1FZ6E

Methane monooxygenase hydroxylase, form ii soaked in 1 m methanol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E02
1XVDE 1FZHE 1FZ2E 1MHYG 1FZIE 1FZ3E 1FZ0E 1XU5E 1XVCE 1FZ6E 1MTYG 1FZ7E 1FZ8E 1XMHE 1FZ1E 1XMFE 1XVBE 1FZ9E 1FZ4E 1XVGE 1MMOG 1FYZE 1XVFE 1XU3E 4GAMC 1XMGE 1XVEE 1FZ5E 1MHZG
chains in the Genus database with same CATH superfamily
1XVDE 3C94A 3LZIA 4J2BA 1JW2A 4FJXA 4IT5A 3QEXA 2E32A 2P1NB 2P5OA 3SQ1A 1FS1A 4DTPA 4KHYA 4DTUA 3QEVA 4I9QA 4JRPA 4B08A 3SQ0A 3S9HA 2OZMA 4M3YA 3LD8A 4I6JB 2FW3A 4HCCA 1Q9XA 4FJJA 4E4BA 2B1EA 3J2PA 5IZ7A 4M42A 2PFVA 1Q9YA 4M45A 2DY4A 4FJ5A 3QERA 3J27A 2JQTA 3KD1E 3NCIA 1XMFE 3KD5E 4DU4A 4J2AA 4M3WA 4FJ8A 3QEPA 4FJKA 3N1EA 1XVGE 4DTOA 3CFPA 3LZJA 3V7DB 3NHGA 4DTSA 4M3XA 1XVFE 1XU3E 4RNGA 3TAFA 2P1PB 3C6PB 1N1CA 3WSOA 4EP9A 3L2OB 4DTJA 2P1OB 4FJ7A 3L1NA 3RWUA 3TJYA 4FJLA 3SJJA 4ICGC 1FPOA 3SVIA 1FZIE 4ADNA 4X5MA 3OGKB 4FK0A 1XU5E 3E4YA 1FZ6E 3QEWA 4E3SA 3SUOA 3SNNA 4ADOA 3LDSA 1XL3C 2JH8A 3SUQA 2B7MA 3C6OB 1FZ8E 4JRQA 4DTNA 4RG8A 1FXXA 3SUPA 1XMHE 1NEXB 1WAJA 1WAFA 3RMDA 3TAEA 2OZSA 4KHNA 4DTRA 1LDKE 1XVBE 1FZ9E 3CFOA 1FZ4E 3K2OA 4AKGA 4DTMA 4X5NA 2K5SA 4DU3A 4FJHA 3RMAA 1IH7A 2H4TA 1MMOG 2PFTA 2P1QB 4GAMC 3SUNA 4AI6A 3TABA 3CQ8A 5IBKB 1IG9A 1FZ5E 3C6NB 2MMBA 3SI6A 2OVPB 2QXFA 1FZ2E 1MHYG 3TL8B 4M3UA 4AKHA 3HGKE 1XVCE 2B8IA 2MZWB 3LDBA 4FJIA 1MTYG 4KHWA 4AKIA 4HCBA 4QNDA 4DTXA 4KI4A 2OVRB 3OGLB 3L8BA 3L0MA 4M3TA 1CLQA 4FJGA 4JS4A 3C95A 2P5GA 1FZ1E 2LF3A 4FK2A 4M41A 3UIQA 3NE6A 3MKSB 3BVOA 3OGMB 4JS5A 3SQ2A 2JPNA 4M3ZA 2FYOA 3UO3A 4QNCA 4FJNA 3QESA 4KI6A 3RMCA 1FYZE 3HGLA 3N1BA 4FJMA 4KHSA 3HP9A 2VIXA 4FVMA 2JHPA 4KHQA 2VJ4A 3SPYA 1P22A 5IREA 3E4WA 1FZHE 2JH9A 2MW2A 2RCUA 2JHAA 3RMBA 1FZ3E 1FZ0E 2HD0A 2JHCA 3QNNA 4KHUA 3SCXA 3HL8A 2LF6A 1FZ7E 2DEBA 3NDKA 4J2EA 2OVQB 4FK4A 3CFRA 3QETA 4M3RA 3UO2A 3SPZA 3TAGA 4EPHA 4I9LA 3NAEA 4J2DA 2YB5A 3QEIA 3NGIA 4FJ9A 4DU1A 2E31A 2P1MB 3SQ4A 2ATQA 4EYWA 4RL5A 5H37A 1XMGE 3QNOA 2DTUA 2RKHA 1XVEE 2OYQA 1MHZG 2VJ5A
chains in the Genus database with same CATH topology
