1FZ4E

Methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 58
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E02
1XVBE 1FZ1E 1FZ9E 1FZ4E 1MMOG 1XMGE 1FZ2E 4GAMC 1MHZG 1XVGE 1XMHE 1XVDE 1FZ7E 1FZHE 1XVEE 1XMFE 1XU5E 1FZ3E 1MTYG 1FZ5E 1FZ6E 1XVCE 1FZIE 1FYZE 1FZ0E 1MHYG 1XU3E 1XVFE 1FZ8E
chains in the Genus database with same CATH superfamily
2QXFA 4FJMA 2FYOA 3J2PA 3CFRA 3RWUA 1FZ1E 3SUOA 2P1NB 3SCXA 3SQ1A 4FJXA 3N1BA 4JRQA 3LZJA 3KD1E 3TAFA 3NGIA 3QESA 1MMOG 1XMGE 2FW3A 3LDBA 4M3WA 1FZ2E 3RMDA 1MHZG 2P1MB 4ICGC 4QNDA 1XMHE 3WSOA 2VJ4A 4DTOA 1Q9YA 3KD5E 4FJLA 4KHUA 4M3XA 1P22A 2DTUA 2ATQA 1FPOA 2P1QB 1FZ3E 3SQ4A 4JRPA 4DTXA 2OZMA 3C95A 4X5NA 2B8IA 2OYQA 2JH9A 1XVCE 3LDSA 4AKIA 4M3YA 1MHYG 4FJHA 3QEIA 2JHCA 3L1NA 3OGMB 3BVOA 3OGLB 1CLQA 3HP9A 1WAJA 4EP9A 1WAFA 2YB5A 3L8BA 1XVBE 2PFVA 2DEBA 3L2OB 3QERA 4FK2A 4X5MA 4DTSA 2H4TA 2JPNA 2P5GA 4FVMA 3SUNA 3QEXA 1FS1A 2JH8A 5IZ7A 3MKSB 4M3UA 3L0MA 4RG8A 3HGKE 3RMCA 1XVGE 1XVDE 3N1EA 3UO3A 4DTNA 3TAGA 3C6NB 4KI4A 1XL3C 4FJ8A 3C94A 3QETA 3QEPA 1XVEE 3TJYA 3SI6A 3SVIA 4M42A 3QEVA 4FK4A 1FXXA 1MTYG 2OVRB 2LF6A 1Q9XA 1FZ6E 1IG9A 2HD0A 2MZWB 1FZIE 4ADOA 3TAEA 4KHWA 3NE6A 4M45A 4DU1A 4KI6A 3C6OB 3SQ2A 2B1EA 2OVPB 3LD8A 1XVFE 2E32A 2VIXA 1FZ8E 4M3RA 3V7DB 4ADNA 4DTJA 2DY4A 3C6PB 3RMBA 2JHPA 2VJ5A 4DTRA 4M3TA 1FZ9E 3CFPA 2MW2A 4AI6A 3TL8B 4DTPA 1LDKE 3TABA 3K2OA 4M41A 4IT5A 4AKGA 4FJ9A 2E31A 3NCIA 4KHSA 2OVQB 4GAMC 4M3ZA 3NAEA 1IH7A 1FZHE 4DTMA 3QNOA 2MMBA 3SUQA 1XMFE 1XU5E 4JS4A 3S9HA 4FJJA 3SQ0A 2RKHA 3QEWA 2P1OB 1N1CA 1JW2A 4E4BA 1XU3E 4RNGA 4EPHA 4JS5A 4DTUA 4FJKA 3E4WA 5H37A 3HL8A 3RMAA 2P5OA 4FJGA 2LF3A 4QNCA 4FK0A 2K5SA 3OGKB 5IBKB 4DU4A 3HGLA 3QNNA 2P1PB 1FZ4E 4HCCA 3NDKA 3UIQA 4J2DA 2OZSA 4FJNA 4EYWA 3SPZA 4J2BA 5IREA 3LZIA 4FJIA 4I6JB 4E3SA 4DU3A 3SUPA 1FZ7E 2B7MA 3J27A 3CQ8A 4KHQA 3UO2A 4I9QA 4B08A 4FJ5A 3NHGA 3SJJA 2RCUA 1FZ5E 4I9LA 4FJ7A 3CFOA 4KHYA 1FYZE 3SNNA 2PFTA 3SPYA 1FZ0E 2JQTA 4AKHA 4J2AA 1NEXB 4J2EA 4HCBA 4KHNA 4RL5A 2JHAA 3E4YA
chains in the Genus database with same CATH topology
