19A 1ICIA 4BWYA 3ABZA 3CTPA 1JXAA 2UV8A 1HLFA 2IZ7A 3KKZA 4QDOA 4DSOA 3BEOA 3I0NA 4Q3BA 5FQOA 2XMBA 4PGGA 5AW0A 1G41A 1ICEA 1RAEA 2BI4A 3OPXA 3QKSB 1KYXA 2E18A 3RUPA 4HZUB 5HKBA 3ZWMA 2X5XA 4QWWA 3UTDA 3DEAA 1P1RA 3SVTA 1NP3A 3NYQA 8ADHA 2QRNA 4UUNA 1SBZA 3N74A 3WWYA 1J5PA 3RSOA 2PS0A 4WUTA 1Z7BA 4NZYA 3VR4H 4RPCA 3S3TA 1I0IA 2HF9A 3SS9X 3C5HA 4QNRA 3KOUA 4HZIA 1BE6A 1F12A 2VQEB 4U9UA 1E63A 1W8IA 4XLZA 4AMGA 4YRFA 3KJFA 3T5BA 5AVXA 4BQQA 1SKUA 1M34B 4KMRA 1RACA 3TXXA 3UM9A 2MCFA 4U9HS 4A2CA 4C3OB 4AY4A 3DXYA 4DCJA 1WZ2A 3VNRA 4PLYA 2POCA 3DOOA 4P4NA 2JJMA 5SZIA 4B2IA 3F5SA 2OBYA 4JZKA 2DF8A 3L4EA 2B7CA 1Z0IA 4QPZA 3NDIA 4AN4A 3ONDA 4WCFB 4AJEA 3DVQX 3Q8WA 1NQAO 2ECOA 2Y27A 3KVRA 4Q02A 3U3DA 4CIAA 3KFLA 3K6RA 4YJ3B 4YAIA 1PVVA 2QTBA 2YOFA 2XEDA 2ZE7A 3K72B 1AKEA 3L0PA 3M6LA 5A03A 3EPPA 4S2UA 4CMEC 4GMFA 1KR2A 2HYDA 3RV4A 4WWHA 2CXQA 2NT3A 2Y1XA 3BIOA 3EXHB 5E1MA 5AW4A 1IM2A 3AW9A 3PL1A 1GAXA 3ZQUA 1N6PA 4RELA 3SYTA 2HRQA 3AQ4A 3PNKA 4WEQA 1YAHA 1F2UA 2RKWA 2Y68A 2VFAA 4JOQA 1SD1A 4R2XA 2OSBA 4YJHA 3RDPA 3WB1A 1ZFNA 4CXMA 1XZEA 2GZRA 3BF7A 3IR7A 5BV2P 1W19A 2IELA 4RLSA 5LQNA 1E2KA 3IAXA 2FZ5A 2CYCA 1Z0JA 5HXAA 1Y7HA 4EO4A 2ZRPA 5EFOA 3TR5A 5E9AA 2VWHA 4OB8A 3RS2A 3AZQA 2QVBA 1SN7A 1QE3A 2GEDA 3B12A 4AS3A 1I1NA 3GJZA 3HCAA 1I80A 3S2UA 2JFGA 2PAFA 2FYTA 5DN9A 2V97A 3SE0A 1QHIA 2G07A 1ZL0A 3V2GA 4E13A 4ZKDA 2Y3IA 1J0EA 3P0FA 1UDRA 3CX7A 2C59A 2C88A 4CG3A 1P3DA 2IZ1A 2AK3A 4G2TA 2NSJA 3OQIA 4W5QA 1QO9A 5F21A 1ODIA 5J40A 4A73A 1KDRA 5JDCA 3OE7A 3IP9A 1NBEA 1PJRA 2A88A 3B7PA 3B1XA 3AOEC 3MT9A 3D4PA 3RJ9A 3UJCA 2GPYA 3DHVA 3ON5A 4EUFA 3V7FA 4QGSA 1GT6A 1C1XB 3HMKA 4PSVA 4JU9A 2QMYA 2B69A 3ASUA 3QF4B 3UWSA 3NH9A 2DGDA 3RG2A 3LNCA 3P2JA 2O1XA 3PNLA 3SI7A 4CM6A 3QRWA 4C4SA 3ETJA 3EGDB 2HLPA 3OQ1A 4GH5A 2XTAA 4W1QA 4GVPA 2NSLA 1KQNA 3U13A 4EMBA 5MN6A 1GDHA 2WVAA 2IYUA 1K7XB 3RR2A 2IX9A 1E5VA 3U1TA 4WXEA 1JYSA 3BOSA 2A5YB 3E58A 4FGUA 3H1BA 4QDJA 2OWDA 5FBWB 1X80A 1CW2B 1J2UA 2EKBA 2P4UA 2QN7A 1X7YB 3DCNA 3HR7A 3W2GA 4V1CA 3QLJA 3PQ3A 1GGFA 3UICA 1JR3E 2P2GA 4WIAA 2XIJA 3C3XA 2J4FA 1L8XA 4EF4A 3CVWA 4LRUA 2FPOA 1T5BA 1EIWA 1M2FA 3JD0A 1G7CA 2BTQA 5CYFA 1EEHA 1A4UA 1LWNA 3W8FA 3Q3VA 4EGSA 1UF9A 3CEMA 3EVAA 1YSCA 1QKJA 1J70A 1O6ZA 3TVDA 3KBBA 2FSVA 4BLQA 7GPBA 1I30A 4N8EA 4D3YA 3FUTA 2NUAB 2X7JA 1CUUA 2H7YA 1UP7A 3LF2A 4JYBA 1JIXA 1EK0A 2OL4A 5HFAA 3RS7A 