1FZ3E

Methane monooxygenase hydroxylase, form iii soak at ph 6.2 (0.1 m pipes)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz3E02
1FZHE 1MMOG 1XVEE 1XMGE 1FZIE 1FZ1E 1XU5E 1XVGE 1FZ2E 1MHZG 1FZ7E 1FYZE 1FZ3E 1FZ6E 1MHYG 1FZ9E 1XU3E 1FZ0E 1FZ4E 4GAMC 1FZ5E 1FZ8E 1XMFE 1XVFE 1XVDE 1XVCE 1XMHE 1XVBE 1MTYG
chains in the Genus database with same CATH superfamily
4M3ZA 3E4YA 3TAEA 2RCUA 2VIXA 3N1BA 4JRPA 3QEIA 5H37A 1XMGE 3NGIA 2OZSA 3UO3A 4ADNA 1FZ1E 4KHSA 3RMBA 3MKSB 3QNNA 3J27A 3TABA 1FZ2E 3N1EA 1FXXA 3CFRA 3CFOA 3OGLB 3C6PB 3HGLA 3TAFA 3LD8A 4RL5A 2E32A 5IBKB 4M3TA 1FZ6E 3UIQA 1MHYG 4DU4A 2P1QB 3L8BA 1FZ9E 1XU3E 3CQ8A 1FZ0E 1FZ4E 3J2PA 2RKHA 4M41A 2MW2A 4DTMA 2H4TA 3SPYA 3C6NB 4EPHA 4J2EA 4FJ9A 4DTJA 2PFVA 1XVDE 4DTNA 2JQTA 3QETA 2OYQA 4FJIA 3RMCA 3SUOA 2JH8A 3C94A 2DY4A 3SJJA 1Q9XA 3C6OB 2P1NB 3SQ2A 1CLQA 3QERA 1FZHE 3HGKE 2DEBA 2JHCA 1MMOG 1XVEE 2P1OB 2VJ4A 1WAJA 3RMAA 4RNGA 2P5OA 3SPZA 4DTRA 4DTXA 4I9QA 4FJKA 3NCIA 2VJ5A 2OZMA 4KI4A 1LDKE 4I6JB 1N1CA 2HD0A 3HL8A 3SUNA 4KHYA 4JRQA 2P1PB 2OVPB 3OGMB 3QEVA 3SUQA 3CFPA 4J2DA 3OGKB 4FJLA 1IG9A 4X5MA 3NHGA 1FZ5E 2MZWB 2PFTA 4J2AA 3TAGA 3UO2A 3QEXA 3WSOA 2LF3A 1XMHE 3LDSA 3SQ1A 2B8IA 1XL3C 2P5GA 1MTYG 2JPNA 4FJXA 3QEPA 4DTSA 3V7DB 4FK0A 4J2BA 1NEXB 3LZJA 4FJGA 3SNNA 4DU1A 1FZIE 3NDKA 2E31A 3K2OA 4I9LA 4EP9A 4FJ8A 4KHUA 5IREA 1JW2A 3RWUA 4RG8A 3RMDA 4KI6A 3BVOA 4IT5A 4E4BA 4FJHA 4QNDA 2B7MA 1IH7A 2LF6A 4HCCA 3NAEA 1FPOA 3C95A 3NE6A 4M42A 4AKIA 4HCBA 3L2OB 4JS4A 3SI6A 4E3SA 2ATQA 1FZ8E 3KD5E 2P1MB 1XVFE 4DTUA 3SCXA 1FS1A 3LZIA 4M3YA 5IZ7A 3TL8B 4DTPA 3SQ4A 3QEWA 2K5SA 3QESA 3SQ0A 3E4WA 2OVRB 4KHNA 2JHAA 3LDBA 2DTUA 4FVMA 4FJ5A 4FJMA 2FYOA 1XU5E 4B08A 3S9HA 1XVGE 1Q9YA 4QNCA 4FK4A 4FJJA 4FK2A 4ADOA 1P22A 2B1EA 1MHZG 4M3XA 3TJYA 1FZ7E 1FYZE 2QXFA 4M3WA 4DU3A 4ICGC 4FJ7A 3L1NA 4M3UA 3SVIA 1FZ3E 3L0MA 4M45A 4AI6A 2YB5A 4AKGA 4GAMC 4EYWA 4DTOA 3SUPA 2JHPA 3HP9A 2FW3A 1XMFE 4KHQA 2MMBA 1XVCE 2JH9A 4X5NA 2OVQB 4FJNA 4KHWA 4JS5A 3KD1E 4AKHA 3QNOA 1XVBE 1WAFA 4M3RA
chains in the Genus database with same CATH topology
