1FZ6E

Methane monooxygenase hydroxylase, form ii soaked in 1 m methanol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E02
4GAMC 1XMGE 1MMOG 1FZHE 1FZ7E 1FZ3E 1XMHE 1XVDE 1FZ8E 1MTYG 1XU5E 1FZ4E 1XVBE 1MHZG 1XVGE 1FZ6E 1FZIE 1FYZE 1XU3E 1XVFE 1FZ2E 1FZ0E 1XVEE 1FZ5E 1FZ9E 1XVCE 1FZ1E 1XMFE 1MHYG
chains in the Genus database with same CATH superfamily
4B08A 3C6PB 3RMDA 1FZHE 1FZ7E 1NEXB 3J27A 3LD8A 3NDKA 5IBKB 1MTYG 3L8BA 3SPZA 2YB5A 4FK2A 2JHPA 4ADNA 3L1NA 3UO2A 3LZJA 2LF6A 3C95A 2VIXA 3QNNA 1FYZE 4DU4A 2P1MB 4ICGC 4DTNA 4KI6A 3C6NB 4FJ7A 2P5GA 4JRPA 4I9LA 3NE6A 3NGIA 2JHCA 3OGLB 2DEBA 4KI4A 4M3ZA 4KHQA 4J2BA 4FVMA 4J2AA 1FZ9E 3NAEA 1WAFA 2HD0A 2OVQB 2QXFA 3E4YA 4RL5A 1IH7A 3UIQA 4AI6A 4FJ9A 1XMFE 1MHYG 2E32A 2P1PB 4ADOA 4M45A 3NCIA 4DTOA 3TABA 3SCXA 4FJ5A 4RNGA 4DTSA 1MMOG 4KHNA 3CFPA 2ATQA 1XVDE 4FJJA 1XMHE 3WSOA 4FJLA 1FZ8E 3QEVA 4DTPA 3TAGA 2FW3A 3HGKE 3HP9A 1JW2A 5H37A 3SQ4A 1XVBE 3SQ1A 3RMAA 3CQ8A 1MHZG 4FK4A 2E31A 3UO3A 2P1QB 2LF3A 3SI6A 2B8IA 4FJHA 3E4WA 3NHGA 4FJKA 3N1EA 4E4BA 3OGMB 3V7DB 3C6OB 4M42A 2MZWB 4I9QA 2MMBA 2VJ5A 4RG8A 3J2PA 4QNDA 4X5MA 4DTJA 1FS1A 3QEXA 2JPNA 1XVCE 2JHAA 4EPHA 3SJJA 2OZSA 3BVOA 4J2EA 4X5NA 3LDSA 4FJ8A 3SUQA 3OGKB 1FZ3E 4IT5A 2OZMA 4FJNA 2OVRB 4DTUA 1N1CA 4DTMA 4DU3A 2P1OB 3QEIA 3LDBA 1XU5E 4AKGA 3QEWA 1FZ4E 2OYQA 2P5OA 4EP9A 1XVGE 5IZ7A 4DTXA 3K2OA 3TL8B 2H4TA 1XU3E 3L2OB 3QETA 3SUOA 3SPYA 3KD1E 3RWUA 4I6JB 3SVIA 4HCCA 4FJXA 2FYOA 1Q9YA 2PFVA 3CFRA 4DU1A 3TAFA 1FZ5E 4FK0A 4DTRA 3SUPA 4KHYA 2RKHA 2K5SA 3C94A 1WAJA 3SQ0A 4JS4A 1LDKE 1FXXA 4GAMC 4AKHA 1XMGE 1IG9A 4KHSA 4KHWA 1P22A 2MW2A 2OVPB 3LZIA 4E3SA 5IREA 4M3WA 2RCUA 3TJYA 3HL8A 4JRQA 3QERA 3KD5E 4M3RA 3N1BA 4M3XA 4M3TA 4J2DA 4M3UA 1FPOA 1FZ6E 2DTUA 2DY4A 1FZIE 4M41A 3TAEA 3S9HA 1XVFE 1FZ2E 1FZ0E 4FJGA 3RMBA 3SNNA 4JS5A 4AKIA 3L0MA 3QEPA 1XL3C 1XVEE 2JH9A 4M3YA 3SQ2A 4FJIA 3RMCA 4KHUA 2B1EA 3HGLA 2B7MA 3MKSB 3CFOA 1Q9XA 4HCBA 2VJ4A 2JH8A 2P1NB 2JQTA 3QNOA 4FJMA 1FZ1E 4EYWA 4QNCA 1CLQA 3QESA 3SUNA 2PFTA
chains in the Genus database with same CATH topology