5JJBA 2BFFB 2ZJYA 3L4BA 4F8EA 4HWGA 4XFKA 1MTOA 5IG2A 1B16A 4HWKA 1YO6A 3DT8A 3BIWA 4DV5B 2ACWA 1UOPA 3ZV7A 1G64A 2E7ZA 2IYNA 2Z1DA 2C9YA 3NS7A 2FK8A 3ZU6A 4F9EA 4D7AA 2BEVA 1AC5A 4DMLA 1IZ8A 1GLVA 2LRHA 5KC9A 5EFZA 2XUOA 2WVHA 2N3ZA 2GXAA 5H02A 2HSEA 2YNMD 4RSHA 5E4JA 4EKYA 3OAAD 2OOSA 1LI4A 3PWTA 5HF6A 4IWYA 2CXRA 4RMIA 5JNSA 1W1WA 2CUKA 4I6JA 2BUAA 3HH8A 4Q21A 2DH6A 2YC4C 2PUWA 2WJVA 2JI6A 3GLKA 3NGLA 4AJKA 3VR5A 3LW8A 4RPHA 4PZDA 2I99A 4QUJA 1W9HA 3U5TA 4Y3UA 3DBHA 5BWCA 3NVDA 3GLGA 1BCRA 3N2KB 4XOIA 2GRAA 4IIDA 3KOWA 3LVQE 4F1WA 1WG8A 2IUTA 1YB4A 4L22A 4AMYA 5EWMB 1JG3A 4EITA 4LEIA 4Y6RA 2Z56A 1DIHA 5I7VA 1E89A 2PPVA 2Z4TA 1VPWA 3EUFA 4W5HA 1F4VA 1QK4A 2WT9A 3RRMA 5CDTA 3ER9A 4AS1A 4GXQA 2B8TA 3ZQKA 3GC6A 4AMVA 3IEVA 4PXAA 1JMYA 3IERA 4WASA 1Y34E 4CKZA 3UQYS 1JHXA 1VHQA 3WGKA 4E4YA 4FGSA 2VHEA 4CF6A 2ZB7A 3PIRA 2LIPA 4JKIA 4W4TA 3EZYA 1YWGO 1OVGA 3DAYA 3RYTC 4JKYA 3GNSA 5C8VA 2V7GA 2FPGA 1D6NA 2VZEA 3O8NA 1WZUA 4NBNA 1KVUA 3EWNA 1CNMA 4GHWA 4ND8A 3HUUA 4ZVTA 5M34A 2Q27A 2VQ6A 3TOVA 2QK4A 5EJ6A 2UZ0A 1RM0A 1GVHA 3DEZA 4O4HB 4MWOA 2GBCA 1N5MA 4P34A 3I9V6 4HDKB 1E6CA 3ZK7A 1YBAA 4EB8A 3S8YA 3LY7A 4L50A 3WO0A 4DRXA 2HV9A 4Y2XA 4DT1B 1ZZGA 4BMNA 4IJKA 1GTSA 3AU9A 4UUBA 1GU1A 1GDTA 2XLCA 4F3NA 2AQIA 2PZMA 4LNAA 1BWQA 3I05A 3V6LA 4BTLA 2X76A 3WWOA 1A5AB 4HGQA 3X1KA 4XCXA 2HNAA 1O77A 5FWNA 1QRRA 4BVLA 5EJ2A 1G5IA 3LE8A 4DXHA 2FN9A 421PA 3RASA 1C7RA 2DRIA 2YW2A 4QVGA 3SSNA 1VJ0A 4XGRA 5ALTA 1OFHA 4DLPA 1CHNA 1C4KA 1OSNA 3DD1A 3KTAB 4KU4A 4YXWA 2BY4A 4JR1A 1F8UA 2YDXA 4N5MA 3PQEA 4PPGA 4XYGA 4C5CA 5A4AA 2Q5LA 5B36A 1KS2A 1JDZA 4OMCA 2HJRA 2IDZA 5HPYB 4ZZ2A 1US8B 2V6BA 4YMSA 5DEOA 3RHZA 3PF8A 1AHIA 1J07A 2G1AA 3B5EA 1ZA1A 4WFJA 4D6YA 4ZJPA 5K8VA 1Z0FA 4GGPA 1YQTA 4LMAA 1QH0A 4TL9A 4K2HA 3L8CA 2RIRA 3LCCA 1SBYA 4A2QA 2FPIB 3ML1A 4Z9YA 5TF0A 3TCNA 4MGIR 3ANYB 5CDFE 1VLJA 2OHJA 3N0XA 3W5AA 3CZAA 1D4AA 4X6YA 4C6HA 5A9TA 3ZI7A 1QFSA 2E2WA 3H4MA 4FX5A 4QARA 1QO0A 3R6TA 1YZFA 3EHDA 3IJRA 4TV9F 2YWXA 4AS2A 5DNYB 4C7OA 3EDQA 1ID8A 4ESHA 4RD4A 4XTRA 1YOVB 2EATA 1XZDA 1UM8A 4PAQA 3J80A 4YEDA 3QELA 2H1HA 3O1HB 3CF4G 2AFHB 1M75A 1SZDA 2ZBFA 3L7KA 1LQ2A 4MHOA 4B83A 5J4KA 3CSSA 1JPUA 2QM8A 1VE9A 2WA1A 4KUGA 2VJMB 4OAOA 1YDWA 2ES4A 1BXZA 2WIKA 2ZKIA 2WU8A 2GPAA 3B3AA 4QFDA 3SDSA 4CHTA 1WDLA 3UMJA 4DLAA 2D2VA 1CR6A 4HDNA 5KTYA 1E58A 1YZVA 2WD7A 2O0HA 3O4VA 4KFSA 