1FZ3E

Methane monooxygenase hydroxylase, form iii soak at ph 6.2 (0.1 m pipes)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E02
1FZ6E 1MTYG 1XMHE 1XMGE 1FZHE 1FZ4E 1XVEE 4GAMC 1MMOG 1XVFE 1XVGE 1FZ7E 1FZ1E 1FZ5E 1FZ2E 1XMFE 1XVDE 1FZ9E 1XU5E 1FZ8E 1MHYG 1FZIE 1FZ0E 1XVCE 1MHZG 1XVBE 1FZ3E 1XU3E 1FYZE
chains in the Genus database with same CATH superfamily
1FZ6E 1IG9A 4KI6A 1XMHE 3L0MA 2MZWB 4FJGA 2E31A 3V7DB 3QEWA 4ICGC 2P5OA 3HGLA 4FJ5A 2ATQA 4FJ9A 3MKSB 4DTSA 4JRQA 3QEIA 3LDBA 1XL3C 2VIXA 4HCBA 1FS1A 1XVDE 2JPNA 4KHSA 1XU5E 2OVQB 2B1EA 4JS4A 4FJNA 4I9LA 3NAEA 3SPZA 1FZIE 4FJJA 4FJKA 1FZ0E 4FK4A 4ADNA 2VJ5A 2MMBA 2P5GA 1MHZG 4DTNA 2FYOA 1XVBE 2P1MB 3S9HA 3UO2A 4DU3A 2P1QB 3SUQA 2DTUA 5H37A 1LDKE 4FVMA 2B8IA 3NHGA 3NCIA 3LZJA 2JQTA 4I9QA 4FJXA 2YB5A 1MTYG 4DTXA 3NDKA 4DTJA 5IBKB 3E4YA 1XMGE 3UO3A 3TAGA 3SI6A 3NGIA 2PFTA 4M42A 4M3UA 1XVGE 2E32A 2K5SA 4EYWA 1IH7A 4DTMA 3QNNA 3SQ4A 3RMBA 2OYQA 3RWUA 4M3TA 2DEBA 4ADOA 2OZMA 3L2OB 3OGMB 3C6PB 3NE6A 4HCCA 3SQ2A 4J2EA 2RKHA 3RMDA 1FXXA 3LD8A 3SUNA 3OGLB 4J2BA 1WAFA 4DU4A 3KD5E 2H4TA 3HGKE 4JRPA 1N1CA 1XVCE 4M3ZA 4FJLA 2JHPA 2JH8A 3SVIA 1FZ3E 4JS5A 4AKGA 1Q9XA 2PFVA 3SPYA 3TJYA 3TAEA 4X5MA 3TABA 4FJIA 1FYZE 4M3RA 3UIQA 2B7MA 3QEVA 1Q9YA 4M3YA 3BVOA 3HL8A 3RMAA 1XVEE 4J2DA 2FW3A 4EPHA 3L1NA 4FK0A 2VJ4A 3RMCA 4AKIA 1FZ7E 4M45A 4RL5A 3SUOA 1FZ5E 1FZ2E 4IT5A 3TAFA 4KHUA 3LDSA 2OVPB 4DTRA 4RNGA 4FJMA 3SQ0A 2DY4A 5IZ7A 2JHAA 1JW2A 4J2AA 4DTUA 3QNOA 3K2OA 4AKHA 2RCUA 4DTOA 4E3SA 2P1NB 4DU1A 3SCXA 4M3WA 4M41A 1FPOA 3J27A 2P1OB 4FJ8A 3QEPA 3QETA 3E4WA 3QERA 2OZSA 3TL8B 4M3XA 2LF3A 3HP9A 4FK2A 2HD0A 3WSOA 4KHWA 1WAJA 3CFRA 4KI4A 3CFPA 3CFOA 3SQ1A 4KHYA 2LF6A 4B08A 2MW2A 1FZHE 1CLQA 1FZ4E 3OGKB 4GAMC 1MMOG 1XVFE 3C6NB 4QNCA 3SJJA 5IREA 4I6JB 4DTPA 3QESA 3N1BA 3L8BA 1P22A 4E4BA 4KHQA 1FZ1E 4X5NA 2JHCA 1NEXB 4QNDA 3QEXA 1XMFE 4FJHA 4EP9A 1FZ9E 2QXFA 1FZ8E 3LZIA 3SNNA 2JH9A 3C95A 1MHYG 3J2PA 3SUPA 4KHNA 4RG8A 2P1PB 2OVRB 3N1EA 3CQ8A 4AI6A 3KD1E 1XU3E 3C94A 3C6OB 4FJ7A
chains in the Genus database with same CATH topology