4B08A 3C6PB 3RMDA 1FZHE 1FZ7E 1NEXB 3J27A 3LD8A 3NDKA 5IBKB 1MTYG 3L8BA 3SPZA 2YB5A 4FK2A 2JHPA 4ADNA 3L1NA 3LZJA 2LF6A 3C95A 2VIXA 3QNNA 1FYZE 4DU4A 2P1MB 4DTNA 4KI6A 3C6NB 4FJ7A 2P5GA 4JRPA 4I9LA 3NE6A 3NGIA 2JHCA 3OGLB 2DEBA 4KI4A 4M3ZA 4KHQA 4J2BA 4FVMA 4J2AA 1FZ9E 3NAEA 1WAFA 2HD0A 2OVQB 2QXFA 3E4YA 4RL5A 1IH7A 3UIQA 4AI6A 4FJ9A 1XMFE 1MHYG 2E32A 2P1PB 4ADOA 4M45A 3NCIA 4DTOA 3TABA 3SCXA 4FJ5A 4RNGA 4DTSA 1MMOG 4KHNA 3CFPA 2ATQA 1XVDE 4FJJA 1XMHE 3WSOA 4FJLA 1FZ8E 3QEVA 4DTPA 3TAGA 2FW3A 3HGKE 3HP9A 5H37A 3SQ4A 1XVBE 3SQ1A 3RMAA 3CQ8A 1MHZG 4FK4A 2E31A 2P1QB 2LF3A 3SI6A 2B8IA 4FJHA 3E4WA 3NHGA 4FJKA 3N1EA 4E4BA 3OGMB 3V7DB 3C6OB 4M42A 2MZWB 4I9QA 2MMBA 2VJ5A 4RG8A 3J2PA 4QNDA 4X5MA 4DTJA 1FS1A 3QEXA 2JPNA 1XVCE 2JHAA 4EPHA 3SJJA 2OZSA 4J2EA 4X5NA 3LDSA 4FJ8A 3SUQA 3OGKB 1FZ3E 2OZMA 4FJNA 2OVRB 4DTUA 4DTMA 3QEIA 4DU3A 2P1OB 3LDBA 1XU5E 4AKGA 3QEWA 1FZ4E 2OYQA 2P5OA 4EP9A 1XVGE 5IZ7A 4DTXA 3K2OA 3TL8B 2H4TA 1XU3E 3L2OB 3QETA 3SUOA 3SPYA 3KD1E 3RWUA 4I6JB 3SVIA 4HCCA 4FJXA 2FYOA 1Q9YA 2PFVA 3CFRA 4DU1A 3TAFA 1FZ5E 4FK0A 4DTRA 3SUPA 4KHYA 3C94A 1WAJA 3SQ0A 4JS4A 1LDKE 1FXXA 4GAMC 4AKHA 1XMGE 1IG9A 4KHSA 4KHWA 1P22A 4E3SA 2OVPB 3LZIA 4M3WA 5IREA 2RCUA 3TJYA 3HL8A 4JRQA 3QERA 3KD5E 4M3RA 3N1BA 4M3XA 4M3TA 4J2DA 4M3UA 1FZ6E 2DTUA 2DY4A 1FZIE 4M41A 3TAEA 3S9HA 1XVFE 1FZ2E 1FZ0E 4FJGA 3RMBA 3SNNA 4JS5A 4AKIA 3L0MA 3QEPA 1XL3C 1XVEE 2JH9A 4M3YA 3SQ2A 4FJIA 3RMCA 4KHUA 2B1EA 3HGLA 2B7MA 3MKSB 3CFOA 1Q9XA 4HCBA 2VJ4A 2JH8A 2P1NB 4FJMA 3QNOA 1CLQA 1FZ1E 4EYWA 4QNCA 3QESA 3SUNA 2PFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAM C;  1XMG E;  1MMO G;  1FZH E;  1FZ7 E;  1FZ3 E;  1XMH E;  1XVD E;  1FZ8 E;  1MTY G;  1XU5 E;  1FZ4 E;  1XVB E;  1MHZ G;  1XVG E;  1FZ6 E;  1FZI E;  1FYZ E;  1XU3 E;  1XVF E;  1FZ2 E;  1FZ0 E;  1XVE E;  1FZ5 E;  1FZ9 E;  1XVC E;  1FZ1 E;  1XMF E;  1MHY G; 
#chains in the Genus database with same CATH topology
 4B08 A;  3C6P B;  3RMD A;  1FZH E;  1FZ7 E;  1NEX B;  3J27 A;  3LD8 A;  3NDK A;  5IBK B;  1MTY G;  3L8B A;  3SPZ A;  2YB5 A;  4FK2 A;  2JHP A;  4ADN A;  3L1N A;  3UO2 A;  3LZJ A;  2LF6 A;  3C95 A;  2VIX A;  3QNN A;  1FYZ E;  4DU4 A;  2P1M B;  4ICG C;  4DTN A;  4KI6 A;  3C6N B;  4FJ7 A;  2P5G A;  4JRP A;  4I9L A;  3NE6 A;  3NGI A;  2JHC A;  3OGL B;  2DEB A;  4KI4 A;  4M3Z A;  4KHQ A;  4J2B A;  4FVM A;  4J2A A;  1FZ9 E;  3NAE A;  