5FPPA 2IU0A 4U2DA 3DONA 3DAFA 2HB6A 4AWBA 1THGA 3O1IC 1M6EX 4MV0A 4L72A 2PX6A 5AH0A 3SHVA 2HN9A 2BV3A 2WW8A 1M8KA 4IMRA 1YI8A 1O97D 4NE7A 2Q4OA 4YRGA 2ABWA 3FYUB 3N07A 4EM6A 5IN4A 1FMFA 1AY0A 2C5SA 4IGAA 4WJKB 3RIMA 3A14A 3VAAA 3CNHA 1K08A 4U6QA 2I8CA 3DKPA 4KPYA 1ZH6A 4XWGA 1UPXA 3CINA 1CQIB 4P81A 2F00A 4OCZA 1U4SA 4Q4DA 4WW0A 2UDPA 3ZKWA 4LOJA 2W37A 5J4VA 3CYFA 1RCFA 2PH1A 2EZ9A 5KBYA 5AOCA 1AGXA 1SQFA 2AIRA 2N46A 4C06A 3PEVA 3LKZA 4NCIA 1QSGA 4RIFA 4PX2A 1X3SA 2A0UA 2X4LA 3ZZMA 2Q99A 3B9RA 4AZTA 3C1UA 4CIYA 5KSZA 3CKKA 3CVUA 1VLLA 1XSEA 1X1RA 3BHMA 2W8ZA 1A88A 1MAAA 1L7BA 5EUMA 1MA3A 3X2EA 2RGYA 4C6TA 5K3OA 3VA7A 2Y1KA 4RGQA 1BDIA 1CC1S 5EIXA 1ATZA 2XMQA 3JPWA 5B3AA 4MP8A 2OPBA 5HK8A 4I3FA 1K5PA 2HA4A 1IWPB 1G3MA 2DE0X 4OV6B 1YJQA 3G6WA 1FU4A 3A9WA 1QV6A 1R2QA 2GAFA 4IJMA 4LWPA 4FWTA 3VAZA 3MIIA 3WYCA 5CITA 3P1JA 1IZZA 3M7IA 4WN9B 3RKRA 3INYA 4UULA 1EFAA 4E5VA 1RRCA 4GUDA 1JLSA 3AOGA 3I8OA 4UXHA 5H3LA 3PUVA 2ZI7A 2RE8A 1DHTA 1O8BA 1M5TA 2P35A 2VDJA 2OLKA 2HEIA 2NUBA 4OYRA 4TV8A 3TLAA 1A69A 1MFPA 3BH0A 1G8GA 3MJFA 4BEJA 4LZNA 4UAGA 3BT7A 1D8AA 2YASA 3G88A 1CK4A 2VRNA 5C1IA 5IM4F 4C30A 5ICCA 3TRFA 1P1CA 3ZWNA 3RK0A 4F9TA 1EVEA 1AS2A 1TK3A 1N8NA 1NW8A 2K4MA 2YW9A 2ZJ8A 3USZA 1MCZA 3UQZA 4BKRA 5BY2A 1QRUA 1FL9A 2PMFA 4D8WA 3S7TA 4X9XA 1CE8A 2J0UA 5DHTA 2ZWPA 2RARA 3AZPA 3LY9A 4OLBA 5FWXB 3F6PA 4UDYX 1FRFS 2IYXA 4N5HX 3I5UA 5JWRA 4DDKA 1T26A 5C31A 2RD2A 3UUWA 2VDKB 1BDBA 2A33A 3K4PA 4HUQB 2O2CA 4O0LA 3RFXA 3RYHA 1TK9A 3T7CA 4BMSA 5IJWA 2PZJA 1SVKA 4QEKA 3V00A 2QX6A 4AMZA 5K4GA 2XMZA 1UKEA 4S1WA 1G5HA 2C77A 3DLCA 4H60A 1FDRA 3FFBA 2Z58A 3U19A 4J7XA 3FFWA 3NT2A 4WGGA 2QPAA 3UIEA 5BN4A 2AYXA 3LPLA 3SK0A 2Q8PA 4KQ2A 3HEAA 1QP4A 4ZZ1A 2VAMA 4QSHA 4L74A 2WEKA 1VSTA 2GLTA 2ON6A 5AI5A 3GBVA 2Y6UA 2EF0A 4Q9KA 3GZNA 5KDOA 1G98A 1WY5A 1NUPA 3QA3E 2IH4A 4LV6A 3RVOA 5JLJA 1KJWA 2FQYA 1JT9A 1T0PA 2FN4A 3NXKA 4WBNB 3MT7A 2OC9A 3E9QA 3PFGA 4MICA 3TW4A 1TU3A 2GTIA 4AB1A 2B3TA 2V6GA 3IAM1 5HFNA 3AF4A 4N8DA 4RKEA 3WKBA 1Z28A 4ZVKA 2O5EA 3G7NA 1F06A 1FVFA 1LNQA 5EP3A 5BRAA 4EBBA 1EB8A 2PBLA 3U1BA 4B6OA 3CRRA 1UBGA 2NU6B 1UJ5A 3HYSA 2PE5A 2YL2A 4RZHA 1HDXA 5LUBA 4MUYA 4LYFA 1TL7C 4BASA 5I7EA 2P9YA 1AURA 1Q0TA 1KC1A 3A32A 1XTTA 3BSSA 1YIDA 2NLOA 1JAHA 3GLUA 3MN1A 3NI2A 2YOHA 1C9DB 1U0GA 2OZKA 3KBOA 3O7WA 4R1PA 3WRYC 4BC0A 4CIBA 1KMQA 2VWPA 2ZRAA 2F67A 3K0EA 