1FZ3E

Methane monooxygenase hydroxylase, form iii soak at ph 6.2 (0.1 m pipes)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E02
1FZ8E 4GAMC 1MTYG 1XMHE 1XVFE 1XMFE 1XU5E 1FZ2E 1FZ1E 1MHYG 1FYZE 1FZ4E 1FZ5E 1FZ0E 1XVDE 1FZ7E 1FZIE 1XU3E 1XVBE 1XVGE 1XVCE 1FZ3E 1XVEE 1MHZG 1FZHE 1FZ9E 1XMGE 1FZ6E 1MMOG
chains in the Genus database with same CATH superfamily
2P1OB 2JQTA 2OVRB 2JH9A 4M45A 3SUQA 1P22A 2YB5A 3C6NB 3QEVA 3TABA 4J2AA 4M42A 4KHQA 4KHSA 4EYWA 5H37A 4ADNA 3C6PB 3CQ8A 3QERA 1Q9XA 2JH8A 3KD5E 1CLQA 1FPOA 3HGKE 4FK0A 2LF6A 4M3RA 3QEWA 4QNDA 2OZMA 3SNNA 3E4WA 3RMAA 2OZSA 4ADOA 4KHUA 3OGKB 1FZ5E 3SJJA 3LZIA 2B8IA 4KHWA 3J2PA 2K5SA 4RL5A 5IBKB 4I6JB 2ATQA 1FZIE 4FJMA 1XVGE 4B08A 4JS4A 1XVCE 3MKSB 2DY4A 3E4YA 4DTPA 2PFTA 2P5GA 3NAEA 2P1MB 4X5NA 3SVIA 3RMCA 3LDBA 2DTUA 3OGMB 1XL3C 3QEIA 1FXXA 2RCUA 3NGIA 4FJLA 1JW2A 4AKHA 4FJHA 3SUPA 1Q9YA 2OYQA 1XMHE 2DEBA 4FJNA 1XMFE 5IZ7A 3SI6A 4KHNA 2VJ4A 1FS1A 2OVPB 1XU5E 3C95A 2OVQB 3QETA 3QEPA 3HP9A 4DTNA 1MHYG 3TAFA 4KI6A 4M3XA 4DTJA 4DTMA 4I9LA 4FJ9A 4E4BA 2MW2A 3UO3A 4FJXA 2PFVA 2P1QB 3SPZA 2JHCA 3RWUA 1FZ7E 4I9QA 1XU3E 2JHPA 3TJYA 4DU1A 4IT5A 4JRPA 3L1NA 4AKIA 3HL8A 4FK2A 4HCBA 4M41A 4RG8A 4HCCA 4AI6A 4M3TA 1FZ6E 3K2OA 3LD8A 3OGLB 3NCIA 3LDSA 3SQ1A 2VJ5A 1N1CA 2B1EA 4GAMC 4QNCA 1XVFE 4J2EA 4M3UA 3RMBA 3L8BA 1FZ2E 4FJIA 1NEXB 3J27A 2B7MA 3QESA 3QNNA 4FJJA 3RMDA 3LZJA 3CFOA 4EPHA 2QXFA 2H4TA 4J2BA 2MZWB 2FYOA 4JRQA 2JPNA 3N1EA 3CFPA 4M3WA 1FZ3E 1XVEE 3SUOA 1WAFA 3SUNA 3SQ0A 1MHZG 4M3ZA 2P5OA 1FZHE 2E31A 3QNOA 3TAGA 3SQ2A 1WAJA 2RKHA 5IREA 3S9HA 4J2DA 1MMOG 3NE6A 4FJKA 1LDKE 3WSOA 4FK4A 4E3SA 1FZ8E 3BVOA 3HGLA 4RNGA 4DTRA 4FJ5A 1MTYG 3SCXA 4EP9A 4DU3A 2MMBA 2FW3A 3KD1E 3TL8B 3NDKA 3L2OB 4JS5A 1FZ1E 4DU4A 3QEXA 4FVMA 1FYZE 3TAEA 1IG9A 4M3YA 2E32A 1FZ0E 4ICGC 2JHAA 4DTSA 4DTXA 2P1NB 2HD0A 1IH7A 4X5MA 3L0MA 1XVDE 3SQ4A 4FJGA 4FJ8A 4KHYA 1XVBE 3C94A 3UO2A 3CFRA 3UIQA 4DTOA 3SPYA 4KI4A 4DTUA 4FJ7A 2P1PB 4AKGA 3N1BA 3NHGA 2LF3A 1FZ9E 1XMGE 1FZ4E 3V7DB 3C6OB 2VIXA
chains in the Genus database with same CATH topology
