1FZ4E

Methane monooxygenase hydroxylase, form iii soaked at ph 8.5 (0.1 m tris)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 58
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz4E02
1XVGE 1FZ6E 1MTYG 1MHYG 1XMFE 1MHZG 1FZ0E 1XU3E 1FZ2E 1FZIE 1XVBE 1XVDE 1FZ1E 1FYZE 4GAMC 1FZ8E 1XVFE 1XVEE 1FZ7E 1XVCE 1FZ5E 1XMHE 1FZHE 1XMGE 1FZ4E 1FZ3E 1FZ9E 1MMOG 1XU5E
chains in the Genus database with same CATH superfamily
4FJLA 3TAEA 3CFOA 2RKHA 3LD8A 3L2OB 1IH7A 3SUOA 4FJ8A 4KHSA 4M3UA 3RMDA 1XU3E 3E4YA 4AKHA 1FZIE 1XVBE 2OYQA 2MW2A 1N1CA 1FZ1E 3TJYA 1FYZE 4M3RA 2LF6A 2OZSA 4M3XA 4KHYA 1XVFE 2VIXA 3N1BA 4EPHA 4HCBA 3NE6A 3OGMB 5IZ7A 3OGLB 4I9QA 4ADOA 2JQTA 2P1NB 3SI6A 1XMHE 1P22A 4DTNA 4DTMA 3SUNA 1NEXB 4J2EA 3HL8A 2JH8A 3QNNA 2RCUA 2VJ5A 4DTXA 2DY4A 3HP9A 2OVQB 3QEVA 4FJNA 3CFRA 3J2PA 3SQ2A 2H4TA 3K2OA 4JS4A 1FZ0E 4M45A 3LZIA 2OZMA 1FPOA 2FW3A 3CQ8A 3MKSB 2LF3A 3QEXA 4DTRA 4HCCA 3UO3A 4FJHA 3TAGA 2HD0A 4GAMC 1FZ8E 4FJXA 4FJMA 2QXFA 4FK4A 4X5NA 1XVCE 4EYWA 4FJKA 4M3ZA 2JH9A 2PFTA 4QNDA 3KD1E 1FZHE 2JHCA 1XMGE 1JW2A 1WAJA 2ATQA 1FZ3E 4M41A 3HGLA 4KI6A 2JHAA 3QETA 4DTUA 3C95A 3TABA 1MMOG 4ICGC 5H37A 4FJGA 2PFVA 1XL3C 2P1MB 4I9LA 3TAFA 1XVGE 4KHQA 4KHUA 3SPZA 3E4WA 1CLQA 1MHZG 3L8BA 2E32A 1FZ2E 4I6JB 2B7MA 3NCIA 1XVDE 3QESA 3SUPA 3SUQA 3KD5E 3RWUA 2B8IA 3QEPA 4FJJA 2DEBA 3BVOA 4AKGA 2MZWB 2JHPA 3NHGA 4DTOA 1Q9YA 4FJ5A 3SVIA 4FK2A 4M42A 4E3SA 3LDSA 3NGIA 2P1QB 3QERA 2E31A 3OGKB 4JS5A 3RMCA 1Q9XA 1FZ5E 2JPNA 3LDBA 4DU4A 3SNNA 4JRPA 2VJ4A 4DTJA 4KHWA 3CFPA 3LZJA 3C6PB 4J2DA 4J2AA 4AKIA 4FVMA 2OVRB 1WAFA 4DTSA 2DTUA 3QEWA 4JRQA 1XU5E 3L1NA 2FYOA 4RG8A 1FZ6E 1MTYG 3SQ4A 1MHYG 1XMFE 4E4BA 5IBKB 2P5GA 4FK0A 2YB5A 4QNCA 4RL5A 3QEIA 3C6NB 4DTPA 3SQ1A 1IG9A 3SCXA 2P5OA 4FJ7A 5IREA 4FJIA 3C94A 3WSOA 3QNOA 3RMBA 3N1EA 4DU1A 4RNGA 4X5MA 4M3YA 2P1PB 3UIQA 3TL8B 4FJ9A 1XVEE 1FZ7E 2OVPB 4IT5A 3NAEA 3S9HA 4M3WA 3V7DB 4DU3A 3SQ0A 3HGKE 2P1OB 1FS1A 1FXXA 3NDKA 3SPYA 4M3TA 4B08A 3SJJA 2MMBA 3UO2A 1FZ4E 3J27A 2K5SA 1LDKE 3C6OB 4EP9A 4KHNA 3L0MA 4KI4A 1FZ9E 4J2BA 4AI6A 3RMAA 2B1EA 4ADNA
chains in the Genus database with same CATH topology