1WAF A;  2HD0 A;  2OVQ B;  2QXF A;  3E4Y A;  4RL5 A;  1IH7 A;  3UIQ A;  4AI6 A;  4FJ9 A;  1XMF E;  1MHY G;  2E32 A;  2P1P B;  4ADO A;  4M45 A;  3NCI A;  4DTO A;  3TAB A;  3SCX A;  4FJ5 A;  4RNG A;  4DTS A;  1MMO G;  4KHN A;  3CFP A;  2ATQ A;  1XVD E;  4FJJ A;  1XMH E;  3WSO A;  4FJL A;  1FZ8 E;  3QEV A;  4DTP A;  3TAG A;  2FW3 A;  3HGK E;  3HP9 A;  1JW2 A;  5H37 A;  3SQ4 A;  1XVB E;  3SQ1 A;  3RMA A;  3CQ8 A;  1MHZ G;  4FK4 A;  2E31 A;  3UO3 A;  2P1Q B;  2LF3 A;  3SI6 A;  2B8I A;  4FJH A;  3E4W A;  3NHG A;  4FJK A;  3N1E A;  4E4B A;  3OGM B;  3V7D B;  3C6O B;  4M42 A;  2MZW B;  4I9Q A;  2MMB A;  2VJ5 A;  4RG8 A;  3J2P A;  4QND A;  4X5M A;  4DTJ A;  1FS1 A;  3QEX A;  2JPN A;  1XVC E;  2JHA A;  4EPH A;  3SJJ A;  2OZS A;  3BVO A;  4J2E A;  4X5N A;  3LDS A;  4FJ8 A;  3SUQ A;  3OGK B;  1FZ3 E;  4IT5 A;  2OZM A;  4FJN A;  2OVR B;  4DTU A;  1N1C A;  4DTM A;  4DU3 A;  2P1O B;  3QEI A;  3LDB A;  1XU5 E;  4AKG A;  3QEW A;  1FZ4 E;  2OYQ A;  2P5O A;  4EP9 A;  1XVG E;  5IZ7 A;  4DTX A;  3K2O A;  3TL8 B;  2H4T A;  1XU3 E;  3L2O B;  3QET A;  3SUO A;  3SPY A;  3KD1 E;  3RWU A;  4I6J B;  3SVI A;  4HCC A;  4FJX A;  2FYO A;  1Q9Y A;  2PFV A;  3CFR A;  4DU1 A;  3TAF A;  1FZ5 E;  4FK0 A;  4DTR A;  3SUP A;  4KHY A;  2RKH A;  2K5S A;  3C94 A;  1WAJ A;  3SQ0 A;  4JS4 A;  1LDK E;  1FXX A;  4GAM C;  4AKH A;  1XMG E;  1IG9 A;  4KHS A;  4KHW A;  1P22 A;  2MW2 A;  2OVP B;  3LZI A;  4E3S A;  5IRE A;  4M3W A;  2RCU A;  3TJY A;  3HL8 A;  4JRQ A;  3QER A;  3KD5 E;  4M3R A;  3N1B A;  4M3X A;  4M3T A;  4J2D A;  4M3U A;  1FPO A;  1FZ6 E;  2DTU A;  2DY4 A;  1FZI E;  4M41 A;  3TAE A;  3S9H A;  1XVF E;  1FZ2 E;  1FZ0 E;  4FJG A;  3RMB A;  3SNN A;  4JS5 A;  4AKI A;  3L0M A;  3QEP A;  1XL3 C;  1XVE E;  2JH9 A;  4M3Y A;  3SQ2 A;  4FJI A;  3RMC A;  4KHU A;  2B1E A;  3HGL A;  2B7M A;  3MKS B;  3CFO A;  1Q9X A;  4HCB A;  2VJ4 A;  2JH8 A;  2P1N B;  2JQT A;  3QNO A;  4FJM A;  1FZ1 E;  4EYW A;  4QNC A;  1CLQ A;  3QES A;  3SUN A;  2PFT A; 
#chains in the Genus database with same CATH homology