1FZ6E 1IG9A 4KI6A 1XMHE 3L0MA 2MZWB 4FJGA 2E31A 3V7DB 3QEWA 2P5OA 3HGLA 4FJ5A 2ATQA 4FJ9A 3MKSB 4DTSA 4JRQA 3QEIA 3LDBA 1XL3C 2VIXA 4HCBA 1FS1A 1XVDE 2JPNA 4KHSA 1XU5E 2OVQB 2B1EA 4JS4A 4FJNA 4I9LA 3NAEA 3SPZA 1FZIE 4FJJA 4FJKA 1FZ0E 4FK4A 4ADNA 2VJ5A 2MMBA 2P5GA 1MHZG 4DTNA 2FYOA 1XVBE 2P1MB 3S9HA 2DTUA 4DU3A 2P1QB 3SUQA 5H37A 1LDKE 4FVMA 2B8IA 3NHGA 3NCIA 3LZJA 4I9QA 4FJXA 2YB5A 1MTYG 4DTXA 3NDKA 4DTJA 5IBKB 3E4YA 1XMGE 3TAGA 3SI6A 3NGIA 2PFTA 4M42A 4M3UA 1XVGE 2E32A 4EYWA 4DTMA 1IH7A 3QNNA 3SQ4A 3RMBA 2OYQA 3RWUA 4M3TA 2DEBA 4ADOA 2OZMA 3L2OB 3OGMB 3C6PB 3NE6A 4HCCA 3SQ2A 4J2EA 3RMDA 1FXXA 3LD8A 3SUNA 3OGLB 4J2BA 1WAFA 4DU4A 3KD5E 2H4TA 3HGKE 4JRPA 1XVCE 4M3ZA 4FJLA 2JHPA 2JH8A 3SVIA 1FZ3E 4JS5A 4AKGA 1Q9XA 2PFVA 3SPYA 3TJYA 3TAEA 4X5MA 3TABA 4FJIA 1FYZE 4M3RA 3UIQA 2B7MA 3QEVA 1Q9YA 4M3YA 3HL8A 3RMAA 1XVEE 4J2DA 2FW3A 4EPHA 3L1NA 4FK0A 2VJ4A 3RMCA 4AKIA 1FZ7E 4M45A 4RL5A 3SUOA 1FZ5E 1FZ2E 3TAFA 4KHUA 3LDSA 2OVPB 4DTRA 4RNGA 4FJMA 3SQ0A 2DY4A 5IZ7A 2JHAA 4J2AA 4DTUA 3QNOA 3K2OA 4AKHA 2RCUA 4DTOA 4E3SA 2P1NB 4DU1A 3SCXA 4M3WA 4M41A 3J27A 2P1OB 4FJ8A 3QEPA 3QETA 3E4WA 3QERA 2OZSA 3TL8B 4M3XA 2LF3A 3HP9A 4FK2A 2HD0A 3WSOA 4KHWA 1WAJA 3CFRA 4KI4A 3CFPA 3CFOA 3SQ1A 4KHYA 2LF6A 4B08A 1FZHE 1CLQA 1FZ4E 3OGKB 4GAMC 1MMOG 1XVFE 3C6NB 4QNCA 3SJJA 5IREA 4I6JB 4DTPA 3QESA 3N1BA 3L8BA 1P22A 4E4BA 4KHQA 1FZ1E 4X5NA 2JHCA 1NEXB 4QNDA 3QEXA 1XMFE 4FJHA 4EP9A 1FZ9E 2QXFA 1FZ8E 3LZIA 3SNNA 2JH9A 3C95A 1MHYG 3J2PA 3SUPA 4KHNA 4RG8A 2P1PB 2OVRB 3N1EA 3CQ8A 4AI6A 3KD1E 1XU3E 3C94A 3C6OB 4FJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ6 E;  1MTY G;  1XMH E;  1XMG E;  1FZH E;  1FZ4 E;  1XVE E;  4GAM C;  1MMO G;  1XVF E;  1XVG E;  1FZ7 E;  1FZ1 E;  1FZ5 E;  1FZ2 E;  1XMF E;  1XVD E;  1FZ9 E;  1XU5 E;  1FZ8 E;  1MHY G;  1FZI E;  1FZ0 E;  1XVC E;  1MHZ G;  1XVB E;  1FZ3 E;  1XU3 E;  1FYZ E; 
#chains in the Genus database with same CATH topology
 1FZ6 E;  1IG9 A;  4KI6 A;  1XMH E;  3L0M A;  2MZW B;  4FJG A;  2E31 A;  3V7D B;  3QEW A;  4ICG C;  2P5O A;  3HGL A;  4FJ5 A;  2ATQ A;  4FJ9 A;  3MKS B;  4DTS A;  4JRQ A;  3QEI A;  3LDB A;  1XL3 C;  2VIX A;  4HCB A;  1FS1 A;  1XVD E;  2JPN A;  4KHS A;  1XU5 E;  2OVQ B;  2B1E A;  4JS4 A;  4FJN A;  4I9L A;  3NAE A;  3SPZ A;  1FZI E;  4FJJ A;  4FJK A;  1FZ0 E;  4FK4 A;  4ADN A;  2VJ5 A;  2MMB A;  2P5G A;  1MHZ G;  4DTN A;  2FYO