4M3ZA 3E4YA 3TAEA 2RCUA 2VIXA 3N1BA 4JRPA 3QEIA 5H37A 1XMGE 3NGIA 2OZSA 4ADNA 1FZ1E 4KHSA 3RMBA 3MKSB 3QNNA 3J27A 3TABA 1FZ2E 3N1EA 1FXXA 3CFRA 3CFOA 3OGLB 3C6PB 3HGLA 3TAFA 3LD8A 4RL5A 2E32A 5IBKB 4M3TA 1FZ6E 3UIQA 1MHYG 4DU4A 2P1QB 3L8BA 1FZ9E 1XU3E 3CQ8A 1FZ0E 1FZ4E 3J2PA 4M41A 4DTMA 2H4TA 3SPYA 3C6NB 4EPHA 4J2EA 4FJ9A 4DTJA 2PFVA 1XVDE 4DTNA 3QETA 2OYQA 4FJIA 2DY4A 3RMCA 3SUOA 2JH8A 3C94A 3SJJA 1Q9XA 3C6OB 2P1NB 3SQ2A 1CLQA 3QERA 1FZHE 3HGKE 2DEBA 2JHCA 1MMOG 1XVEE 2P1OB 2VJ4A 1WAJA 3RMAA 4RNGA 2P5OA 3SPZA 4DTRA 4DTXA 4I9QA 4FJKA 3NCIA 2VJ5A 2OZMA 4KI4A 1LDKE 4I6JB 2HD0A 3HL8A 3SUNA 4KHYA 4JRQA 2P1PB 2OVPB 3OGMB 3QEVA 3SUQA 3CFPA 4J2DA 3OGKB 4FJLA 1IG9A 4X5MA 3NHGA 1FZ5E 2MZWB 2PFTA 4J2AA 3TAGA 3QEXA 3WSOA 2LF3A 1XMHE 3LDSA 3SQ1A 2B8IA 1XL3C 2P5GA 1MTYG 2JPNA 4FJXA 3QEPA 4DTSA 3V7DB 4FK0A 4J2BA 1NEXB 3LZJA 4FJGA 3SNNA 4DU1A 1FZIE 3NDKA 2E31A 3K2OA 4I9LA 4EP9A 4FJ8A 4KHUA 5IREA 3RWUA 4RG8A 3RMDA 4KI6A 4E4BA 4FJHA 4QNDA 2B7MA 1IH7A 2LF6A 4HCCA 3NAEA 3NE6A 3C95A 4AKIA 4M42A 4HCBA 3L2OB 4JS4A 3SI6A 4E3SA 2ATQA 1FZ8E 3KD5E 2P1MB 1XVFE 4DTUA 3SCXA 1FS1A 3LZIA 4M3YA 5IZ7A 3TL8B 4DTPA 3SQ4A 3QEWA 3QESA 3SQ0A 3E4WA 2OVRB 4KHNA 2JHAA 3LDBA 2DTUA 4FVMA 4FJ5A 4FJMA 2FYOA 1XU5E 4B08A 3S9HA 1XVGE 1Q9YA 4QNCA 4FK4A 4FJJA 4FK2A 4ADOA 1P22A 2B1EA 1MHZG 4M3XA 3TJYA 1FZ7E 1FYZE 2QXFA 4M3WA 4DU3A 4FJ7A 3L1NA 4M3UA 3SVIA 1FZ3E 3L0MA 4M45A 4AI6A 2YB5A 4AKGA 4GAMC 4EYWA 4DTOA 3SUPA 2JHPA 3HP9A 2FW3A 1XMFE 4KHQA 2MMBA 1XVCE 2JH9A 4X5NA 2OVQB 4FJNA 4KHWA 4JS5A 3KD1E 4AKHA 3QNOA 1XVBE 1WAFA 4M3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZH E;  1MMO G;  1XVE E;  1XMG E;  1FZI E;  1FZ1 E;  1XU5 E;  1XVG E;  1FZ2 E;  1MHZ G;  1FZ7 E;  1FYZ E;  1FZ3 E;  1FZ6 E;  1MHY G;  1FZ9 E;  1XU3 E;  1FZ0 E;  1FZ4 E;  4GAM C;  1FZ5 E;  1FZ8 E;  1XMF E;  1XVF E;  1XVD E;  1XVC E;  1XMH E;  1XVB E;  1MTY G; 
#chains in the Genus database with same CATH topology
 4M3Z A;  3E4Y A;  3TAE A;  2RCU A;  2VIX A;  3N1B A;  4JRP A;  3QEI A;  5H37 A;  1XMG E;  3NGI A;  2OZS A;  3UO3 A;  4ADN A;  1FZ1 E;  4KHS A;  3RMB A;  3MKS B;  3QNN A;  3J27 A;  3TAB A;  1FZ2 E;  3N1E A;  1FXX A;  3CFR A;  3CFO A;  3OGL B;  3C6P B;  3HGL A;  3TAF A;  3LD8 A;  4RL5 A;  2E32 A;  5IBK B;  4M3T A;  1FZ6 E;  3UIQ A;  1MHY G;  4DU4 A;  2P1Q B;  3L8B A;  1FZ9 E;  1XU3 E;  3CQ8 A;  1FZ0 E;  1FZ4 E;  3J2P A;  2RKH