1FZ4E

Methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 58
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E02
1XU5E 1XVEE 1FZ5E 1FZ0E 1XU3E 1MHZG 1XMGE 1FYZE 1FZ9E 1FZ4E 1XVGE 1MTYG 1XMHE 1XVDE 1FZIE 1XVFE 1FZHE 1XVBE 4GAMC 1FZ2E 1MHYG 1XVCE 1FZ1E 1FZ7E 1FZ8E 1FZ6E 1XMFE 1MMOG 1FZ3E
chains in the Genus database with same CATH superfamily
4JS4A 2YB5A 4M3UA 3LZJA 4E4BA 4DU4A 4FJ8A 3SUNA 3CFRA 4FK2A 3C95A 1FZ0E 3SUQA 4HCCA 4AI6A 4M3WA 3L0MA 3QETA 4KHQA 2P1QB 4B08A 3QEVA 2OZMA 4QNDA 4RNGA 4I6JB 3LD8A 3TAFA 4J2BA 2LF3A 3C6OB 4FJMA 4FK0A 1XVDE 4KHUA 3E4YA 3N1BA 4X5MA 3SPYA 1FZIE 4HCBA 3N1EA 1LDKE 3TJYA 4ADNA 2LF6A 5IREA 2DEBA 3OGLB 3QNNA 3RMDA 2P1OB 1FZ2E 4GAMC 1MHYG 3QERA 4DU3A 3SCXA 4KHWA 2P1MB 4IT5A 2VJ4A 3NHGA 1FZ7E 4DTXA 2OZSA 1CLQA 2OYQA 4RL5A 4M3TA 2B1EA 2OVRB 3NE6A 3CFOA 4M41A 3LZIA 3QNOA 3HP9A 3S9HA 4DTJA 4FJXA 4KI4A 2JQTA 4J2DA 4E3SA 3RMCA 2QXFA 2OVPB 3SVIA 1XL3C 2P1NB 3CFPA 3SUPA 1Q9YA 4FJKA 3J2PA 4AKIA 4AKGA 1FZ5E 4FJNA 1FPOA 3OGMB 4M3RA 4JRQA 3QEIA 1JW2A 1FS1A 3RMBA 3KD5E 3C6PB 3TL8B 1FZ4E 2VIXA 3QEPA 4FVMA 1XMHE 4FJIA 4KHSA 2PFVA 2DY4A 2B8IA 4J2EA 2OVQB 1Q9XA 3LDBA 1FZHE 2E32A 4DTMA 3RWUA 1N1CA 1XVCE 4M3ZA 4M3YA 2B7MA 2FW3A 3SQ4A 4JS5A 3TAEA 1FZ8E 4FJJA 2VJ5A 2RCUA 3SPZA 3V7DB 3C94A 3OGKB 1FZ6E 4RG8A 4I9QA 4EP9A 1XU5E 1XVEE 2JHCA 4QNCA 3NCIA 4DU1A 3SI6A 3WSOA 3NDKA 3KD1E 4M42A 4FJHA 1MHZG 4EPHA 5IZ7A 4FK4A 1XMGE 1FYZE 2JH8A 2MMBA 1FZ9E 1P22A 1IH7A 3E4WA 3SQ0A 3CQ8A 4JRPA 2JHPA 1XMFE 4EYWA 2JPNA 1IG9A 4J2AA 3J27A 2P5GA 2H4TA 2HD0A 4DTPA 3HGKE 2P5OA 4AKHA 4DTUA 4FJLA 1FXXA 3SQ1A 4M3XA 3NAEA 2K5SA 3SJJA 4ADOA 3NGIA 4FJGA 4I9LA 3MKSB 4KI6A 4DTOA 2JH9A 5IBKB 1MMOG 3C6NB 1FZ3E 3UIQA 3BVOA 1WAJA 3L8BA 3SQ2A 4M45A 3L2OB 3TAGA 1XU3E 3TABA 3RMAA 4DTSA 3HGLA 2JHAA 4KHYA 4X5NA 2MZWB 1XVGE 5H37A 1MTYG 2DTUA 3L1NA 4KHNA 4ICGC 1XVFE 2MW2A 1XVBE 3K2OA 4FJ9A 2E31A 3QEXA 3QEWA 1FZ1E 4DTNA 3SUOA 3QESA 3UO2A 3HL8A 2FYOA 1WAFA 3SNNA 3LDSA 2P1PB 3UO3A 4FJ7A 1NEXB 4DTRA 2PFTA 2ATQA 4FJ5A 2RKHA
chains in the Genus database with same CATH topology