2P1OB 2OVRB 2JH9A 4M45A 3SUQA 1P22A 2YB5A 3C6NB 3QEVA 3TABA 4J2AA 4M42A 4KHQA 4KHSA 4EYWA 5H37A 4ADNA 3C6PB 3CQ8A 3QERA 1Q9XA 2JH8A 3KD5E 1CLQA 3HGKE 4FK0A 2LF6A 4M3RA 3QEWA 4QNDA 2OZMA 3SNNA 3E4WA 3RMAA 2OZSA 4ADOA 4KHUA 3OGKB 1FZ5E 3SJJA 3LZIA 2B8IA 4KHWA 3J2PA 4RL5A 5IBKB 4I6JB 2ATQA 1FZIE 4FJMA 1XVGE 4B08A 4JS4A 1XVCE 3MKSB 2DY4A 3E4YA 4DTPA 2PFTA 2P5GA 3NAEA 2P1MB 4X5NA 3SVIA 3RMCA 3LDBA 2DTUA 3OGMB 1XL3C 3QEIA 1FXXA 2RCUA 3NGIA 4FJLA 4AKHA 4FJHA 3SUPA 1Q9YA 2OYQA 1XMHE 2DEBA 4FJNA 1XMFE 5IZ7A 3SI6A 4KHNA 2VJ4A 1FS1A 2OVPB 1XU5E 3C95A 2OVQB 3QETA 3QEPA 3HP9A 4DTNA 1MHYG 3TAFA 4KI6A 4M3XA 4DTJA 4DTMA 4I9LA 4FJ9A 4E4BA 4FJXA 2PFVA 2P1QB 3SPZA 2JHCA 3RWUA 1FZ7E 4I9QA 1XU3E 2JHPA 3TJYA 4DU1A 4JRPA 3L1NA 4AKIA 3HL8A 4FK2A 4HCBA 4M41A 4RG8A 4HCCA 4AI6A 4M3TA 1FZ6E 3K2OA 3LD8A 3OGLB 3NCIA 3LDSA 3SQ1A 2VJ5A 2B1EA 4GAMC 4QNCA 1XVFE 4J2EA 4M3UA 3RMBA 3L8BA 1FZ2E 4FJIA 1NEXB 3J27A 2B7MA 3QESA 3QNNA 4FJJA 3RMDA 3LZJA 3CFOA 4EPHA 2QXFA 2H4TA 4J2BA 2MZWB 2FYOA 4JRQA 2JPNA 3N1EA 3CFPA 4M3WA 1FZ3E 1XVEE 3SUOA 1WAFA 3SUNA 3SQ0A 1MHZG 4M3ZA 2P5OA 1FZHE 2E31A 3QNOA 3TAGA 3SQ2A 1WAJA 5IREA 3S9HA 4J2DA 1MMOG 3NE6A 4FJKA 1LDKE 3WSOA 4FK4A 4E3SA 1FZ8E 3HGLA 4RNGA 4DTRA 4FJ5A 1MTYG 3SCXA 4EP9A 4DU3A 2MMBA 2FW3A 3KD1E 3TL8B 3NDKA 3L2OB 4JS5A 1FZ1E 4DU4A 3QEXA 4FVMA 1FYZE 3TAEA 1IG9A 4M3YA 2E32A 1FZ0E 2JHAA 4DTSA 4DTXA 2HD0A 2P1NB 1IH7A 4X5MA 3L0MA 1XVDE 3SQ4A 4FJGA 4FJ8A 4KHYA 1XVBE 3C94A 3CFRA 3UIQA 4DTOA 3SPYA 4KI4A 4DTUA 4FJ7A 2P1PB 4AKGA 3N1BA 3NHGA 2LF3A 1FZ9E 1XMGE 1FZ4E 3V7DB 3C6OB 2VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ8 E;  4GAM C;  1MTY G;  1XMH E;  1XVF E;  1XMF E;  1XU5 E;  1FZ2 E;  1FZ1 E;  1MHY G;  1FYZ E;  1FZ4 E;  1FZ5 E;  1FZ0 E;  1XVD E;  1FZ7 E;  1FZI E;  1XU3 E;  1XVB E;  1XVG E;  1XVC E;  1FZ3 E;  1XVE E;  1MHZ G;  1FZH E;  1FZ9 E;  1XMG E;  1FZ6 E;  1MMO G; 
#chains in the Genus database with same CATH topology
 2P1O B;  2JQT A;  2OVR B;  2JH9 A;  4M45 A;  3SUQ A;  1P22 A;  2YB5 A;  3C6N B;  3QEV A;  3TAB A;  4J2A A;  4M42 A;  4KHQ A;  4KHS A;  4EYW A;  5H37 A;  4ADN A;  3C6P B;  3CQ8 A;  3QER A;  1Q9X A;  2JH8 A;  3KD5 E;  1CLQ A;  1FPO A;  3HGK E;  4FK0 A;  2LF6 A;  4M3R A;  3QEW A;  4QND A;  2OZM A;  3SNN A;  3E4W A;  3RMA A;  2OZS A;  4ADO A;  4KHU A;  3OGK B;  1FZ5 E;  3SJJ A;  3LZI A;  2B8I A;  4KHW A;  3J2P A;  2K5S A;  4RL5 