A;  1XVB E;  2P1M B;  3S9H A;  3UO2 A;  4DU3 A;  2P1Q B;  3SUQ A;  2DTU A;  5H37 A;  1LDK E;  4FVM A;  2B8I A;  3NHG A;  3NCI A;  3LZJ A;  2JQT A;  4I9Q A;  4FJX A;  2YB5 A;  1MTY G;  4DTX A;  3NDK A;  4DTJ A;  5IBK B;  3E4Y A;  1XMG E;  3UO3 A;  3TAG A;  3SI6 A;  3NGI A;  2PFT A;  4M42 A;  4M3U A;  1XVG E;  2E32 A;  2K5S A;  4EYW A;  1IH7 A;  4DTM A;  3QNN A;  3SQ4 A;  3RMB A;  2OYQ A;  3RWU A;  4M3T A;  2DEB A;  4ADO A;  2OZM A;  3L2O B;  3OGM B;  3C6P B;  3NE6 A;  4HCC A;  3SQ2 A;  4J2E A;  2RKH A;  3RMD A;  1FXX A;  3LD8 A;  3SUN A;  3OGL B;  4J2B A;  1WAF A;  4DU4 A;  3KD5 E;  2H4T A;  3HGK E;  4JRP A;  1N1C A;  1XVC E;  4M3Z A;  4FJL A;  2JHP A;  2JH8 A;  3SVI A;  1FZ3 E;  4JS5 A;  4AKG A;  1Q9X A;  2PFV A;  3SPY A;  3TJY A;  3TAE A;  4X5M A;  3TAB A;  4FJI A;  1FYZ E;  4M3R A;  3UIQ A;  2B7M A;  3QEV A;  1Q9Y A;  4M3Y A;  3BVO A;  3HL8 A;  3RMA A;  1XVE E;  4J2D A;  2FW3 A;  4EPH A;  3L1N A;  4FK0 A;  2VJ4 A;  3RMC A;  4AKI A;  1FZ7 E;  4M45 A;  4RL5 A;  3SUO A;  1FZ5 E;  1FZ2 E;  4IT5 A;  3TAF A;  4KHU A;  3LDS A;  2OVP B;  4DTR A;  4RNG A;  4FJM A;  3SQ0 A;  2DY4 A;  5IZ7 A;  2JHA A;  1JW2 A;  4J2A A;  4DTU A;  3QNO A;  3K2O A;  4AKH A;  2RCU A;  4DTO A;  4E3S A;  2P1N B;  4DU1 A;  3SCX A;  4M3W A;  4M41 A;  1FPO A;  3J27 A;  2P1O B;  4FJ8 A;  3QEP A;  3QET A;  3E4W A;  3QER A;  2OZS A;  3TL8 B;  4M3X A;  2LF3 A;  3HP9 A;  4FK2 A;  2HD0 A;  3WSO A;  4KHW A;  1WAJ A;  3CFR A;  4KI4 A;  3CFP A;  3CFO A;  3SQ1 A;  4KHY A;  2LF6 A;  4B08 A;  2MW2 A;  1FZH E;  1CLQ A;  1FZ4 E;  3OGK B;  4GAM C;  1MMO G;  1XVF E;  3C6N B;  4QNC A;  3SJJ A;  5IRE A;  4I6J B;  4DTP A;  3QES A;  3N1B A;  3L8B A;  1P22 A;  4E4B A;  4KHQ A;  1FZ1 E;  4X5N A;  2JHC A;  1NEX B;  4QND A;  3QEX A;  1XMF E;  4FJH A;  4EP9 A;  1FZ9 E;  2QXF A;  1FZ8 E;  3LZI A;  3SNN A;  2JH9 A;  3C95 A;  1MHY G;  3J2P A;  3SUP A;  4KHN A;  4RG8 A;  2P1P B;  2OVR B;  3N1E A;  3CQ8 A;  4AI6 A;  3KD1 E;  1XU3 E;  3C94 A;  3C6O B;  4FJ7 A; 
#chains in the Genus database with same CATH homology