2QXFA 4FJMA 2FYOA 3J2PA 3CFRA 3RWUA 1FZ1E 3SUOA 2P1NB 3SCXA 3SQ1A 4FJXA 3N1BA 4JRQA 3LZJA 3KD1E 3TAFA 3NGIA 3QESA 1MMOG 1XMGE 2FW3A 3LDBA 4M3WA 1FZ2E 3RMDA 1MHZG 2P1MB 3WSOA 4QNDA 1XMHE 1Q9YA 2VJ4A 4DTOA 3KD5E 4FJLA 4KHUA 1P22A 2DTUA 2ATQA 2P1QB 1FZ3E 3SQ4A 4JRPA 4DTXA 2OZMA 3C95A 4X5NA 2B8IA 2OYQA 2JH9A 1XVCE 3LDSA 4AKIA 4M3YA 1MHYG 4FJHA 3QEIA 2JHCA 3L1NA 3OGMB 3OGLB 1CLQA 3HP9A 1WAJA 4EP9A 1WAFA 2YB5A 3L8BA 1XVBE 2PFVA 2DEBA 3L2OB 3QERA 4FK2A 4X5MA 4DTSA 2H4TA 2JPNA 2P5GA 4FVMA 3SUNA 3QEXA 1FS1A 2JH8A 5IZ7A 3MKSB 4M3UA 3L0MA 4RG8A 3HGKE 3RMCA 1XVGE 1XVDE 3N1EA 4DTNA 3TAGA 4KI4A 3C6NB 4M3XA 1XL3C 4FJ8A 3C94A 3QETA 3QEPA 1XVEE 3TJYA 3SI6A 3SVIA 4M42A 3QEVA 4FK4A 1FXXA 1MTYG 2OVRB 2LF6A 1Q9XA 1FZ6E 1IG9A 2HD0A 2MZWB 1FZIE 4ADOA 3TAEA 4KHWA 3NE6A 4M45A 4DU1A 4KI6A 3C6OB 3SQ2A 2B1EA 2OVPB 3LD8A 1XVFE 2E32A 2VIXA 1FZ8E 4M3RA 3V7DB 4ADNA 4DTJA 2DY4A 3C6PB 3RMBA 2JHPA 2VJ5A 4DTRA 4M3TA 1FZ9E 3CFPA 4AI6A 3TL8B 4DTPA 1LDKE 3TABA 3K2OA 4M41A 4AKGA 4FJ9A 2E31A 3NCIA 4KHSA 2OVQB 4GAMC 4M3ZA 3NAEA 1IH7A 1FZHE 4DTMA 3QNOA 2MMBA 3SUQA 1XMFE 1XU5E 4JS4A 3S9HA 4FJJA 3SQ0A 3QEWA 2P1OB 4E4BA 1XU3E 4RNGA 4EPHA 4JS5A 4DTUA 4FJKA 3E4WA 5H37A 3HL8A 3RMAA 2P5OA 4FJGA 2LF3A 4QNCA 4FK0A 3OGKB 5IBKB 4DU4A 3HGLA 3QNNA 2P1PB 1FZ4E 4HCCA 3NDKA 3UIQA 4J2DA 2OZSA 4FJNA 4EYWA 3SPZA 4J2BA 5IREA 3LZIA 4FJIA 4I6JB 4E3SA 4DU3A 3SUPA 1FZ7E 2B7MA 3J27A 3CQ8A 4KHQA 4I9QA 4B08A 4FJ5A 3NHGA 3SJJA 2RCUA 1FZ5E 4I9LA 4FJ7A 3CFOA 4KHYA 1FYZE 3SNNA 2PFTA 3SPYA 1FZ0E 4AKHA 4J2AA 1NEXB 4J2EA 4HCBA 4KHNA 4RL5A 2JHAA 3E4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVB E;  1FZ1 E;  1FZ9 E;  1FZ4 E;  1MMO G;  1XMG E;  1FZ2 E;  4GAM C;  1MHZ G;  1XVG E;  1XMH E;  1XVD E;  1FZ7 E;  1FZH E;  1XVE E;  1XMF E;  1XU5 E;  1FZ3 E;  1MTY G;  1FZ5 E;  1FZ6 E;  1XVC E;  1FZI E;  1FYZ E;  1FZ0 E;  1MHY G;  1XU3 E;  1XVF E;  1FZ8 E; 
#chains in the Genus database with same CATH topology
 2QXF A;  4FJM A;  2FYO A;  3J2P A;  3CFR A;  3RWU A;  1FZ1 E;  3SUO A;  2P1N B;  3SCX A;  3SQ1 A;  4FJX A;  3N1B A;  4JRQ A;  3LZJ A;  3KD1 E;  3TAF A;  3NGI A;  3QES A;  1MMO G;  1XMG E;  2FW3 A;  3LDB A;  4M3W A;  1FZ2 E;  3RMD A;  1MHZ G;  2P1M B;  4ICG C;  4QND A;  1XMH E;  3WSO A;  2VJ4 A;  4DTO A;  1Q9Y A;  3KD5 E;  4FJL A;  4KHU A;  4M3X A;  1P22 A;  2DTU A;  2ATQ A;  1FPO A;  2P1Q B;  1FZ3 E;  3SQ4 A;  4JRP A;  4DTX A;  