1FZ4E

Methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 58
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E02
1FZ7E 1FZHE 1FZ3E 1XVDE 4GAMC 1FZ4E 1XU3E 1FZ8E 1MHYG 1FZ6E 1FYZE 1XVFE 1FZ5E 1FZ2E 1XU5E 1FZ0E 1XVEE 1FZ1E 1XMFE 1XVBE 1FZIE 1FZ9E 1XMHE 1MMOG 1MHZG 1XMGE 1XVGE 1MTYG 1XVCE
chains in the Genus database with same CATH superfamily
1FZHE 3RMCA 2FW3A 4B08A 3NHGA 3LD8A 4DU1A 3SQ2A 4M3XA 2OZMA 3L0MA 3C95A 4M3UA 2YB5A 2B8IA 2OVPB 3TAGA 4DTUA 3L2OB 3OGMB 1FZ5E 3LDBA 2JH8A 3WSOA 4FK0A 4FJ9A 4FJLA 4KHYA 2DEBA 1NEXB 3CFOA 3J27A 4AKGA 1XVEE 3QNNA 4DTNA 4KHUA 4M45A 4RNGA 1XVBE 3HP9A 4JS5A 3J2PA 1FZ9E 3RMAA 3UO2A 3CFRA 3TABA 3SCXA 1XMGE 2JHCA 5IREA 4FK2A 4RL5A 2VJ4A 2VIXA 2ATQA 4JRPA 1FZ7E 3LZIA 4AKIA 1XL3C 4I9QA 4M3WA 1XU3E 1IH7A 3HGKE 2OYQA 2B1EA 3SJJA 1FZ6E 2JH9A 2MW2A 4DTOA 1XVFE 3NGIA 2P1MB 4FJNA 3HGLA 3L8BA 3QETA 3QNOA 3QESA 1WAFA 1IG9A 3TL8B 1FZ0E 4J2EA 3V7DB 2E31A 5IZ7A 4FJIA 4FJ8A 1FZIE 3N1EA 3SVIA 4KHNA 2VJ5A 3SI6A 3KD1E 3SQ4A 1MHZG 1Q9YA 2K5SA 2P1NB 3BVOA 4KHWA 4M3YA 4JRQA 3E4YA 3SNNA 4ADNA 4FJ7A 1WAJA 3TAFA 4KHQA 1FZ3E 3C94A 3SQ1A 2P1QB 2PFTA 4GAMC 3LDSA 4KHSA 3KD5E 1MHYG 3SUNA 4FJJA 4KI6A 4EYWA 2JHAA 3SUPA 5IBKB 1FYZE 4JS4A 4DTSA 2FYOA 2LF6A 4X5NA 4DTJA 2DY4A 1FXXA 3QERA 4DTPA 2RKHA 4M3ZA 5H37A 3NAEA 3QEPA 1FZ2E 3RMBA 3OGLB 2OZSA 2P1OB 1XU5E 4X5MA 3CQ8A 4E4BA 4E3SA 3RMDA 1FZ1E 1CLQA 3N1BA 4QNDA 4ADOA 4DTXA 3K2OA 2JPNA 4IT5A 2MZWB 3E4WA 2E32A 3QEWA 3QEIA 4EP9A 3NCIA 3QEXA 2P5OA 3SUOA 1Q9XA 3C6OB 1MTYG 2H4TA 1XVCE 3HL8A 4FJHA 4RG8A 1N1CA 3S9HA 2LF3A 2P5GA 4M41A 3CFPA 3UIQA 1XVDE 3C6PB 4QNCA 4ICGC 4EPHA 1FZ4E 1FZ8E 2QXFA 4I6JB 3RWUA 3L1NA 4FJGA 4HCCA 2OVRB 2PFVA 1P22A 4M42A 3C6NB 1JW2A 4J2DA 4J2AA 4HCBA 2B7MA 1LDKE 3OGKB 1FS1A 3SPYA 4M3TA 4AI6A 3SPZA 2MMBA 3NE6A 4FJKA 4KI4A 4DTRA 4FVMA 2HD0A 2JQTA 1FPOA 4J2BA 2RCUA 4DU3A 3LZJA 1XMFE 3TAEA 3NDKA 3QEVA 3SUQA 2DTUA 4FK4A 4AKHA 1XMHE 1MMOG 4DTMA 2OVQB 3MKSB 4FJMA 4FJ5A 2JHPA 4FJXA 1XVGE 3SQ0A 3TJYA 2P1PB 3UO3A 4I9LA 4M3RA 4DU4A
chains in the Genus database with same CATH topology