4JS4A 2YB5A 4M3UA 3LZJA 4E4BA 4DU4A 4FJ8A 3SUNA 3CFRA 4FK2A 3C95A 1FZ0E 3SUQA 4HCCA 4AI6A 4M3WA 3L0MA 3QETA 4KHQA 2P1QB 4B08A 3QEVA 2OZMA 4QNDA 4RNGA 4I6JB 3LD8A 3TAFA 4J2BA 2LF3A 3C6OB 4FJMA 4FK0A 1XVDE 4KHUA 3E4YA 3N1BA 4X5MA 3SPYA 1FZIE 4HCBA 3N1EA 1LDKE 3TJYA 4ADNA 2LF6A 5IREA 2DEBA 3OGLB 3QNNA 3RMDA 2P1OB 1FZ2E 4GAMC 1MHYG 3QERA 4DU3A 3SCXA 4KHWA 2P1MB 2VJ4A 3NHGA 1FZ7E 4DTXA 2OZSA 1CLQA 2OYQA 4RL5A 4M3TA 2B1EA 2OVRB 3NE6A 3CFOA 4M41A 3LZIA 3QNOA 3HP9A 3S9HA 4DTJA 4FJXA 4KI4A 4J2DA 4E3SA 3RMCA 2QXFA 2OVPB 3SVIA 1XL3C 2P1NB 3CFPA 3SUPA 1Q9YA 4FJKA 3J2PA 4AKIA 4AKGA 1FZ5E 4FJNA 3OGMB 4JRQA 4M3RA 3QEIA 1FS1A 3RMBA 3KD5E 3C6PB 3TL8B 1FZ4E 2VIXA 3QEPA 4FVMA 1XMHE 4FJIA 4KHSA 2PFVA 2DY4A 2B8IA 4J2EA 2OVQB 1Q9XA 3LDBA 1FZHE 2E32A 4DTMA 3RWUA 1XVCE 4M3ZA 4M3YA 2B7MA 2FW3A 3SQ4A 4JS5A 3TAEA 1FZ8E 4FJJA 2VJ5A 2RCUA 3SPZA 3V7DB 3C94A 3OGKB 1FZ6E 4RG8A 4I9QA 4EP9A 1XU5E 1XVEE 2JHCA 4QNCA 3NCIA 4DU1A 3SI6A 3WSOA 3NDKA 3KD1E 4M42A 4FJHA 1MHZG 4EPHA 5IZ7A 4FK4A 1XMGE 1FYZE 2JH8A 2MMBA 1FZ9E 1P22A 1IH7A 3E4WA 3SQ0A 3CQ8A 4JRPA 2JHPA 1XMFE 4EYWA 2JPNA 1IG9A 4J2AA 3J27A 2P5GA 2H4TA 2HD0A 4DTPA 3HGKE 2P5OA 4AKHA 4DTUA 4FJLA 1FXXA 3SQ1A 4M3XA 3NAEA 3SJJA 4ADOA 3NGIA 4FJGA 4I9LA 3MKSB 4KI6A 4DTOA 2JH9A 5IBKB 1MMOG 3C6NB 1FZ3E 3UIQA 1WAJA 3L8BA 3SQ2A 4M45A 3L2OB 3TAGA 1XU3E 3TABA 3RMAA 4DTSA 3HGLA 2JHAA 4KHYA 4X5NA 2MZWB 1XVGE 5H37A 1MTYG 2DTUA 3L1NA 4KHNA 1XVFE 1XVBE 3K2OA 4FJ9A 2E31A 3QEXA 3QEWA 1FZ1E 4DTNA 3SUOA 3QESA 3HL8A 2FYOA 1WAFA 3SNNA 3LDSA 2P1PB 4FJ7A 1NEXB 4DTRA 2PFTA 2ATQA 4FJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU5 E;  1XVE E;  1FZ5 E;  1FZ0 E;  1XU3 E;  1MHZ G;  1XMG E;  1FYZ E;  1FZ9 E;  1FZ4 E;  1XVG E;  1MTY G;  1XMH E;  1XVD E;  1FZI E;  1XVF E;  1FZH E;  1XVB E;  4GAM C;  1FZ2 E;  1MHY G;  1XVC E;  1FZ1 E;  1FZ7 E;  1FZ8 E;  1FZ6 E;  1XMF E;  1MMO G;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 4JS4 A;  2YB5 A;  4M3U A;  3LZJ A;  4E4B A;  4DU4 A;  4FJ8 A;  3SUN A;  3CFR A;  4FK2 A;  3C95 A;  1FZ0 E;  3SUQ A;  4HCC A;  4AI6 A;  4M3W A;  3L0M A;  3QET A;  4KHQ A;  2P1Q B;  4B08 A;  3QEV A;  2OZM A;  4QND A;  4RNG A;  4I6J B;  3LD8 A;  3TAF A;  4J2B A;  2LF3 A;  3C6O B;  4FJM A;  4FK0 A;  1XVD E;  4KHU A;  3E4Y A;  3N1B A;  4X5M A;  3SPY A;  1FZI E;  4HCB A;  3N1E A;  1LDK E;  3TJY A;  4ADN A;  2LF6 A;  5IRE A;  2DEB A;  3OGL B;  