2OZM A;  3C95 A;  4X5N A;  2B8I A;  2OYQ A;  2JH9 A;  1XVC E;  3LDS A;  4AKI A;  4M3Y A;  1MHY G;  4FJH A;  3QEI A;  2JHC A;  3L1N A;  3OGM B;  3BVO A;  3OGL B;  1CLQ A;  3HP9 A;  1WAJ A;  4EP9 A;  1WAF A;  2YB5 A;  3L8B A;  1XVB E;  2PFV A;  2DEB A;  3L2O B;  3QER A;  4FK2 A;  4X5M A;  4DTS A;  2H4T A;  2JPN A;  2P5G A;  4FVM A;  3SUN A;  3QEX A;  1FS1 A;  2JH8 A;  5IZ7 A;  3MKS B;  4M3U A;  3L0M A;  4RG8 A;  3HGK E;  3RMC A;  1XVG E;  1XVD E;  3N1E A;  3UO3 A;  4DTN A;  3TAG A;  3C6N B;  4KI4 A;  1XL3 C;  4FJ8 A;  3C94 A;  3QET A;  3QEP A;  1XVE E;  3TJY A;  3SI6 A;  3SVI A;  4M42 A;  3QEV A;  4FK4 A;  1FXX A;  1MTY G;  2OVR B;  2LF6 A;  1Q9X A;  1FZ6 E;  1IG9 A;  2HD0 A;  2MZW B;  1FZI E;  4ADO A;  3TAE A;  4KHW A;  3NE6 A;  4M45 A;  4DU1 A;  4KI6 A;  3C6O B;  3SQ2 A;  2B1E A;  2OVP B;  3LD8 A;  1XVF E;  2E32 A;  2VIX A;  1FZ8 E;  4M3R A;  3V7D B;  4ADN A;  4DTJ A;  2DY4 A;  3C6P B;  3RMB A;  2JHP A;  2VJ5 A;  4DTR A;  4M3T A;  1FZ9 E;  3CFP A;  2MW2 A;  4AI6 A;  3TL8 B;  4DTP A;  1LDK E;  3TAB A;  3K2O A;  4M41 A;  4IT5 A;  4AKG A;  4FJ9 A;  2E31 A;  3NCI A;  4KHS A;  2OVQ B;  4GAM C;  4M3Z A;  3NAE A;  1IH7 A;  1FZH E;  4DTM A;  3QNO A;  2MMB A;  3SUQ A;  1XMF E;  1XU5 E;  4JS4 A;  3S9H A;  4FJJ A;  3SQ0 A;  2RKH A;  3QEW A;  2P1O B;  1N1C A;  1JW2 A;  4E4B A;  1XU3 E;  4RNG A;  4EPH A;  4JS5 A;  4DTU A;  4FJK A;  3E4W A;  5H37 A;  3HL8 A;  3RMA A;  2P5O A;  4FJG A;  2LF3 A;  4QNC A;  4FK0 A;  2K5S A;  3OGK B;  5IBK B;  4DU4 A;  3HGL A;  3QNN A;  2P1P B;  1FZ4 E;  4HCC A;  3NDK A;  3UIQ A;  4J2D A;  2OZS A;  4FJN A;  4EYW A;  3SPZ A;  4J2B A;  5IRE A;  3LZI A;  4FJI A;  4I6J B;  4E3S A;  4DU3 A;  3SUP A;  1FZ7 E;  2B7M A;  3J27 A;  3CQ8 A;  4KHQ A;  3UO2 A;  4I9Q A;  4B08 A;  4FJ5 A;  3NHG A;  3SJJ A;  2RCU A;  1FZ5 E;  4I9L A;  4FJ7 A;  3CFO A;  4KHY A;  1FYZ E;  3SNN A;  2PFT A;  3SPY A;  1FZ0 E;  2JQT A;  4AKH A;  4J2A A;  1NEX B;  4J2E A;  4HCB A;  4KHN A;  4RL5 A;  2JHA A;  3E4Y A; 
#chains in the Genus database with same CATH homology