A;  4M41 A;  2MW2 A;  4DTM A;  2H4T A;  3SPY A;  3C6N B;  4EPH A;  4J2E A;  4FJ9 A;  4DTJ A;  2PFV A;  1XVD E;  4DTN A;  2JQT A;  3QET A;  2OYQ A;  4FJI A;  3RMC A;  3SUO A;  2JH8 A;  3C94 A;  2DY4 A;  3SJJ A;  1Q9X A;  3C6O B;  2P1N B;  3SQ2 A;  1CLQ A;  3QER A;  1FZH E;  3HGK E;  2DEB A;  2JHC A;  1MMO G;  1XVE E;  2P1O B;  2VJ4 A;  1WAJ A;  3RMA A;  4RNG A;  2P5O A;  3SPZ A;  4DTR A;  4DTX A;  4I9Q A;  4FJK A;  3NCI A;  2VJ5 A;  2OZM A;  4KI4 A;  1LDK E;  4I6J B;  1N1C A;  2HD0 A;  3HL8 A;  3SUN A;  4KHY A;  4JRQ A;  2P1P B;  2OVP B;  3OGM B;  3QEV A;  3SUQ A;  3CFP A;  4J2D A;  3OGK B;  4FJL A;  1IG9 A;  4X5M A;  3NHG A;  1FZ5 E;  2MZW B;  2PFT A;  4J2A A;  3TAG A;  3UO2 A;  3QEX A;  3WSO A;  2LF3 A;  1XMH E;  3LDS A;  3SQ1 A;  2B8I A;  1XL3 C;  2P5G A;  1MTY G;  2JPN A;  4FJX A;  3QEP A;  4DTS A;  3V7D B;  4FK0 A;  4J2B A;  1NEX B;  3LZJ A;  4FJG A;  3SNN A;  4DU1 A;  1FZI E;  3NDK A;  2E31 A;  3K2O A;  4I9L A;  4EP9 A;  4FJ8 A;  4KHU A;  5IRE A;  1JW2 A;  3RWU A;  4RG8 A;  3RMD A;  4KI6 A;  3BVO A;  4IT5 A;  4E4B A;  4FJH A;  4QND A;  2B7M A;  1IH7 A;  2LF6 A;  4HCC A;  3NAE A;  1FPO A;  3C95 A;  3NE6 A;  4M42 A;  4AKI A;  4HCB A;  3L2O B;  4JS4 A;  3SI6 A;  4E3S A;  2ATQ A;  1FZ8 E;  3KD5 E;  2P1M B;  1XVF E;  4DTU A;  3SCX A;  1FS1 A;  3LZI A;  4M3Y A;  5IZ7 A;  3TL8 B;  4DTP A;  3SQ4 A;  3QEW A;  2K5S A;  3QES A;  3SQ0 A;  3E4W A;  2OVR B;  4KHN A;  2JHA A;  3LDB A;  2DTU A;  4FVM A;  4FJ5 A;  4FJM A;  2FYO A;  1XU5 E;  4B08 A;  3S9H A;  1XVG E;  1Q9Y A;  4QNC A;  4FK4 A;  4FJJ A;  4FK2 A;  4ADO A;  1P22 A;  2B1E A;  1MHZ G;  4M3X A;  3TJY A;  1FZ7 E;  1FYZ E;  2QXF A;  4M3W A;  4DU3 A;  4ICG C;  4FJ7 A;  3L1N A;  4M3U A;  3SVI A;  1FZ3 E;  3L0M A;  4M45 A;  4AI6 A;  2YB5 A;  4AKG A;  4GAM C;  4EYW A;  4DTO A;  3SUP A;  2JHP A;  3HP9 A;  2FW3 A;  1XMF E;  4KHQ A;  2MMB A;  1XVC E;  2JH9 A;  4X5N A;  2OVQ B;  4FJN A;  4KHW A;  4JS5 A;  3KD1 E;  4AKH A;  3QNO A;  1XVB E;  1WAF A;  4M3R A; 
#chains in the Genus database with same CATH homology