5A7HA 3V32A 4BFCA 3AESA 4NFYA 2DJ5A 1SNYA 5F78A 3U3KA 5HJ5A 1Q2UA 3HY4A 3HWSA 3TEMA 2H2WA 2NZ8A 3G0GA 3NV9A 2GNAA 4HQOA 2BUBA 1VKRA 4LJYA 4ZVQA 1TZMA 3W8RA 5J2TB 2J6BA 3D54D 4PANA 2GKGA 4V02A 3W5UA 3ZU5A 5AKXA 2VRWA 1O6BA 3OIFA 2QRKA 3WRXC 3IODA 3K30A 4BQFA 3Q5DA 1ZM3A 2HO4A 2JIBA 3UOAB 2YXNA 3GB9A 3VC1A 4E30A 1GUZA 3ANLA 5BMVA 4YO8A 3WYBA 4MI1A 1EXVA 3ZV4A 3NHRA 3ZS9A 4X7PA 5A71A 1T25A 1GUBA 1L3IA 2XYHA 1QZUA 1GGKA 1U8FO 1DV2A 3DP7A 1ACMA 2WE7A 3E18A 3PUHA 4HNAB 4QECA 4WZAB 3ZHVA 1W46A 4N3GA 3DBRA 4X20B 4DEVA 4W8GA 4CIXA 2EKZA 5KYWA 5JSFA 4RVSA 3K73O 5IDQA 1BD4A 1GPWB 3OSUA 4M9RA 1N4DA 1NXXA 4Q3CA 4L07A 2RJ3A 1TPZA 3CURA 3LCMA 2RAUA 4X3CA 3GFTA 3AR4A 4IV0A 2JL1A 2ZJ3A 3FUXA 4W82A 3GPBA 3P9IA 5BSEA 4IIVA 3P0IA 2Q2NA 3PI7A 2X9LA 4IFBA 2EX1A 2IV3A 4KXUA 4O2BF 5TVKA 1EG2A 1EGQA 1ZCAA 1B8VA 4JJIA 4XW2A 1U28C 4ER6A 4C3VA 3O31A 3DKRA 3ZDQA 4MI6A 4QJBA 3PHLA 1I9CA 3HDGA 4WKOA 3R0QA 3ZCQA 3AL0C 1AQUA 1KH3A 5DFAA 4EVIA 5CXQA 5JQWA 5ALHA 1KDVA 4HNGA 2IPNA 5GONB 3O83A 3QMWA 2E85A 5T57A 3TL6A 1AUVA 2BONA 1W76A 4DM7A 2W0SA 1OYOA 1KBZA 3SBDA 1FFWA 3ZNPA 3BRWA 4DIEA 3JR7A 3T4EA 2V03A 2L82A 1H23A 5NLLA 2IBSA 4ZK2A 1S2NA 4D5EA 2R751 4TVKA 3DZKA 5E4FA 3KKKA 4QRHA 2JK0A 3JQ7B 4MUMA 4PEVA 5TR9A 5TPZA 2P91A 4NDAA 3QI2A 1IH8A 1UIMA 3S1LA 3E9NA 4NLLA 4ZYXA 4CLRA 2B1RA 1A95A 2RH4A 3RWMB 3EGEA 4UOQA 5DI3B 4JLUA 1JHZA 1RBZA 2AEEA 1AUPA 4JNCA 4L2IB 4P1ZA 3RFVA 3FLEA 4QAQA 3WNQA 4F12A 3J81k 3JAMA 2IYRA 3A1DA 2FEOA 2BJHA 1SVWA 1HY3A 4JBLA 3W0LB 3VISA 5J4HA 2QNBA 3F4BA 5LQDA 1O5TA 4D3SA 4ZMSA 3UB3A 5JSHA 2XZDA 4HPJB 3EC1A 3NEPX 3DTVD 4KNWA 5ALRA 4HH0A 3VR2A 4Z51A 5JJ5A 4FNMA 4GE0A 1YRLA 3ZHOA 4HVLA 1JLKA 2QRVB 4B3BA 3LOQA 4LF5B 3E9RA 5C9ZA 3CEHA 1XDSA 4QM6A 2B83A 2ARKA 3KOOA 2R7NA 3E3LA 2G67A 4KGXA 4U2KA 4B4UA 4JIGA 1FLAA 1IG0A 4MPDA 1BSVA 5AK5A 1K7YA 1YUNA 3G2LA 5FWDA 1QGED 5FORA 4CT0A 1EDOA 1WPGA 1FSPA 1PR3A 5EHNA 3RODA 5HKAA 4W5OA 4RFSA 3S2GA 4JT2A 4KDRA 4LSZA 4CF7A 1T34A 1E1RA 3KO8A 1YS4A 2ZE5A 3WL8A 2RHGB 3X1XA 3BICA 3UUFA 1WHTB 2KSQA 3IIMA 2JHPA 1RYHA 4AKGA 3AJAA 5DCUA 4B84A 1SRRA 3PHIA 4K3UA 5C46F 4QASA 1X8XA 4RY8A 3D7RA 3Q7PA 4B4OA 1KO1A 1NZJA 1RLMA 1KSFX 4WN3A 4EHKA 3L79A 5B3JC 2NPOA 2AW3A 2OAQ1 2Z5GA 2HSWA 3AI1A 3IKVA 4MS4A 1NSTA 4TXJA 2BTQB 3AEZA 3AETB 3THWB 4D81A 2OENG 4LWQA 9ABPA 4V0LA 3TKAA 5GZ1A 1BROA 3MYRA 3UUEA 4R1UA 4RVGA 3FYUC 3GA0A 2PTHA 4HN9A 4D4IA 