 2QXF A;  4FJM A;  2FYO A;  3J2P A;  3CFR A;  3RWU A;  1FZ1 E;  3SUO A;  2P1N B;  3SCX A;  3SQ1 A;  4FJX A;  3N1B A;  4JRQ A;  3LZJ A;  3KD1 E;  3TAF A;  3NGI A;  3QES A;  1MMO G;  1XMG E;  2FW3 A;  3LDB A;  4M3W A;  1FZ2 E;  3RMD A;  1MHZ G;  2P1M B;  3WSO A;  4QND A;  1XMH E;  1Q9Y A;  2VJ4 A;  4DTO A;  3KD5 E;  4FJL A;  4KHU A;  1P22 A;  2DTU A;  2ATQ A;  2P1Q B;  1FZ3 E;  3SQ4 A;  4JRP A;  4DTX A;  2OZM A;  3C95 A;  4X5N A;  2B8I A;  2OYQ A;  2JH9 A;  1XVC E;  3LDS A;  4AKI A;  4M3Y A;  1MHY G;  4FJH A;  3QEI A;  2JHC A;  3L1N A;  3OGM B;  3OGL B;  1CLQ A;  3HP9 A;  1WAJ A;  4EP9 A;  1WAF A;  2YB5 A;  3L8B A;  1XVB E;  2PFV A;  2DEB A;  3L2O B;  3QER A;  4FK2 A;  4X5M A;  4DTS A;  2H4T A;  2JPN A;  2P5G A;  4FVM A;  3SUN A;  3QEX A;  1FS1 A;  2JH8 A;  5IZ7 A;  3MKS B;  4M3U A;  3L0M A;  4RG8 A;  3HGK E;  3RMC A;  1XVG E;  1XVD E;  3N1E A;  4DTN A;  3TAG A;  4KI4 A;  3C6N B;  4M3X A;  1XL3 C;  4FJ8 A;  3C94 A;  3QET A;  3QEP A;  1XVE E;  3TJY A;  3SI6 A;  3SVI A;  4M42 A;  3QEV A;  4FK4 A;  1FXX A;  1MTY G;  2OVR B;  2LF6 A;  1Q9X A;  1FZ6 E;  1IG9 A;  2HD0 A;  2MZW B;  1FZI E;  4ADO A;  3TAE A;  4KHW A;  3NE6 A;  4M45 A;  4DU1 A;  4KI6 A;  3C6O B;  3SQ2 A;  2B1E A;  2OVP B;  3LD8 A;  1XVF E;  2E32 A;  2VIX A;  1FZ8 E;  4M3R A;  3V7D B;  4ADN A;  4DTJ A;  2DY4 A;  3C6P B;  3RMB A;  2JHP A;  2VJ5 A;  4DTR A;  4M3T A;  1FZ9 E;  3CFP A;  4AI6 A;  3TL8 B;  4DTP A;  1LDK E;  3TAB A;  3K2O A;  4M41 A;  4AKG A;  4FJ9 A;  2E31 A;  3NCI A;  4KHS A;  2OVQ B;  4GAM C;  4M3Z A;  3NAE A;  1IH7 A;  1FZH E;  4DTM A;  3QNO A;  2MMB A;  3SUQ A;  1XMF E;  1XU5 E;  4JS4 A;  3S9H A;  4FJJ A;  3SQ0 A;  3QEW A;  2P1O B;  4E4B A;  1XU3 E;  4RNG A;  4EPH A;  4JS5 A;  4DTU A;  4FJK A;  3E4W A;  5H37 A;  3HL8 A;  3RMA A;  2P5O A;  4FJG A;  2LF3 A;  4QNC A;  4FK0 A;  3OGK B;  5IBK B;  4DU4 A;  3HGL A;  3QNN A;  2P1P B;  1FZ4 E;  4HCC A;  3NDK A;  3UIQ A;  4J2D A;  2OZS A;  4FJN A;  4EYW A;  3SPZ A;  4J2B A;  5IRE A;  3LZI A;  4FJI A;  4I6J B;  4E3S A;  4DU3 A;  3SUP A;  1FZ7 E;  2B7M A;  3J27 A;  3CQ8 A;  4KHQ A;  4I9Q A;  4B08 A;  4FJ5 A;  3NHG A;  3SJJ A;  2RCU A;  1FZ5 E;  4I9L A;  4FJ7 A;  3CFO A;  4KHY A;  1FYZ E;  3SNN A;  2PFT A;  3SPY A;  1FZ0 E;  4AKH A;  4J2A A;  1NEX B;  4J2E A;  4HCB A;  4KHN A;  4RL5 A;  2JHA A;  3E4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...