A;  5IBK B;  4I6J B;  2ATQ A;  1FZI E;  4FJM A;  1XVG E;  4B08 A;  4JS4 A;  1XVC E;  3MKS B;  2DY4 A;  3E4Y A;  4DTP A;  2PFT A;  2P5G A;  3NAE A;  2P1M B;  4X5N A;  3SVI A;  3RMC A;  3LDB A;  2DTU A;  3OGM B;  1XL3 C;  3QEI A;  1FXX A;  2RCU A;  3NGI A;  4FJL A;  1JW2 A;  4AKH A;  4FJH A;  3SUP A;  1Q9Y A;  2OYQ A;  1XMH E;  2DEB A;  4FJN A;  1XMF E;  5IZ7 A;  3SI6 A;  4KHN A;  2VJ4 A;  1FS1 A;  2OVP B;  1XU5 E;  3C95 A;  2OVQ B;  3QET A;  3QEP A;  3HP9 A;  4DTN A;  1MHY G;  3TAF A;  4KI6 A;  4M3X A;  4DTJ A;  4DTM A;  4I9L A;  4FJ9 A;  4E4B A;  2MW2 A;  3UO3 A;  4FJX A;  2PFV A;  2P1Q B;  3SPZ A;  2JHC A;  3RWU A;  1FZ7 E;  4I9Q A;  1XU3 E;  2JHP A;  3TJY A;  4DU1 A;  4IT5 A;  4JRP A;  3L1N A;  4AKI A;  3HL8 A;  4FK2 A;  4HCB A;  4M41 A;  4RG8 A;  4HCC A;  4AI6 A;  4M3T A;  1FZ6 E;  3K2O A;  3LD8 A;  3OGL B;  3NCI A;  3LDS A;  3SQ1 A;  2VJ5 A;  1N1C A;  2B1E A;  4GAM C;  4QNC A;  1XVF E;  4J2E A;  4M3U A;  3RMB A;  3L8B A;  1FZ2 E;  4FJI A;  1NEX B;  3J27 A;  2B7M A;  3QES A;  3QNN A;  4FJJ A;  3RMD A;  3LZJ A;  3CFO A;  4EPH A;  2QXF A;  2H4T A;  4J2B A;  2MZW B;  2FYO A;  4JRQ A;  2JPN A;  3N1E A;  3CFP A;  4M3W A;  1FZ3 E;  1XVE E;  3SUO A;  1WAF A;  3SUN A;  3SQ0 A;  1MHZ G;  4M3Z A;  2P5O A;  1FZH E;  2E31 A;  3QNO A;  3TAG A;  3SQ2 A;  1WAJ A;  2RKH A;  5IRE A;  3S9H A;  4J2D A;  1MMO G;  3NE6 A;  4FJK A;  1LDK E;  3WSO A;  4FK4 A;  4E3S A;  1FZ8 E;  3BVO A;  3HGL A;  4RNG A;  4DTR A;  4FJ5 A;  1MTY G;  3SCX A;  4EP9 A;  4DU3 A;  2MMB A;  2FW3 A;  3KD1 E;  3TL8 B;  3NDK A;  3L2O B;  4JS5 A;  1FZ1 E;  4DU4 A;  3QEX A;  4FVM A;  1FYZ E;  3TAE A;  1IG9 A;  4M3Y A;  2E32 A;  1FZ0 E;  4ICG C;  2JHA A;  4DTS A;  4DTX A;  2P1N B;  2HD0 A;  1IH7 A;  4X5M A;  3L0M A;  1XVD E;  3SQ4 A;  4FJG A;  4FJ8 A;  4KHY A;  1XVB E;  3C94 A;  3UO2 A;  3CFR A;  3UIQ A;  4DTO A;  3SPY A;  4KI4 A;  4DTU A;  4FJ7 A;  2P1P B;  4AKG A;  3N1B A;  3NHG A;  2LF3 A;  1FZ9 E;  1XMG E;  1FZ4 E;  3V7D B;  3C6O B;  2VIX A; 
#chains in the Genus database with same CATH homology