1U7TA 3CG0A 1RFGE 3RUDA 2GCPA 4GX2A 2IH2A 2H00A 3EQZA 5FOSA 1UEIA 1S6YA 4V38A 1JVBA 1P75A 1TTPB 1A9QA 2D06A 2XNHA 3CNEA 4EQZA 4WZBB 5F52A 1PL6A 8OHMA 4FEAA 2QA5A 1I2DA 4P4SA 4PSKA 1J39A 4JWKA 4JVMA 1BMQA 5JNVA 1KZ7B 1V1RB 5TQ2B 1OI7A 2AFIB 2VP4A 1OLSA 1USKA 1CEQA 2WYIA 5FUYA 3NWJA 1KERA 4R1LA 4WOPA 2ZCUA 3MUFA 5EUBA 4ETWA 5K6RA 4BBZA 5IF9A 4UREA 3W8NA 4B43A 4K9KA 5B55A 1KEEA 1KOGA 2NO5A 3FYHA 2XVAA 3B78A 4LC9A 1TX4B 2PYDA 4JITA 3HCEA 4IDFA 3WTCA 1CZOA 1MX5A 3P5BA 3Q15C 4FIDA 5D1HA 3BBLA 4Z1MA 4LV8B 3RTCA 1KK1A 2W2LA 3D8TA 1X8KA 1EFPB 3C3CA 2ZRDA 5FXMA 3CUUA 3RC7A 1NMXA 4O08A 1JDBB 2GDJA 3IQXA 4LHEA 1UBJS 4QBKA 4LGMA 2QRZA 2SBTA 2JHAA 3IO3A 2VHYA 2VNAA 3ONFA 4PSUA 4U0JA 3ZDRA 1RQ7A 2WK1A 1MV5A 4ILEA 1ESCA 5LBIA 3S99A 5F2EA 2ENUA 1C0IA 2CXHA 4IIJA 3DOJA 4MJLA 4URFA 1UBRS 2ZSBA 3TNLA 5JH7F 1V4BA 4JB8A 3VO9A 2C9BA 2C61A 4MQFA 4HJXA 3FHTA 4QO7A 4BZPA 3ROQA 5KOJB 3B70A 4MUKA 2ZRLA 2DKOA 3LFTA 1P2UA 1OGIA 1JQEA 4MR9B 1PK7A 1B74A 2QVGA 4ND8B 4RFLA 1BMFA 2R7KA 4X45A 3U61B 1MX1A 1TLFA 5F98A 1OKKA 3JS5A 3NOVA 1IOWA 4P3XA 2BEJA 3A9UA 3Q6IA 3QU5A 1V8ZA 4MUJA 2HPHA 1QG6A 1TADA 4AD8A 1IM8A 2PL1A 4A0HA 1WXEA 2ATIA 2Y1OA 2A35A 1USGA 4EW1A 4KLRA 2ZRFA 3EVTA 5J63A 4Y2GA 4PG4A 3QHQA 3SZMA 1QVZA 3B1VA 5AJTA 5EIHA 2AG5A 5DK4A 3O26A 5DNVA 2R1VB 1VYVA 2F1RA 3UJ9A 1E8NA 3VZCA 5A7FA 3TGLA 1I6MA 2PBRA 4X6LA 4HQ6A 3C14C 2VSFA 4FWIB 1CQJB 3BRSA 3TOXA 4H18A 3ZVRA 2VPQA 2VJOA 4HWSA 4MPPA 2CLCX 3WGUA 2JAQA 3NM4A 1OFTA 4NOKA 1DC3A 5FUWA 4U3JA 3DWEX 4Z1OA 3PXEA 5JJIA 4EGAA 2WG1A 4X91A 4MMYB 4YRBA 4LYYA 5DP2A 1YMUA 5J47A 3AERA 5A7GA 1J0XO 3CB2A 4RNCA 5GGYA 3VJLA 2HU8A 3BH6A 2VJPA 4OXQA 5IDVA 4RJTA 4D92A 1K8ZB 3FWPA 3MERA 1Y4UA 3MVEA 3ZDCA 1FFGA 2P6NA 3OZGA 1J23A 1TYAE 1CZRA 4JEUA 3T7RA 4B3TB 4B45A 4BCBA 2ZTSA 4N18A 1ZR2A 4OXKA 4FIZA 4E22A 3CF2A 5G40A 3WZLA 1QYDA 1WP9A 4M1SA 1SVUA 3FPSA 4LF8B 1ACJA 5AM4A 3RYFB 2Z6VA 4RVUA 1W87A 1E77A 3HN6A 1GRNA 1NW6A 2J30A 1C2TA 3PL5A 3VC2A 3AWDA 4Y9RA 4DNFA 5HW0A 4HJRA 1LS6A 5DGXA 4I14A 1MJGM 5CM2Z 3S4YA 4EJSA 3O03A 1N1GA 3DVLA 2C31A 4MRAA 4WOKA 4OEHA 3VPDA 4IIGA 1U31A 3IBSA 4GBJA 4PRZA 3EQ7A 3VU3A 3WS7A 1MC1A 2V55B 3I42A 5EUQB 2FWNA 1YT5A 1TD1A 2W6MA 2Q46A 5FJIA 1SXHA 3TLBA 3W5HA 2EG9A 4X64B 4TPKA 4E5PA 2WSLA 2C4HA 3H6HA 1KVRA 3IVGA 1A9TA 2DWQA 5U4XA 1E7SA 3JYPA 2LTAA 2Q50A 3G9UA 3IUQA 3MW8A 2XQGA 3NBKA 1H65A 3MILA 3C3YA 1GARA 3VZBA 1UZUA 