4FJLA 3TAEA 3CFOA 3LD8A 3L2OB 1IH7A 3SUOA 4FJ8A 4KHSA 4M3UA 3RMDA 1XU3E 3E4YA 4AKHA 1FZIE 1XVBE 2OYQA 1FZ1E 3TJYA 1FYZE 4M3RA 2LF6A 2OZSA 4M3XA 4KHYA 1XVFE 2VIXA 3N1BA 4EPHA 4HCBA 3NE6A 3OGMB 5IZ7A 3OGLB 4I9QA 4ADOA 2P1NB 3SI6A 1XMHE 1P22A 4DTNA 4DTMA 3SUNA 1NEXB 4J2EA 3HL8A 2JH8A 3QNNA 2RCUA 2VJ5A 4DTXA 2DY4A 3HP9A 2OVQB 3QEVA 4FJNA 3CFRA 3J2PA 3SQ2A 2H4TA 3K2OA 4JS4A 1FZ0E 4M45A 3LZIA 2OZMA 2FW3A 3CQ8A 3MKSB 2LF3A 3QEXA 4DTRA 4HCCA 4FJHA 3TAGA 2HD0A 4GAMC 1FZ8E 4FJXA 4FJMA 2QXFA 4FK4A 4X5NA 1XVCE 4EYWA 4FJKA 4M3ZA 2JH9A 2PFTA 4QNDA 3KD1E 1FZHE 2JHCA 1XMGE 1WAJA 2ATQA 1FZ3E 4M41A 3HGLA 4KI6A 2JHAA 3QETA 4DTUA 3C95A 3TABA 1MMOG 5H37A 4FJGA 2PFVA 1XL3C 2P1MB 4I9LA 3TAFA 1XVGE 4KHQA 4KHUA 3SPZA 3E4WA 1CLQA 1MHZG 3L8BA 2E32A 1FZ2E 4I6JB 2B7MA 3NCIA 1XVDE 3QESA 3SUPA 3SUQA 3KD5E 3RWUA 2B8IA 3QEPA 4FJJA 2DEBA 4AKGA 2MZWB 2JHPA 3NHGA 4DTOA 1Q9YA 4FJ5A 3SVIA 4FK2A 4M42A 4E3SA 3LDSA 3NGIA 2P1QB 3QERA 2E31A 3OGKB 4JS5A 3RMCA 1Q9XA 1FZ5E 2JPNA 3LDBA 4DU4A 3SNNA 4JRPA 2VJ4A 4DTJA 4KHWA 3CFPA 3LZJA 3C6PB 4J2DA 4J2AA 4AKIA 4FVMA 2OVRB 1WAFA 4DTSA 2DTUA 3QEWA 4JRQA 1XU5E 3L1NA 2FYOA 4RG8A 1FZ6E 1MTYG 3SQ4A 1MHYG 1XMFE 4E4BA 5IBKB 2P5GA 4FK0A 2YB5A 4QNCA 4RL5A 3QEIA 3C6NB 4DTPA 3SQ1A 1IG9A 3SCXA 2P5OA 4FJ7A 5IREA 4FJIA 3C94A 3WSOA 3QNOA 3RMBA 3N1EA 4DU1A 4RNGA 4X5MA 4M3YA 2P1PB 3UIQA 3TL8B 4FJ9A 1XVEE 1FZ7E 2OVPB 3NAEA 3S9HA 4M3WA 3V7DB 4DU3A 3SQ0A 3HGKE 2P1OB 1FS1A 1FXXA 3NDKA 3SPYA 4M3TA 4B08A 3SJJA 2MMBA 1FZ4E 3J27A 1LDKE 3C6OB 4EP9A 4KHNA 3L0MA 4KI4A 1FZ9E 4J2BA 4AI6A 3RMAA 2B1EA 4ADNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVG E;  1FZ6 E;  1MTY G;  1MHY G;  1XMF E;  1MHZ G;  1FZ0 E;  1XU3 E;  1FZ2 E;  1FZI E;  1XVB E;  1XVD E;  1FZ1 E;  1FYZ E;  4GAM C;  1FZ8 E;  1XVF E;  1XVE E;  1FZ7 E;  1XVC E;  1FZ5 E;  1XMH E;  1FZH E;  1XMG E;  1FZ4 E;  1FZ3 E;  1FZ9 E;  1MMO G;  1XU5 E; 
#chains in the Genus database with same CATH topology
 4FJL A;  3TAE A;  3CFO A;  2RKH A;  3LD8 A;  3L2O B;  1IH7 A;  3SUO A;  4FJ8 A;  4KHS A;  4M3U A;  3RMD A;  1XU3 E;  3E4Y A;  4AKH A;  1FZI E;  1XVB E;  2OYQ A;  2MW2 A;  1N1C A;  1FZ1 E;  3TJY A;  1FYZ E;  4M3R A;  2LF6 A;  2OZS A;  4M3X A;  4KHY A;  1XVF E;  2VIX A;  3N1B A;  4EPH A;  4HCB A;  3NE6 A;  3OGM B;  5IZ7 A;  3OGL B;  4I9Q A;  4ADO A;  2JQT A;  2P1N B;  3SI6 A;  1XMH E;  1P22 A;  4DTN