3QNN A;  3RMD A;  2P1O B;  1FZ2 E;  4GAM C;  1MHY G;  3QER A;  4DU3 A;  3SCX A;  4KHW A;  2P1M B;  4IT5 A;  2VJ4 A;  3NHG A;  1FZ7 E;  4DTX A;  2OZS A;  1CLQ A;  2OYQ A;  4RL5 A;  4M3T A;  2B1E A;  2OVR B;  3NE6 A;  3CFO A;  4M41 A;  3LZI A;  3QNO A;  3HP9 A;  3S9H A;  4DTJ A;  4FJX A;  4KI4 A;  2JQT A;  4J2D A;  4E3S A;  3RMC A;  2QXF A;  2OVP B;  3SVI A;  1XL3 C;  2P1N B;  3CFP A;  3SUP A;  1Q9Y A;  4FJK A;  3J2P A;  4AKI A;  4AKG A;  1FZ5 E;  4FJN A;  1FPO A;  3OGM B;  4M3R A;  4JRQ A;  3QEI A;  1JW2 A;  1FS1 A;  3RMB A;  3KD5 E;  3C6P B;  3TL8 B;  1FZ4 E;  2VIX A;  3QEP A;  4FVM A;  1XMH E;  4FJI A;  4KHS A;  2PFV A;  2DY4 A;  2B8I A;  4J2E A;  2OVQ B;  1Q9X A;  3LDB A;  1FZH E;  2E32 A;  4DTM A;  3RWU A;  1N1C A;  1XVC E;  4M3Z A;  4M3Y A;  2B7M A;  2FW3 A;  3SQ4 A;  4JS5 A;  3TAE A;  1FZ8 E;  4FJJ A;  2VJ5 A;  2RCU A;  3SPZ A;  3V7D B;  3C94 A;  3OGK B;  1FZ6 E;  4RG8 A;  4I9Q A;  4EP9 A;  1XU5 E;  1XVE E;  2JHC A;  4QNC A;  3NCI A;  4DU1 A;  3SI6 A;  3WSO A;  3NDK A;  3KD1 E;  4M42 A;  4FJH A;  1MHZ G;  4EPH A;  5IZ7 A;  4FK4 A;  1XMG E;  1FYZ E;  2JH8 A;  2MMB A;  1FZ9 E;  1P22 A;  1IH7 A;  3E4W A;  3SQ0 A;  3CQ8 A;  4JRP A;  2JHP A;  1XMF E;  4EYW A;  2JPN A;  1IG9 A;  4J2A A;  3J27 A;  2P5G A;  2H4T A;  2HD0 A;  4DTP A;  3HGK E;  2P5O A;  4AKH A;  4DTU A;  4FJL A;  1FXX A;  3SQ1 A;  4M3X A;  3NAE A;  2K5S A;  3SJJ A;  4ADO A;  3NGI A;  4FJG A;  4I9L A;  3MKS B;  4KI6 A;  4DTO A;  2JH9 A;  5IBK B;  1MMO G;  3C6N B;  1FZ3 E;  3UIQ A;  3BVO A;  1WAJ A;  3L8B A;  3SQ2 A;  4M45 A;  3L2O B;  3TAG A;  1XU3 E;  3TAB A;  3RMA A;  4DTS A;  3HGL A;  2JHA A;  4KHY A;  4X5N A;  2MZW B;  1XVG E;  5H37 A;  1MTY G;  2DTU A;  3L1N A;  4KHN A;  4ICG C;  1XVF E;  2MW2 A;  1XVB E;  3K2O A;  4FJ9 A;  2E31 A;  3QEX A;  3QEW A;  1FZ1 E;  4DTN A;  3SUO A;  3QES A;  3UO2 A;  3HL8 A;  2FYO A;  1WAF A;  3SNN A;  3LDS A;  2P1P B;  3UO3 A;  4FJ7 A;  1NEX B;  4DTR A;  2PFT A;  2ATQ A;  4FJ5 A;  2RKH A; 
#chains in the Genus database with same CATH homology