2GILA 2I4TA 1G3RA 3PXXA 5DYGA 3W8EA 4J16A 3KQNA 1QZZA 4ZI7B 4FCTA 3MWLA 4JJ4A 1N77A 2AEMA 2QT1A 4L4ZA 3GF4A 3K0FB 2Z43A 1KEPA 2DB3A 5TQ0B 1UWLA 4JWTA 4TTAA 3MAAC 1N25A 1BXKA 1E1DA 3R0VA 4CV0A 4EFNA 2WWYA 2NP6A 2ZT5A 4BMOB 1Q22A 1T43A 4CQLB 5GQSA 5DYIA 3UK7A 4GOLD 4OHVA 5JSQA 4DQVA 5KPDA 2Z8ZA 1EE2A 2FSSA 4LXQA 3ZHXA 5IJ0A 5I7RA 2FPLA 5LD2C 3BXFA 4YTEA 2FKNA 5KTPA 2AQ8A 1JRLA 5J58A 2PT5A 3RO7A 1SURA 1FJXA 4TUYB 4R6XA 3UB4A 4LJSA 1RKVA 4JJ6A 4M1YA 3SN6A 2IPOA 4YACA 3LWNA 1F2VA 4YJ2F 1AXEA 1FDTA 2AF3C 3MGKA 2P6MA 2V7BA 3E61A 5FOWA 2QAGB 3OFNA 2P9HA 5BRNA 2AZXA 1VI5A 4UUOA 3HXKA 5D51S 2RGEA 1NIJA 1OWPA 5AXBA 5A0FA 4F46A 4G56A 3ZCRA 3MFQA 4EHIA 1E1QD 2Y0CA 2CJWA 4YP5A 1E2QA 1H5QA 5FA6A 1ORWA 2OO5A 1QYCA 3U26A 2XWBF 3K9HA 1MQSA 5BW5A 1VHWA 3PNPA 4CCAA 5JYDA 1RTKA 3AF0A 1E6WA 2QJFA 2NU9A 2ZJ1A 4ZOLB 2BGUA 4DJFC 1THTA 4HOYA 4I8DA 3S28A 4A92A 3I9JA 3JZIA 1WZIA 5D3MB 1I32A 4YT2A 2VT2A 2VJQA 1CNFA 3SD7A 2UYQA 4KJZA 2AQHA 4RE6A 4NE2A 1JHAA 3A1WA 3FOEC 2AJDA 4L0QA 4NYIR 3DMYA 3KSDO 1HE5A 1R9MA 4L5CA 4BP8A 3HBLA 4FX2A 4NXNB 2GLUA 3R8XA 1CX9B 4F5EA 4AJPA 1RYFA 1U3CA 3D3KA 3TYXA 1LVGA 1XEXA 4HATA 2E1PA 4NULA 5JDCC 2J9RA 3COSA 4AY3A 3RT9A 3V2UA 1OVMA 4OIFA 3ZYCA 2YHIA 5AVWA 1MH9A 3GVHA 4R8KA 2PPLA 3T12A 2KW5A 3AJ9A 1P9LA 1UPUA 3FHLA 4L73A 4MWGA 1XFAA 3G2MA 5A3VA 1U7ZA 1B7GO 5C8YF 3JQCA 2HK9A 1ENPA 3EZFA 3OI7A 5B1SA 3V6MA 4K8RB 4KV7A 3QX8A 4PLHA 5JEEA 5KWVA 3KLMX 3UXMA 3ZCXA 3UJ7A 2ET6A 4L0MA 2XHEA 2PTGA 3MWFA 4V1CI 2ZBGA 3N9IA 1M0EA 3IAFA 1GP2A 4ZXPA 1F6DA 1GZ3A 1MC4A 1UMKA 1ZWKA 2GARA 3E9DA 5ALOA 4IRMA 4RD0A 2B37A 4V2IA 2PMEA 5AVYA 3KAQA 1VMDA 1J33A 2RGWA 2INGX 2HV8A 4EEZA 3SXUA 2PRZA 1IZ7A 3IV6A 3JQ8A 3KJZA 4NQRA 3VR1A 3ZOZA 5IHPA 1CF4A 2DZDA 4F38A 1GQFA 1KAOA 3H19A 5B1HA 4YY3B 4TZKA 2ZXEA 1JZSA 3GZNB 4D6XA 1Y63A 3MIZA 2QB5A 2PRIA 3H1PA 4LYAA 4MTCA 3W3AD 1YVPA 1W0KD 1O95D 2FSVC 1TDJA 5BUZA 3K9FC 2JHFA 2JJ2A 2WIDA 3SR3A 1M74A 3CVYA 4MYDA 2NV2B 2F1JA 1MAVA 3H9JA 4JC0A 4YPVA 1CVLA 3L4BC 4AUKA 4NJMB 4BXOA 3PYXA 4JASB 4NEGA 1NN5A 4U5XA 1C30A 3IVXA 1YU6A 3A9SA 1G6OA 3K0AA 3T3GA 3SQLA 5I7FA 3M5CA 1V3QE 4BX3A 4DIFA 1W5FA 1PBNA 4L0DA 1CUHA 3MJCA 1V6CA 2JJ1D 3KPVA 3Q3GE 1SHTX 4BO0A 1BKYA 1YIAA 2HWUA 3BSFA 1KRWA 1SEPA 2OV8A 1IHXA 1RFLA 1C3VA 3E5HA 3IPCA 5KTKA 3WZ2A 3L6OO 5EKUA 5TJ9A 2POQX 5A05A 4Q19A 3W7VA 2PX3A 3C98A 2IY7A 4DR5B 2BSQA 3JD4A 2XUKA 3VH2A 2ETVA 