1XVDE 3C94A 3LZIA 4J2BA 4FJXA 3QEXA 2E32A 2P1NB 2P5OA 3SQ1A 1FS1A 4DTPA 4KHYA 4DTUA 3QEVA 4I9QA 4JRPA 4B08A 3SQ0A 3S9HA 2OZMA 4M3YA 3LD8A 4I6JB 2FW3A 4HCCA 1Q9XA 4FJJA 4E4BA 2B1EA 3J2PA 5IZ7A 4M42A 2PFVA 1Q9YA 4M45A 2DY4A 4FJ5A 3QERA 3J27A 3KD1E 3NCIA 1XMFE 3KD5E 4DU4A 4J2AA 4M3WA 4FJ8A 3QEPA 4FJKA 3N1EA 1XVGE 4DTOA 3CFPA 3LZJA 3V7DB 3NHGA 4DTSA 4M3XA 1XVFE 1XU3E 4RNGA 3TAFA 2P1PB 3C6PB 4EP9A 3WSOA 4DTJA 3L2OB 2P1OB 4FJ7A 3L1NA 3RWUA 3TJYA 4FJLA 3SJJA 3SVIA 1FZIE 4ADNA 4X5MA 3OGKB 4FK0A 1XU5E 3E4YA 1FZ6E 3QEWA 4E3SA 3SUOA 3SNNA 4ADOA 3LDSA 1XL3C 2JH8A 3SUQA 2B7MA 3C6OB 1FZ8E 4JRQA 4DTNA 4RG8A 1FXXA 3SUPA 1XMHE 1NEXB 1WAJA 1WAFA 3RMDA 3TAEA 2OZSA 4KHNA 4DTRA 1LDKE 1XVBE 1FZ9E 3CFOA 1FZ4E 3K2OA 4AKGA 4DTMA 4X5NA 4FJHA 4DU3A 3RMAA 1IH7A 2H4TA 1MMOG 2PFTA 2P1QB 4GAMC 3SUNA 4AI6A 3TABA 3CQ8A 5IBKB 1IG9A 1FZ5E 3C6NB 2MMBA 3SI6A 2OVPB 2QXFA 1FZ2E 1MHYG 3TL8B 4M3UA 4AKHA 3HGKE 1XVCE 2B8IA 2MZWB 3LDBA 4FJIA 1MTYG 4KHWA 4AKIA 4HCBA 4QNDA 4DTXA 4KI4A 2OVRB 3OGLB 3L8BA 3L0MA 4M3TA 1CLQA 4FJGA 4JS4A 3C95A 2P5GA 1FZ1E 2LF3A 4FK2A 4M41A 3UIQA 3NE6A 3MKSB 4JS5A 3OGMB 3SQ2A 4M3ZA 2JPNA 2FYOA 4QNCA 4FJNA 3QESA 4KI6A 3RMCA 1FYZE 3HGLA 3N1BA 4FJMA 4KHSA 3HP9A 2VIXA 4FVMA 2JHPA 4KHQA 2VJ4A 3SPYA 1P22A 5IREA 3E4WA 1FZHE 2JH9A 2RCUA 2JHAA 3RMBA 1FZ3E 1FZ0E 2HD0A 2JHCA 3QNNA 4KHUA 3SCXA 3HL8A 2LF6A 1FZ7E 2DEBA 3NDKA 4J2EA 2OVQB 4FK4A 3CFRA 3QETA 4M3RA 3SPZA 3TAGA 4EPHA 4I9LA 3NAEA 4J2DA 2YB5A 3QEIA 3NGIA 4FJ9A 4DU1A 2E31A 2P1MB 3SQ4A 2ATQA 4EYWA 4RL5A 5H37A 1XMGE 3QNOA 2DTUA 1XVEE 2OYQA 1MHZG 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVD E;  1FZH E;  1FZ2 E;  1MHY G;  1FZI E;  1FZ3 E;  1FZ0 E;  1XU5 E;  1XVC E;  1FZ6 E;  1MTY G;  1FZ7 E;  1FZ8 E;  1XMH E;  1FZ1 E;  1XMF E;  1XVB E;  1FZ9 E;  1FZ4 E;  1XVG E;  1MMO G;  1FYZ E;  1XVF E;  1XU3 E;  4GAM C;  1XMG E;  1XVE E;  1FZ5 E;  1MHZ G; 
#chains in the Genus database with same CATH topology
 1XVD E;  3C94 A;  3LZI A;  4J2B A;  1JW2 A;  4FJX A;  4IT5 A;  3QEX A;  2E32 A;  2P1N B;  2P5O A;  3SQ1 A;  1FS1 A;  4DTP A;  4KHY A;  4DTU A;  3QEV A;  4I9Q A;  4JRP A;  4B08 A;  3SQ0 A;  3S9H A;  2OZM A;  4M3Y A;  3LD8 A;  4I6J B;  2FW3 A;  4HCC A;  1Q9X A;  4FJJ A;  4E4B A;  2B1E A;  3J2P A;  5IZ7 A;  4M42 A;  2PFV A;  1Q9Y A;  4M45 A;  2DY4 A;  4FJ5 A;  3QER