1FZHE 3RMCA 2FW3A 4B08A 3NHGA 3LD8A 4DU1A 3SQ2A 4M3XA 2OZMA 3L0MA 3C95A 4M3UA 2YB5A 2B8IA 2OVPB 3TAGA 4DTUA 3L2OB 3OGMB 1FZ5E 3LDBA 2JH8A 3WSOA 4FK0A 4FJ9A 4FJLA 4KHYA 2DEBA 1NEXB 3CFOA 3J27A 4AKGA 1XVEE 3QNNA 4DTNA 4KHUA 4M45A 4RNGA 1XVBE 3HP9A 4JS5A 3J2PA 1FZ9E 3RMAA 3CFRA 3TABA 3SCXA 1XMGE 2JHCA 5IREA 4FK2A 4RL5A 2VJ4A 2VIXA 2ATQA 4JRPA 1FZ7E 3LZIA 4AKIA 1XL3C 4I9QA 4M3WA 1XU3E 1IH7A 3HGKE 2OYQA 2B1EA 3SJJA 1FZ6E 2JH9A 4DTOA 1XVFE 3NGIA 2P1MB 4FJNA 3HGLA 3L8BA 3QETA 3QNOA 3QESA 1WAFA 1IG9A 3TL8B 1FZ0E 4J2EA 3V7DB 2E31A 5IZ7A 4FJIA 4FJ8A 1FZIE 3N1EA 3SVIA 4KHNA 2VJ5A 3SI6A 3KD1E 3SQ4A 1MHZG 1Q9YA 2P1NB 4KHWA 4M3YA 4JRQA 3E4YA 3SNNA 4ADNA 4FJ7A 1WAJA 3TAFA 4KHQA 1FZ3E 3C94A 3SQ1A 2P1QB 2PFTA 4GAMC 3LDSA 4KHSA 3KD5E 1MHYG 3SUNA 4FJJA 4KI6A 4EYWA 2JHAA 3SUPA 5IBKB 1FYZE 4JS4A 4DTSA 2FYOA 2LF6A 4X5NA 4DTJA 2DY4A 1FXXA 3QERA 4DTPA 4M3ZA 5H37A 3NAEA 3QEPA 1FZ2E 3RMBA 3OGLB 2OZSA 2P1OB 1XU5E 4X5MA 3CQ8A 4E4BA 4E3SA 3RMDA 1FZ1E 1CLQA 3N1BA 4QNDA 4ADOA 4DTXA 3K2OA 2JPNA 2MZWB 3E4WA 2E32A 3QEWA 3QEIA 4EP9A 3NCIA 3QEXA 2P5OA 3SUOA 1Q9XA 3C6OB 1MTYG 2H4TA 1XVCE 3HL8A 4FJHA 4RG8A 3S9HA 2LF3A 2P5GA 4M41A 3CFPA 3UIQA 1XVDE 3C6PB 4QNCA 4EPHA 1FZ4E 1FZ8E 2QXFA 4I6JB 3RWUA 3L1NA 4FJGA 4HCCA 2OVRB 2PFVA 1P22A 4M42A 3C6NB 4J2DA 4J2AA 4HCBA 2B7MA 1LDKE 3OGKB 1FS1A 3SPYA 4M3TA 4AI6A 3SPZA 2MMBA 3NE6A 4FJKA 4KI4A 4DTRA 4FVMA 2HD0A 4J2BA 2RCUA 4DU3A 3LZJA 1XMFE 3TAEA 3NDKA 3QEVA 3SUQA 2DTUA 4FK4A 4AKHA 1XMHE 1MMOG 4DTMA 2OVQB 3MKSB 4FJMA 4FJ5A 2JHPA 4FJXA 1XVGE 3SQ0A 3TJYA 2P1PB 4I9LA 4M3RA 4DU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1FZH E;  1FZ3 E;  1XVD E;  4GAM C;  1FZ4 E;  1XU3 E;  1FZ8 E;  1MHY G;  1FZ6 E;  1FYZ E;  1XVF E;  1FZ5 E;  1FZ2 E;  1XU5 E;  1FZ0 E;  1XVE E;  1FZ1 E;  1XMF E;  1XVB E;  1FZI E;  1FZ9 E;  1XMH E;  1MMO G;  1MHZ G;  1XMG E;  1XVG E;  1MTY G;  1XVC E; 
#chains in the Genus database with same CATH topology
 1FZH E;  3RMC A;  2FW3 A;  4B08 A;  3NHG A;  3LD8 A;  4DU1 A;  3SQ2 A;  4M3X A;  2OZM A;  3L0M A;  3C95 A;  4M3U A;  2YB5 A;  2B8I A;  2OVP B;  3TAG A;  4DTU A;  3L2O B;  3OGM B;  1FZ5 E;  3LDB A;  2JH8 A;  3WSO A;  4FK0 A;  4FJ9 A;  4FJL A;  4KHY A;  2DEB A;  1NEX B;  3CFO A;  3J27 A;  4AKG A;  1XVE E;  3QNN A;  4DTN A;  4KHU A;  4M45 A;  4RNG A;  1XVB E;  3HP9 A;  4JS5 A;  3J2P A;  1FZ9 E;  3RMA A;  3UO2 A;  3CFR A;  3TAB A;  3SCX