4Y6GB 4CL8A 3DOIA 4ME6A 5P8WA 2O8DB 4HDQB 3G7SA 3ZLVA 4ZVSA 1JR6A 1FPMA 3QG5A 1Z6PA 1NOJA 1C1DB 1F0KA 3U3RA 3QBJA 4NDZA 2CNNA 1RQRA 3K94A 5L7TA 1KI4A 3F4KA 4D74A 2CE2X 1RMQA 3ZW9A 1ESZA 5CJ2A 2IF2A 3ZYZA 3QVTA 1NUQA 4LJ4A 2IXEA 4DYHA 4GX5A 5J2UF 4PONA 2I7TA 2IC5A 3UPDA 3WB9A 4B3CA 1AA9A 4KQGA 1JLHA 5PNTA 4MVJE 3SJUA 5AP9A 2ZPUA 2ID8A 2IU3A 3GD7A 3ZWPA 1XQ1A 3KIPA 1F6BA 2F4VB 2FWMX 3ZD7A 4NONA 2HQOA 4X54A 2CD9A 2V6JA 4G86A 1P6UA 2VDWA 2R8RA 2FR0A 2H1CA 3ABQB 3JAWB 1I7PA 1EWRA 3P9NA 4G0ZA 5E6RB 3RJZA 1S2LA 3TZCA 4Q4AA 3ESYA 3MQ4A 4X1KB 3CRW1 3VC7A 3C48A 4OGFA 1L5KA 4ZHQF 2PZKA 4LHVA 5K51A 5T41A 5JFOA 2CVQA 4DJEC 5A4MS 1FUKA 1MB2A 1Y1LA 2YZ2A 2YMQA 3BREA 4NSNA 1K75A 4C7VA 3AY3A 1YC5A 1TYBE 4IJWA 3SKYA 4LRTB 4V3CA 3E48A 4GLFA 4DA6A 1UC5B 3IUMA 4TLAA 4ZDKA 2EXXA 4Q12A 3U3JA 1ZKDA 4PO9A 4RAOA 4F2HA 2GHRA 2XODA 4OM8A 1BMDA 4UBOA 1CIPA 3O21A 3WL5A 3B9BA 1C41A 3V8MA 4XIJA 2P2NA 5LPNA 1EVYA 5KX5A 2C9OA 3ZLBA 1KGDA 1V8DA 2XUZA 3HPQA 5K3SA 3F5MA 3R4CA 1NPTO 5CDHA 1LTHR 1EWTA 2AG0A 4FJ1A 1DBPA 4OLJA 2WAXA 3EXG1 3GFRA 3E03A 3NHZA 4G5SA 4YB8A 1PG2A 3PKIA 3QKRA 4JBGA 1FFBA 3VYVA 3E9MA 3R5FA 1PV2A 2IS2A 1OFUA 3I9MA 3ZDAA 3AXTA 1ZGGA 1VIMA 2IP1A 3HYLA 4I1SA 2F3PA 4QYIB 3TK1A 3HHPA 3N59A 2XZLA 1QDUA 1KDZA 1NX6A 3AFIA 2QGNA 5IP5A 5KYTA 2V7QA 3C3WA 1ZGJA 1KO4A 3SOZA 2ZRHA 5HQJA 5AJUA 2PRJA 3QUTA 2F2TA 2X0KA 1TVEA 2L17A 2VDQB 1FU8A 1ECFA 2WUFA 3ESZA 1KQOA 4LHSA 2RHTA 2R8BA 5AXCA 4W5RA 1UK8A 2OBFA 2XZPA 3T1NA 3EEOA 1BCSA 3C7CB 5JQGF 1TK2A 1PR1A 3TQOA 4PQGA 2ONKA 3QYPA 3TB6A 1HH4A 3O4IA 3Q2KA 3I3SR 4ZWNA 2BGGA 4ZU6X 4BJ6A 1VLVA 3M6UA 2G08A 1PFUA 3LC2O 4IMPA 1WXFA 3ZNNA 3C6BA 1VLQA 4I19A 3HUTA 3U4AA 4BRSA 3F98A 1SQ0A 3H1AA 1IN7A 3TX2A 3DE3X 2X9GA 4OUKX 2F8TA 3U3MA 4UMVA 2DBRA 3ZWOA 2NO4A 3ERCA 1VMEA 4MVJG 4XIGS 2OGSA 2C3PA 1FP4A 1OYWA 4EAAA 4H27A 5IK2D 5L3SB 1QMPA 3BJIC 5LQSA 1YB1A 3DMTA 4J3NA 5KOYA 1Q1BA 3NEJA 3RVDA 2QR5A 5FOTA 4MS4B 1HEUA 3FDZA 5LLDA 1UIRA 4G0NA 4DJ5X 5JARA 1JUDA 2WM8A 4QGBA 5ES3A 1N75A 2CDNA 2MSNA 3BPSA 3JSXA 4WXYB 1FTWA 5HIMA 3TW0A 1GSOA 3O8OA 3T7DA 4YMGA 4I1YA 1Z4IA 2TMGA 4EFLA 3QFSA 4OJYA 3O73A 3OQNA 1RRPA 5ERGB 5JD4A 3PJEA 2GM3A 1AV7A 5CTJA 5HYVA 1H4QA 1W85A 2HBQA 3QGMA 1P1HA 3N5KA 1ZS9A 1P33A 2XDWA 5FIUA 3VR6A 1NQTA 2G5TA 1ZN9A 1LSSA 2O7QA 4UQOA 3T9DA 3TSOA 5EMMA 4K6FA 1FRVA 3OZEA 3PXUA 3Q9LA 2R7AA 4N5LA 2G6TA 1PR5A 1SH7A 3L6DA 3DA8A 5IDYA 