 1FZ6 E;  1IG9 A;  4KI6 A;  1XMH E;  3L0M A;  2MZW B;  4FJG A;  2E31 A;  3V7D B;  3QEW A;  2P5O A;  3HGL A;  4FJ5 A;  2ATQ A;  4FJ9 A;  3MKS B;  4DTS A;  4JRQ A;  3QEI A;  3LDB A;  1XL3 C;  2VIX A;  4HCB A;  1FS1 A;  1XVD E;  2JPN A;  4KHS A;  1XU5 E;  2OVQ B;  2B1E A;  4JS4 A;  4FJN A;  4I9L A;  3NAE A;  3SPZ A;  1FZI E;  4FJJ A;  4FJK A;  1FZ0 E;  4FK4 A;  4ADN A;  2VJ5 A;  2MMB A;  2P5G A;  1MHZ G;  4DTN A;  2FYO A;  1XVB E;  2P1M B;  3S9H A;  2DTU A;  4DU3 A;  2P1Q B;  3SUQ A;  5H37 A;  1LDK E;  4FVM A;  2B8I A;  3NHG A;  3NCI A;  3LZJ A;  4I9Q A;  4FJX A;  2YB5 A;  1MTY G;  4DTX A;  3NDK A;  4DTJ A;  5IBK B;  3E4Y A;  1XMG E;  3TAG A;  3SI6 A;  3NGI A;  2PFT A;  4M42 A;  4M3U A;  1XVG E;  2E32 A;  4EYW A;  4DTM A;  1IH7 A;  3QNN A;  3SQ4 A;  3RMB A;  2OYQ A;  3RWU A;  4M3T A;  2DEB A;  4ADO A;  2OZM A;  3L2O B;  3OGM B;  3C6P B;  3NE6 A;  4HCC A;  3SQ2 A;  4J2E A;  3RMD A;  1FXX A;  3LD8 A;  3SUN A;  3OGL B;  4J2B A;  1WAF A;  4DU4 A;  3KD5 E;  2H4T A;  3HGK E;  4JRP A;  1XVC E;  4M3Z A;  4FJL A;  2JHP A;  2JH8 A;  3SVI A;  1FZ3 E;  4JS5 A;  4AKG A;  1Q9X A;  2PFV A;  3SPY A;  3TJY A;  3TAE A;  4X5M A;  3TAB A;  4FJI A;  1FYZ E;  4M3R A;  3UIQ A;  2B7M A;  3QEV A;  1Q9Y A;  4M3Y A;  3HL8 A;  3RMA A;  1XVE E;  4J2D A;  2FW3 A;  4EPH A;  3L1N A;  4FK0 A;  2VJ4 A;  3RMC A;  4AKI A;  1FZ7 E;  4M45 A;  4RL5 A;  3SUO A;  1FZ5 E;  1FZ2 E;  3TAF A;  4KHU A;  3LDS A;  2OVP B;  4DTR A;  4RNG A;  4FJM A;  3SQ0 A;  2DY4 A;  5IZ7 A;  2JHA A;  4J2A A;  4DTU A;  3QNO A;  3K2O A;  4AKH A;  2RCU A;  4DTO A;  4E3S A;  2P1N B;  4DU1 A;  3SCX A;  4M3W A;  4M41 A;  3J27 A;  2P1O B;  4FJ8 A;  3QEP A;  3QET A;  3E4W A;  3QER A;  2OZS A;  3TL8 B;  4M3X A;  2LF3 A;  3HP9 A;  4FK2 A;  2HD0 A;  3WSO A;  4KHW A;  1WAJ A;  3CFR A;  4KI4 A;  3CFP A;  3CFO A;  3SQ1 A;  4KHY A;  2LF6 A;  4B08 A;  1FZH E;  1CLQ A;  1FZ4 E;  3OGK B;  4GAM C;  1MMO G;  1XVF E;  3C6N B;  4QNC A;  3SJJ A;  5IRE A;  4I6J B;  4DTP A;  3QES A;  3N1B A;  3L8B A;  1P22 A;  4E4B A;  4KHQ A;  1FZ1 E;  4X5N A;  2JHC A;  1NEX B;  4QND A;  3QEX A;  1XMF E;  4FJH A;  4EP9 A;  1FZ9 E;  2QXF A;  1FZ8 E;  3LZI A;  3SNN A;  2JH9 A;  3C95 A;  1MHY G;  3J2P A;  3SUP A;  4KHN A;  4RG8 A;  2P1P B;  2OVR B;  3N1E A;  3CQ8 A;  4AI6 A;  3KD1 E;  1XU3 E;  3C94 A;  3C6O B;  4FJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...