 4JS4 A;  2YB5 A;  4M3U A;  3LZJ A;  4E4B A;  4DU4 A;  4FJ8 A;  3SUN A;  3CFR A;  4FK2 A;  3C95 A;  1FZ0 E;  3SUQ A;  4HCC A;  4AI6 A;  4M3W A;  3L0M A;  3QET A;  4KHQ A;  2P1Q B;  4B08 A;  3QEV A;  2OZM A;  4QND A;  4RNG A;  4I6J B;  3LD8 A;  3TAF A;  4J2B A;  2LF3 A;  3C6O B;  4FJM A;  4FK0 A;  1XVD E;  4KHU A;  3E4Y A;  3N1B A;  4X5M A;  3SPY A;  1FZI E;  4HCB A;  3N1E A;  1LDK E;  3TJY A;  4ADN A;  2LF6 A;  5IRE A;  2DEB A;  3OGL B;  3QNN A;  3RMD A;  2P1O B;  1FZ2 E;  4GAM C;  1MHY G;  3QER A;  4DU3 A;  3SCX A;  4KHW A;  2P1M B;  2VJ4 A;  3NHG A;  1FZ7 E;  4DTX A;  2OZS A;  1CLQ A;  2OYQ A;  4RL5 A;  4M3T A;  2B1E A;  2OVR B;  3NE6 A;  3CFO A;  4M41 A;  3LZI A;  3QNO A;  3HP9 A;  3S9H A;  4DTJ A;  4FJX A;  4KI4 A;  4J2D A;  4E3S A;  3RMC A;  2QXF A;  2OVP B;  3SVI A;  1XL3 C;  2P1N B;  3CFP A;  3SUP A;  1Q9Y A;  4FJK A;  3J2P A;  4AKI A;  4AKG A;  1FZ5 E;  4FJN A;  3OGM B;  4JRQ A;  4M3R A;  3QEI A;  1FS1 A;  3RMB A;  3KD5 E;  3C6P B;  3TL8 B;  1FZ4 E;  2VIX A;  3QEP A;  4FVM A;  1XMH E;  4FJI A;  4KHS A;  2PFV A;  2DY4 A;  2B8I A;  4J2E A;  2OVQ B;  1Q9X A;  3LDB A;  1FZH E;  2E32 A;  4DTM A;  3RWU A;  1XVC E;  4M3Z A;  4M3Y A;  2B7M A;  2FW3 A;  3SQ4 A;  4JS5 A;  3TAE A;  1FZ8 E;  4FJJ A;  2VJ5 A;  2RCU A;  3SPZ A;  3V7D B;  3C94 A;  3OGK B;  1FZ6 E;  4RG8 A;  4I9Q A;  4EP9 A;  1XU5 E;  1XVE E;  2JHC A;  4QNC A;  3NCI A;  4DU1 A;  3SI6 A;  3WSO A;  3NDK A;  3KD1 E;  4M42 A;  4FJH A;  1MHZ G;  4EPH A;  5IZ7 A;  4FK4 A;  1XMG E;  1FYZ E;  2JH8 A;  2MMB A;  1FZ9 E;  1P22 A;  1IH7 A;  3E4W A;  3SQ0 A;  3CQ8 A;  4JRP A;  2JHP A;  1XMF E;  4EYW A;  2JPN A;  1IG9 A;  4J2A A;  3J27 A;  2P5G A;  2H4T A;  2HD0 A;  4DTP A;  3HGK E;  2P5O A;  4AKH A;  4DTU A;  4FJL A;  1FXX A;  3SQ1 A;  4M3X A;  3NAE A;  3SJJ A;  4ADO A;  3NGI A;  4FJG A;  4I9L A;  3MKS B;  4KI6 A;  4DTO A;  2JH9 A;  5IBK B;  1MMO G;  3C6N B;  1FZ3 E;  3UIQ A;  1WAJ A;  3L8B A;  3SQ2 A;  4M45 A;  3L2O B;  3TAG A;  1XU3 E;  3TAB A;  3RMA A;  4DTS A;  3HGL A;  2JHA A;  4KHY A;  4X5N A;  2MZW B;  1XVG E;  5H37 A;  1MTY G;  2DTU A;  3L1N A;  4KHN A;  1XVF E;  1XVB E;  3K2O A;  4FJ9 A;  2E31 A;  3QEX A;  3QEW A;  1FZ1 E;  4DTN A;  3SUO A;  3QES A;  3HL8 A;  2FYO A;  1WAF A;  3SNN A;  3LDS A;  2P1P B;  4FJ7 A;  1NEX B;  4DTR A;  2PFT A;  2ATQ A;  4FJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...