A;  1XMG E;  2JHC A;  5IRE A;  4FK2 A;  4RL5 A;  2VJ4 A;  2VIX A;  2ATQ A;  4JRP A;  1FZ7 E;  3LZI A;  4AKI A;  1XL3 C;  4I9Q A;  4M3W A;  1XU3 E;  1IH7 A;  3HGK E;  2OYQ A;  2B1E A;  3SJJ A;  1FZ6 E;  2JH9 A;  2MW2 A;  4DTO A;  1XVF E;  3NGI A;  2P1M B;  4FJN A;  3HGL A;  3L8B A;  3QET A;  3QNO A;  3QES A;  1WAF A;  1IG9 A;  3TL8 B;  1FZ0 E;  4J2E A;  3V7D B;  2E31 A;  5IZ7 A;  4FJI A;  4FJ8 A;  1FZI E;  3N1E A;  3SVI A;  4KHN A;  2VJ5 A;  3SI6 A;  3KD1 E;  3SQ4 A;  1MHZ G;  1Q9Y A;  2K5S A;  2P1N B;  3BVO A;  4KHW A;  4M3Y A;  4JRQ A;  3E4Y A;  3SNN A;  4ADN A;  4FJ7 A;  1WAJ A;  3TAF A;  4KHQ A;  1FZ3 E;  3C94 A;  3SQ1 A;  2P1Q B;  2PFT A;  4GAM C;  3LDS A;  4KHS A;  3KD5 E;  1MHY G;  3SUN A;  4FJJ A;  4KI6 A;  4EYW A;  2JHA A;  3SUP A;  5IBK B;  1FYZ E;  4JS4 A;  4DTS A;  2FYO A;  2LF6 A;  4X5N A;  4DTJ A;  2DY4 A;  1FXX A;  3QER A;  4DTP A;  2RKH A;  4M3Z A;  5H37 A;  3NAE A;  3QEP A;  1FZ2 E;  3RMB A;  3OGL B;  2OZS A;  2P1O B;  1XU5 E;  4X5M A;  3CQ8 A;  4E4B A;  4E3S A;  3RMD A;  1FZ1 E;  1CLQ A;  3N1B A;  4QND A;  4ADO A;  4DTX A;  3K2O A;  2JPN A;  4IT5 A;  2MZW B;  3E4W A;  2E32 A;  3QEW A;  3QEI A;  4EP9 A;  3NCI A;  3QEX A;  2P5O A;  3SUO A;  1Q9X A;  3C6O B;  1MTY G;  2H4T A;  1XVC E;  3HL8 A;  4FJH A;  4RG8 A;  1N1C A;  3S9H A;  2LF3 A;  2P5G A;  4M41 A;  3CFP A;  3UIQ A;  1XVD E;  3C6P B;  4QNC A;  4ICG C;  4EPH A;  1FZ4 E;  1FZ8 E;  2QXF A;  4I6J B;  3RWU A;  3L1N A;  4FJG A;  4HCC A;  2OVR B;  2PFV A;  1P22 A;  4M42 A;  3C6N B;  1JW2 A;  4J2D A;  4J2A A;  4HCB A;  2B7M A;  1LDK E;  3OGK B;  1FS1 A;  3SPY A;  4M3T A;  4AI6 A;  3SPZ A;  2MMB A;  3NE6 A;  4FJK A;  4KI4 A;  4DTR A;  4FVM A;  2HD0 A;  2JQT A;  1FPO A;  4J2B A;  2RCU A;  4DU3 A;  3LZJ A;  1XMF E;  3TAE A;  3NDK A;  3QEV A;  3SUQ A;  2DTU A;  4FK4 A;  4AKH A;  1XMH E;  1MMO G;  4DTM A;  2OVQ B;  3MKS B;  4FJM A;  4FJ5 A;  2JHP A;  4FJX A;  1XVG E;  3SQ0 A;  3TJY A;  2P1P B;  3UO3 A;  4I9L A;  4M3R A;  4DU4 A; 
#chains in the Genus database with same CATH homology