 4M3Z A;  3E4Y A;  3TAE A;  2RCU A;  2VIX A;  3N1B A;  4JRP A;  3QEI A;  5H37 A;  1XMG E;  3NGI A;  2OZS A;  4ADN A;  1FZ1 E;  4KHS A;  3RMB A;  3MKS B;  3QNN A;  3J27 A;  3TAB A;  1FZ2 E;  3N1E A;  1FXX A;  3CFR A;  3CFO A;  3OGL B;  3C6P B;  3HGL A;  3TAF A;  3LD8 A;  4RL5 A;  2E32 A;  5IBK B;  4M3T A;  1FZ6 E;  3UIQ A;  1MHY G;  4DU4 A;  2P1Q B;  3L8B A;  1FZ9 E;  1XU3 E;  3CQ8 A;  1FZ0 E;  1FZ4 E;  3J2P A;  4M41 A;  4DTM A;  2H4T A;  3SPY A;  3C6N B;  4EPH A;  4J2E A;  4FJ9 A;  4DTJ A;  2PFV A;  1XVD E;  4DTN A;  3QET A;  2OYQ A;  4FJI A;  2DY4 A;  3RMC A;  3SUO A;  2JH8 A;  3C94 A;  3SJJ A;  1Q9X A;  3C6O B;  2P1N B;  3SQ2 A;  1CLQ A;  3QER A;  1FZH E;  3HGK E;  2DEB A;  2JHC A;  1MMO G;  1XVE E;  2P1O B;  2VJ4 A;  1WAJ A;  3RMA A;  4RNG A;  2P5O A;  3SPZ A;  4DTR A;  4DTX A;  4I9Q A;  4FJK A;  3NCI A;  2VJ5 A;  2OZM A;  4KI4 A;  1LDK E;  4I6J B;  2HD0 A;  3HL8 A;  3SUN A;  4KHY A;  4JRQ A;  2P1P B;  2OVP B;  3OGM B;  3QEV A;  3SUQ A;  3CFP A;  4J2D A;  3OGK B;  4FJL A;  1IG9 A;  4X5M A;  3NHG A;  1FZ5 E;  2MZW B;  2PFT A;  4J2A A;  3TAG A;  3QEX A;  3WSO A;  2LF3 A;  1XMH E;  3LDS A;  3SQ1 A;  2B8I A;  1XL3 C;  2P5G A;  1MTY G;  2JPN A;  4FJX A;  3QEP A;  4DTS A;  3V7D B;  4FK0 A;  4J2B A;  1NEX B;  3LZJ A;  4FJG A;  3SNN A;  4DU1 A;  1FZI E;  3NDK A;  2E31 A;  3K2O A;  4I9L A;  4EP9 A;  4FJ8 A;  4KHU A;  5IRE A;  3RWU A;  4RG8 A;  3RMD A;  4KI6 A;  4E4B A;  4FJH A;  4QND A;  2B7M A;  1IH7 A;  2LF6 A;  4HCC A;  3NAE A;  3NE6 A;  3C95 A;  4AKI A;  4M42 A;  4HCB A;  3L2O B;  4JS4 A;  3SI6 A;  4E3S A;  2ATQ A;  1FZ8 E;  3KD5 E;  2P1M B;  1XVF E;  4DTU A;  3SCX A;  1FS1 A;  3LZI A;  4M3Y A;  5IZ7 A;  3TL8 B;  4DTP A;  3SQ4 A;  3QEW A;  3QES A;  3SQ0 A;  3E4W A;  2OVR B;  4KHN A;  2JHA A;  3LDB A;  2DTU A;  4FVM A;  4FJ5 A;  4FJM A;  2FYO A;  1XU5 E;  4B08 A;  3S9H A;  1XVG E;  1Q9Y A;  4QNC A;  4FK4 A;  4FJJ A;  4FK2 A;  4ADO A;  1P22 A;  2B1E A;  1MHZ G;  4M3X A;  3TJY A;  1FZ7 E;  1FYZ E;  2QXF A;  4M3W A;  4DU3 A;  4FJ7 A;  3L1N A;  4M3U A;  3SVI A;  1FZ3 E;  3L0M A;  4M45 A;  4AI6 A;  2YB5 A;  4AKG A;  4GAM C;  4EYW A;  4DTO A;  3SUP A;  2JHP A;  3HP9 A;  2FW3 A;  1XMF E;  4KHQ A;  2MMB A;  1XVC E;  2JH9 A;  4X5N A;  2OVQ B;  4FJN A;  4KHW A;  4JS5 A;  3KD1 E;  4AKH A;  3QNO A;  1XVB E;  1WAF A;  4M3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...