A;  4DTM A;  3SUN A;  1NEX B;  4J2E A;  3HL8 A;  2JH8 A;  3QNN A;  2RCU A;  2VJ5 A;  4DTX A;  2DY4 A;  3HP9 A;  2OVQ B;  3QEV A;  4FJN A;  3CFR A;  3J2P A;  3SQ2 A;  2H4T A;  3K2O A;  4JS4 A;  1FZ0 E;  4M45 A;  3LZI A;  2OZM A;  1FPO A;  2FW3 A;  3CQ8 A;  3MKS B;  2LF3 A;  3QEX A;  4DTR A;  4HCC A;  3UO3 A;  4FJH A;  3TAG A;  2HD0 A;  4GAM C;  1FZ8 E;  4FJX A;  4FJM A;  2QXF A;  4FK4 A;  4X5N A;  1XVC E;  4EYW A;  4FJK A;  4M3Z A;  2JH9 A;  2PFT A;  4QND A;  3KD1 E;  1FZH E;  2JHC A;  1XMG E;  1JW2 A;  1WAJ A;  2ATQ A;  1FZ3 E;  4M41 A;  3HGL A;  4KI6 A;  2JHA A;  3QET A;  4DTU A;  3C95 A;  3TAB A;  1MMO G;  4ICG C;  5H37 A;  4FJG A;  2PFV A;  1XL3 C;  2P1M B;  4I9L A;  3TAF A;  1XVG E;  4KHQ A;  4KHU A;  3SPZ A;  3E4W A;  1CLQ A;  1MHZ G;  3L8B A;  2E32 A;  1FZ2 E;  4I6J B;  2B7M A;  3NCI A;  1XVD E;  3QES A;  3SUP A;  3SUQ A;  3KD5 E;  3RWU A;  2B8I A;  3QEP A;  4FJJ A;  2DEB A;  3BVO A;  4AKG A;  2MZW B;  2JHP A;  3NHG A;  4DTO A;  1Q9Y A;  4FJ5 A;  3SVI A;  4FK2 A;  4M42 A;  4E3S A;  3LDS A;  3NGI A;  2P1Q B;  3QER A;  2E31 A;  3OGK B;  4JS5 A;  3RMC A;  1Q9X A;  1FZ5 E;  2JPN A;  3LDB A;  4DU4 A;  3SNN A;  4JRP A;  2VJ4 A;  4DTJ A;  4KHW A;  3CFP A;  3LZJ A;  3C6P B;  4J2D A;  4J2A A;  4AKI A;  4FVM A;  2OVR B;  1WAF A;  4DTS A;  2DTU A;  3QEW A;  4JRQ A;  1XU5 E;  3L1N A;  2FYO A;  4RG8 A;  1FZ6 E;  1MTY G;  3SQ4 A;  1MHY G;  1XMF E;  4E4B A;  5IBK B;  2P5G A;  4FK0 A;  2YB5 A;  4QNC A;  4RL5 A;  3QEI A;  3C6N B;  4DTP A;  3SQ1 A;  1IG9 A;  3SCX A;  2P5O A;  4FJ7 A;  5IRE A;  4FJI A;  3C94 A;  3WSO A;  3QNO A;  3RMB A;  3N1E A;  4DU1 A;  4RNG A;  4X5M A;  4M3Y A;  2P1P B;  3UIQ A;  3TL8 B;  4FJ9 A;  1XVE E;  1FZ7 E;  2OVP B;  4IT5 A;  3NAE A;  3S9H A;  4M3W A;  3V7D B;  4DU3 A;  3SQ0 A;  3HGK E;  2P1O B;  1FS1 A;  1FXX A;  3NDK A;  3SPY A;  4M3T A;  4B08 A;  3SJJ A;  2MMB A;  3UO2 A;  1FZ4 E;  3J27 A;  2K5S A;  1LDK E;  3C6O B;  4EP9 A;  4KHN A;  3L0M A;  4KI4 A;  1FZ9 E;  4J2B A;  4AI6 A;  3RMA A;  2B1E A;  4ADN A; 
#chains in the Genus database with same CATH homology