3HL4A 3V1TC 2HREA 1WV1A 1HL7A 2J4DA 4RIEA 5BW6B 2F3UA 3TD6A 1T3SA 4NC9A 1KWGA 4R2KA 1M7GA 2NXEA 1QC5B 3PDHA 1P2TA 1VMAA 1NVUQ 4MKZA 3GCDA 2Z83A 4MV9A 4MIEA 4PC7A 4KR9A 1O58A 2X8AA 5KTNA 4BNIA 3MJVA 1DIGA 1T2EA 4OFWA 1G20A 1ZVJA 1Z0DA 4C0BA 3BWVA 1Z2CA 2QN6A 4ASUA 1WXQA 4YI5A 2DFVA 1N34B 5A62A 1UJNA 2I2XB 4FNGA 1L5HB 1YL6A 2ZWIA 4OFXA 4ARSA 2R1ZA 2YN0A 2DUJA 4K6MA 3KUDA 3UJHA 4TZTA 3BE4A 4DQXA 1JW9B 3GG2A 3CWQA 1FUIA 2E4WA 2H29A 2V7EA 1VRVA 4JBWA 1ZZEA 2QQ0A 4KXWA 5GV7A 1MNAA 1ZM2A 4CV1A 3COZA 5KTTA 2X5KO 2ZSIA 4EF5A 4WESA 2AG1A 3Q12A 3ADPA 5TEWA 3MCZA 1C8VB 2J6IA 1EQ2A 1ZIOA 2RHMA 2J9YB 4HFNA 4MEJA 1QLWA 2Z30A 1A9YA 2ZROA 3ECCA 3ESCA 3JXEA 3QVLA 1LXCA 2A3RA 4UBNA 4F5YA 4RD6A 4L75A 1AQLA 4Y2QA 2PA0A 3IIJA 2MMCA 2WG0A 1A9XA 6CHYA 1QFYA 1UODA 4DNXA 4WLVA 4YP9A 1K5GA 4Q1VA 2C2WA 3BIXA 1NBAA 4LFCB 2V1UA 1EGVB 1UANA 3DTNA 2MIIA 2WINI 3GH3A 1XNJA 2X14A 4NG4A 5T67A 4LFBB 5JCXA 5LJLA 3TVTA 1L7XA 2PH7A 2BYTA 4G97A 3EB9A 2O8BA 2CDBA 3R5XA 4H1HA 3QQ5A 3WBJA 1FXWF 1S2GA 1CUZA 4Z4QA 2IYWA 2EG5A 4J90A 4WFKA 4RWEA 4OP2A 2WE8A 5CFNA 2BEWB 3KCNA 2OFXA 3PYLA 5KS2A 3PFIA 3FCUB 1BX1A 1A82A 1SWVA 2ASEA 2Z3WA 3UNXA 3W4KA 4DQDA 5K4HA 1IM5A 3LXRA 1E9DA 3WBKA 2NAPA 5AJYA 2C00A 4MH0R 2BH2A 4AW9A 3GFBA 1ZHHA 1V11B 2YQZA 3PX7A 2GTHA 4H6VA 4DUYB 1V48A 4N01A 1O5IA 1ESDA 1XCOA 2PJDA 3PNMA 3UJBA 3HBFA 3FAKA 1P8AA 3F9CA 1NJGA 2P9ZA 3EDCA 1U0JA 4KPGA 3E3OA 2J5KA 2ZXUA 1FE8A 1M6HA 4BGDA 2H85A 2B4RO 2XVZA 2UZ1B 3LV8A 1PT6A 2ZWOA 5JADA 3ZCVA 4UHBA 1D8TA 4DXDA 5I7WA 4MROA 1RC1A 2D0PB 4TSFA 3NIDB 5C52B 5BV7A 4U2CA 1KDPA 5A6SB 3L07A 3NR2A 1R6TA 2Q6IA 1T9HA 1Y7IA 3UAZA 2XKJE 5BV0A 4QDXA 1BEUB 3Q10A 2DX7A 4BLOA 3LIIA 2CLLB 3EVGA 2VJYA 3T06B 3WADA 2F9LA 4BGUA 3ZVMA 2Q8NA 3ACBA 3CLRD 4LJRA 2VJCA 1W5TA 4Q3OA 5BUSA 3H18A 3ZWKA 2FPPB 4P0TA 5FB3A 1HE2A 3AEYA 3OIUA 3OFJA 2O06A 3LX5A 1I3KA 1B6GA 2VSOA 3HFSA 4DA4A 1F2TA 1KPGA 3FSGA 4QLOA 1VGRA 2CLHB 1FNMA 4BFLA 4P83A 4ALJA 5DISB 2H31A 5GZ3A 3CSUA 4NBKA 2WNSA 3MRXA 4NZOA 3VZSA 2DWCA 5EJ4A 3BUSA 5HIAA 5JYBA 3NT5A 2QD4A 3LC0A 4I6GA 4UDXX 1Q0SA 4K88A 5J4YA 4MRMA 2OMEA 3A2MA 3OZVA 1O3YA 2QM7A 5LLTA 2AKAB 1LRLA 1OE0A 4M2LA 3RC3A 4EFKA 5IDXA 1HF3A 2A30A 1UZAA 1XK7A 1YBHA 1ZNYA 3HG7A 4DFDA 2VHQA 5IANA 3RVQA 3VSEA 1N0HA 4BWVA 1UJ4A 1X92A 2B4QA 2PQ0A 4AMUA 4AIRA 3JARB 1U6KA 4E14A 2J7PA 5GV8A 4ZKEA 1QHFA 4RV9A 1FMTA 3ZIDA 4XM2A 4B9EA 4ZIRB 1AF4A 4UQPA