 2P1O B;  2OVR B;  2JH9 A;  4M45 A;  3SUQ A;  1P22 A;  2YB5 A;  3C6N B;  3QEV A;  3TAB A;  4J2A A;  4M42 A;  4KHQ A;  4KHS A;  4EYW A;  5H37 A;  4ADN A;  3C6P B;  3CQ8 A;  3QER A;  1Q9X A;  2JH8 A;  3KD5 E;  1CLQ A;  3HGK E;  4FK0 A;  2LF6 A;  4M3R A;  3QEW A;  4QND A;  2OZM A;  3SNN A;  3E4W A;  3RMA A;  2OZS A;  4ADO A;  4KHU A;  3OGK B;  1FZ5 E;  3SJJ A;  3LZI A;  2B8I A;  4KHW A;  3J2P A;  4RL5 A;  5IBK B;  4I6J B;  2ATQ A;  1FZI E;  4FJM A;  1XVG E;  4B08 A;  4JS4 A;  1XVC E;  3MKS B;  2DY4 A;  3E4Y A;  4DTP A;  2PFT A;  2P5G A;  3NAE A;  2P1M B;  4X5N A;  3SVI A;  3RMC A;  3LDB A;  2DTU A;  3OGM B;  1XL3 C;  3QEI A;  1FXX A;  2RCU A;  3NGI A;  4FJL A;  4AKH A;  4FJH A;  3SUP A;  1Q9Y A;  2OYQ A;  1XMH E;  2DEB A;  4FJN A;  1XMF E;  5IZ7 A;  3SI6 A;  4KHN A;  2VJ4 A;  1FS1 A;  2OVP B;  1XU5 E;  3C95 A;  2OVQ B;  3QET A;  3QEP A;  3HP9 A;  4DTN A;  1MHY G;  3TAF A;  4KI6 A;  4M3X A;  4DTJ A;  4DTM A;  4I9L A;  4FJ9 A;  4E4B A;  4FJX A;  2PFV A;  2P1Q B;  3SPZ A;  2JHC A;  3RWU A;  1FZ7 E;  4I9Q A;  1XU3 E;  2JHP A;  3TJY A;  4DU1 A;  4JRP A;  3L1N A;  4AKI A;  3HL8 A;  4FK2 A;  4HCB A;  4M41 A;  4RG8 A;  4HCC A;  4AI6 A;  4M3T A;  1FZ6 E;  3K2O A;  3LD8 A;  3OGL B;  3NCI A;  3LDS A;  3SQ1 A;  2VJ5 A;  2B1E A;  4GAM C;  4QNC A;  1XVF E;  4J2E A;  4M3U A;  3RMB A;  3L8B A;  1FZ2 E;  4FJI A;  1NEX B;  3J27 A;  2B7M A;  3QES A;  3QNN A;  4FJJ A;  3RMD A;  3LZJ A;  3CFO A;  4EPH A;  2QXF A;  2H4T A;  4J2B A;  2MZW B;  2FYO A;  4JRQ A;  2JPN A;  3N1E A;  3CFP A;  4M3W A;  1FZ3 E;  1XVE E;  3SUO A;  1WAF A;  3SUN A;  3SQ0 A;  1MHZ G;  4M3Z A;  2P5O A;  1FZH E;  2E31 A;  3QNO A;  3TAG A;  3SQ2 A;  1WAJ A;  5IRE A;  3S9H A;  4J2D A;  1MMO G;  3NE6 A;  4FJK A;  1LDK E;  3WSO A;  4FK4 A;  4E3S A;  1FZ8 E;  3HGL A;  4RNG A;  4DTR A;  4FJ5 A;  1MTY G;  3SCX A;  4EP9 A;  4DU3 A;  2MMB A;  2FW3 A;  3KD1 E;  3TL8 B;  3NDK A;  3L2O B;  4JS5 A;  1FZ1 E;  4DU4 A;  3QEX A;  4FVM A;  1FYZ E;  3TAE A;  1IG9 A;  4M3Y A;  2E32 A;  1FZ0 E;  2JHA A;  4DTS A;  4DTX A;  2HD0 A;  2P1N B;  1IH7 A;  4X5M A;  3L0M A;  1XVD E;  3SQ4 A;  4FJG A;  4FJ8 A;  4KHY A;  1XVB E;  3C94 A;  3CFR A;  3UIQ A;  4DTO A;  3SPY A;  4KI4 A;  4DTU A;  4FJ7 A;  2P1P B;  4AKG A;  3N1B A;  3NHG A;  2LF3 A;  1FZ9 E;  1XMG E;  1FZ4 E;  3V7D B;  3C6O B;  2VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...