 4FJL A;  3TAE A;  3CFO A;  3LD8 A;  3L2O B;  1IH7 A;  3SUO A;  4FJ8 A;  4KHS A;  4M3U A;  3RMD A;  1XU3 E;  3E4Y A;  4AKH A;  1FZI E;  1XVB E;  2OYQ A;  1FZ1 E;  3TJY A;  1FYZ E;  4M3R A;  2LF6 A;  2OZS A;  4M3X A;  4KHY A;  1XVF E;  2VIX A;  3N1B A;  4EPH A;  4HCB A;  3NE6 A;  3OGM B;  5IZ7 A;  3OGL B;  4I9Q A;  4ADO A;  2P1N B;  3SI6 A;  1XMH E;  1P22 A;  4DTN A;  4DTM A;  3SUN A;  1NEX B;  4J2E A;  3HL8 A;  2JH8 A;  3QNN A;  2RCU A;  2VJ5 A;  4DTX A;  2DY4 A;  3HP9 A;  2OVQ B;  3QEV A;  4FJN A;  3CFR A;  3J2P A;  3SQ2 A;  2H4T A;  3K2O A;  4JS4 A;  1FZ0 E;  4M45 A;  3LZI A;  2OZM A;  2FW3 A;  3CQ8 A;  3MKS B;  2LF3 A;  3QEX A;  4DTR A;  4HCC A;  4FJH A;  3TAG A;  2HD0 A;  4GAM C;  1FZ8 E;  4FJX A;  4FJM A;  2QXF A;  4FK4 A;  4X5N A;  1XVC E;  4EYW A;  4FJK A;  4M3Z A;  2JH9 A;  2PFT A;  4QND A;  3KD1 E;  1FZH E;  2JHC A;  1XMG E;  1WAJ A;  2ATQ A;  1FZ3 E;  4M41 A;  3HGL A;  4KI6 A;  2JHA A;  3QET A;  4DTU A;  3C95 A;  3TAB A;  1MMO G;  5H37 A;  4FJG A;  2PFV A;  1XL3 C;  2P1M B;  4I9L A;  3TAF A;  1XVG E;  4KHQ A;  4KHU A;  3SPZ A;  3E4W A;  1CLQ A;  1MHZ G;  3L8B A;  2E32 A;  1FZ2 E;  4I6J B;  2B7M A;  3NCI A;  1XVD E;  3QES A;  3SUP A;  3SUQ A;  3KD5 E;  3RWU A;  2B8I A;  3QEP A;  4FJJ A;  2DEB A;  4AKG A;  2MZW B;  2JHP A;  3NHG A;  4DTO A;  1Q9Y A;  4FJ5 A;  3SVI A;  4FK2 A;  4M42 A;  4E3S A;  3LDS A;  3NGI A;  2P1Q B;  3QER A;  2E31 A;  3OGK B;  4JS5 A;  3RMC A;  1Q9X A;  1FZ5 E;  2JPN A;  3LDB A;  4DU4 A;  3SNN A;  4JRP A;  2VJ4 A;  4DTJ A;  4KHW A;  3CFP A;  3LZJ A;  3C6P B;  4J2D A;  4J2A A;  4AKI A;  4FVM A;  2OVR B;  1WAF A;  4DTS A;  2DTU A;  3QEW A;  4JRQ A;  1XU5 E;  3L1N A;  2FYO A;  4RG8 A;  1FZ6 E;  1MTY G;  3SQ4 A;  1MHY G;  1XMF E;  4E4B A;  5IBK B;  2P5G A;  4FK0 A;  2YB5 A;  4QNC A;  4RL5 A;  3QEI A;  3C6N B;  4DTP A;  3SQ1 A;  1IG9 A;  3SCX A;  2P5O A;  4FJ7 A;  5IRE A;  4FJI A;  3C94 A;  3WSO A;  3QNO A;  3RMB A;  3N1E A;  4DU1 A;  4RNG A;  4X5M A;  4M3Y A;  2P1P B;  3UIQ A;  3TL8 B;  4FJ9 A;  1XVE E;  1FZ7 E;  2OVP B;  3NAE A;  3S9H A;  4M3W A;  3V7D B;  4DU3 A;  3SQ0 A;  3HGK E;  2P1O B;  1FS1 A;  1FXX A;  3NDK A;  3SPY A;  4M3T A;  4B08 A;  3SJJ A;  2MMB A;  1FZ4 E;  3J27 A;  1LDK E;  3C6O B;  4EP9 A;  4KHN A;  3L0M A;  4KI4 A;  1FZ9 E;  4J2B A;  4AI6 A;  3RMA A;  2B1E A;  4ADN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...