 4B08 A;  3C6P B;  3RMD A;  1FZH E;  1FZ7 E;  1NEX B;  3J27 A;  3LD8 A;  3NDK A;  5IBK B;  1MTY G;  3L8B A;  3SPZ A;  2YB5 A;  4FK2 A;  2JHP A;  4ADN A;  3L1N A;  3LZJ A;  2LF6 A;  3C95 A;  2VIX A;  3QNN A;  1FYZ E;  4DU4 A;  2P1M B;  4DTN A;  4KI6 A;  3C6N B;  4FJ7 A;  2P5G A;  4JRP A;  4I9L A;  3NE6 A;  3NGI A;  2JHC A;  3OGL B;  2DEB A;  4KI4 A;  4M3Z A;  4KHQ A;  4J2B A;  4FVM A;  4J2A A;  1FZ9 E;  3NAE A;  1WAF A;  2HD0 A;  2OVQ B;  2QXF A;  3E4Y A;  4RL5 A;  1IH7 A;  3UIQ A;  4AI6 A;  4FJ9 A;  1XMF E;  1MHY G;  2E32 A;  2P1P B;  4ADO A;  4M45 A;  3NCI A;  4DTO A;  3TAB A;  3SCX A;  4FJ5 A;  4RNG A;  4DTS A;  1MMO G;  4KHN A;  3CFP A;  2ATQ A;  1XVD E;  4FJJ A;  1XMH E;  3WSO A;  4FJL A;  1FZ8 E;  3QEV A;  4DTP A;  3TAG A;  2FW3 A;  3HGK E;  3HP9 A;  5H37 A;  3SQ4 A;  1XVB E;  3SQ1 A;  3RMA A;  3CQ8 A;  1MHZ G;  4FK4 A;  2E31 A;  2P1Q B;  2LF3 A;  3SI6 A;  2B8I A;  4FJH A;  3E4W A;  3NHG A;  4FJK A;  3N1E A;  4E4B A;  3OGM B;  3V7D B;  3C6O B;  4M42 A;  2MZW B;  4I9Q A;  2MMB A;  2VJ5 A;  4RG8 A;  3J2P A;  4QND A;  4X5M A;  4DTJ A;  1FS1 A;  3QEX A;  2JPN A;  1XVC E;  2JHA A;  4EPH A;  3SJJ A;  2OZS A;  4J2E A;  4X5N A;  3LDS A;  4FJ8 A;  3SUQ A;  3OGK B;  1FZ3 E;  2OZM A;  4FJN A;  2OVR B;  4DTU A;  4DTM A;  3QEI A;  4DU3 A;  2P1O B;  3LDB A;  1XU5 E;  4AKG A;  3QEW A;  1FZ4 E;  2OYQ A;  2P5O A;  4EP9 A;  1XVG E;  5IZ7 A;  4DTX A;  3K2O A;  3TL8 B;  2H4T A;  1XU3 E;  3L2O B;  3QET A;  3SUO A;  3SPY A;  3KD1 E;  3RWU A;  4I6J B;  3SVI A;  4HCC A;  4FJX A;  2FYO A;  1Q9Y A;  2PFV A;  3CFR A;  4DU1 A;  3TAF A;  1FZ5 E;  4FK0 A;  4DTR A;  3SUP A;  4KHY A;  3C94 A;  1WAJ A;  3SQ0 A;  4JS4 A;  1LDK E;  1FXX A;  4GAM C;  4AKH A;  1XMG E;  1IG9 A;  4KHS A;  4KHW A;  1P22 A;  4E3S A;  2OVP B;  3LZI A;  4M3W A;  5IRE A;  2RCU A;  3TJY A;  3HL8 A;  4JRQ A;  3QER A;  3KD5 E;  4M3R A;  3N1B A;  4M3X A;  4M3T A;  4J2D A;  4M3U A;  1FZ6 E;  2DTU A;  2DY4 A;  1FZI E;  4M41 A;  3TAE A;  3S9H A;  1XVF E;  1FZ2 E;  1FZ0 E;  4FJG A;  3RMB A;  3SNN A;  4JS5 A;  4AKI A;  3L0M A;  3QEP A;  1XL3 C;  1XVE E;  2JH9 A;  4M3Y A;  3SQ2 A;  4FJI A;  3RMC A;  4KHU A;  2B1E A;  3HGL A;  2B7M A;  3MKS B;  3CFO A;  1Q9X A;  4HCB A;  2VJ4 A;  2JH8 A;  2P1N B;  4FJM A;  3QNO A;  1CLQ A;  1FZ1 E;  4EYW A;  4QNC A;  3QES A;  3SUN A;  2PFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...