 1FZH E;  3RMC A;  2FW3 A;  4B08 A;  3NHG A;  3LD8 A;  4DU1 A;  3SQ2 A;  4M3X A;  2OZM A;  3L0M A;  3C95 A;  4M3U A;  2YB5 A;  2B8I A;  2OVP B;  3TAG A;  4DTU A;  3L2O B;  3OGM B;  1FZ5 E;  3LDB A;  2JH8 A;  3WSO A;  4FK0 A;  4FJ9 A;  4FJL A;  4KHY A;  2DEB A;  1NEX B;  3CFO A;  3J27 A;  4AKG A;  1XVE E;  3QNN A;  4DTN A;  4KHU A;  4M45 A;  4RNG A;  1XVB E;  3HP9 A;  4JS5 A;  3J2P A;  1FZ9 E;  3RMA A;  3CFR A;  3TAB A;  3SCX A;  1XMG E;  2JHC A;  5IRE A;  4FK2 A;  4RL5 A;  2VJ4 A;  2VIX A;  2ATQ A;  4JRP A;  1FZ7 E;  3LZI A;  4AKI A;  1XL3 C;  4I9Q A;  4M3W A;  1XU3 E;  1IH7 A;  3HGK E;  2OYQ A;  2B1E A;  3SJJ A;  1FZ6 E;  2JH9 A;  4DTO A;  1XVF E;  3NGI A;  2P1M B;  4FJN A;  3HGL A;  3L8B A;  3QET A;  3QNO A;  3QES A;  1WAF A;  1IG9 A;  3TL8 B;  1FZ0 E;  4J2E A;  3V7D B;  2E31 A;  5IZ7 A;  4FJI A;  4FJ8 A;  1FZI E;  3N1E A;  3SVI A;  4KHN A;  2VJ5 A;  3SI6 A;  3KD1 E;  3SQ4 A;  1MHZ G;  1Q9Y A;  2P1N B;  4KHW A;  4M3Y A;  4JRQ A;  3E4Y A;  3SNN A;  4ADN A;  4FJ7 A;  1WAJ A;  3TAF A;  4KHQ A;  1FZ3 E;  3C94 A;  3SQ1 A;  2P1Q B;  2PFT A;  4GAM C;  3LDS A;  4KHS A;  3KD5 E;  1MHY G;  3SUN A;  4FJJ A;  4KI6 A;  4EYW A;  2JHA A;  3SUP A;  5IBK B;  1FYZ E;  4JS4 A;  4DTS A;  2FYO A;  2LF6 A;  4X5N A;  4DTJ A;  2DY4 A;  1FXX A;  3QER A;  4DTP A;  4M3Z A;  5H37 A;  3NAE A;  3QEP A;  1FZ2 E;  3RMB A;  3OGL B;  2OZS A;  2P1O B;  1XU5 E;  4X5M A;  3CQ8 A;  4E4B A;  4E3S A;  3RMD A;  1FZ1 E;  1CLQ A;  3N1B A;  4QND A;  4ADO A;  4DTX A;  3K2O A;  2JPN A;  2MZW B;  3E4W A;  2E32 A;  3QEW A;  3QEI A;  4EP9 A;  3NCI A;  3QEX A;  2P5O A;  3SUO A;  1Q9X A;  3C6O B;  1MTY G;  2H4T A;  1XVC E;  3HL8 A;  4FJH A;  4RG8 A;  3S9H A;  2LF3 A;  2P5G A;  4M41 A;  3CFP A;  3UIQ A;  1XVD E;  3C6P B;  4QNC A;  4EPH A;  1FZ4 E;  1FZ8 E;  2QXF A;  4I6J B;  3RWU A;  3L1N A;  4FJG A;  4HCC A;  2OVR B;  2PFV A;  1P22 A;  4M42 A;  3C6N B;  4J2D A;  4J2A A;  4HCB A;  2B7M A;  1LDK E;  3OGK B;  1FS1 A;  3SPY A;  4M3T A;  4AI6 A;  3SPZ A;  2MMB A;  3NE6 A;  4FJK A;  4KI4 A;  4DTR A;  4FVM A;  2HD0 A;  4J2B A;  2RCU A;  4DU3 A;  3LZJ A;  1XMF E;  3TAE A;  3NDK A;  3QEV A;  3SUQ A;  2DTU A;  4FK4 A;  4AKH A;  1XMH E;  1MMO G;  4DTM A;  2OVQ B;  3MKS B;  4FJM A;  4FJ5 A;  2JHP A;  4FJX A;  1XVG E;  3SQ0 A;  3TJY A;  2P1P B;  4I9L A;  4M3R A;  4DU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...