A;  3J27 A;  2JQT A;  3KD1 E;  3NCI A;  1XMF E;  3KD5 E;  4DU4 A;  4J2A A;  4M3W A;  4FJ8 A;  3QEP A;  4FJK A;  3N1E A;  1XVG E;  4DTO A;  3CFP A;  3LZJ A;  3V7D B;  3NHG A;  4DTS A;  4M3X A;  1XVF E;  1XU3 E;  4RNG A;  3TAF A;  2P1P B;  3C6P B;  1N1C A;  3WSO A;  4EP9 A;  3L2O B;  4DTJ A;  2P1O B;  4FJ7 A;  3L1N A;  3RWU A;  3TJY A;  4FJL A;  3SJJ A;  4ICG C;  1FPO A;  3SVI A;  1FZI E;  4ADN A;  4X5M A;  3OGK B;  4FK0 A;  1XU5 E;  3E4Y A;  1FZ6 E;  3QEW A;  4E3S A;  3SUO A;  3SNN A;  4ADO A;  3LDS A;  1XL3 C;  2JH8 A;  3SUQ A;  2B7M A;  3C6O B;  1FZ8 E;  4JRQ A;  4DTN A;  4RG8 A;  1FXX A;  3SUP A;  1XMH E;  1NEX B;  1WAJ A;  1WAF A;  3RMD A;  3TAE A;  2OZS A;  4KHN A;  4DTR A;  1LDK E;  1XVB E;  1FZ9 E;  3CFO A;  1FZ4 E;  3K2O A;  4AKG A;  4DTM A;  4X5N A;  2K5S A;  4DU3 A;  4FJH A;  3RMA A;  1IH7 A;  2H4T A;  1MMO G;  2PFT A;  2P1Q B;  4GAM C;  3SUN A;  4AI6 A;  3TAB A;  3CQ8 A;  5IBK B;  1IG9 A;  1FZ5 E;  3C6N B;  2MMB A;  3SI6 A;  2OVP B;  2QXF A;  1FZ2 E;  1MHY G;  3TL8 B;  4M3U A;  4AKH A;  3HGK E;  1XVC E;  2B8I A;  2MZW B;  3LDB A;  4FJI A;  1MTY G;  4KHW A;  4AKI A;  4HCB A;  4QND A;  4DTX A;  4KI4 A;  2OVR B;  3OGL B;  3L8B A;  3L0M A;  4M3T A;  1CLQ A;  4FJG A;  4JS4 A;  3C95 A;  2P5G A;  1FZ1 E;  2LF3 A;  4FK2 A;  4M41 A;  3UIQ A;  3NE6 A;  3MKS B;  3BVO A;  3OGM B;  4JS5 A;  3SQ2 A;  2JPN A;  4M3Z A;  2FYO A;  3UO3 A;  4QNC A;  4FJN A;  3QES A;  4KI6 A;  3RMC A;  1FYZ E;  3HGL A;  3N1B A;  4FJM A;  4KHS A;  3HP9 A;  2VIX A;  4FVM A;  2JHP A;  4KHQ A;  2VJ4 A;  3SPY A;  1P22 A;  5IRE A;  3E4W A;  1FZH E;  2JH9 A;  2MW2 A;  2RCU A;  2JHA A;  3RMB A;  1FZ3 E;  1FZ0 E;  2HD0 A;  2JHC A;  3QNN A;  4KHU A;  3SCX A;  3HL8 A;  2LF6 A;  1FZ7 E;  2DEB A;  3NDK A;  4J2E A;  2OVQ B;  4FK4 A;  3CFR A;  3QET A;  4M3R A;  3UO2 A;  3SPZ A;  3TAG A;  4EPH A;  4I9L A;  3NAE A;  4J2D A;  2YB5 A;  3QEI A;  3NGI A;  4FJ9 A;  4DU1 A;  2E31 A;  2P1M B;  3SQ4 A;  2ATQ A;  4EYW A;  4RL5 A;  5H37 A;  1XMG E;  3QNO A;  2DTU A;  2RKH A;  1XVE E;  2OYQ A;  1MHZ G;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 1XVD E;  3C94 A;  3LZI A;  4J2B A;  4FJX A;  3QEX A;  2E32 A;  2P1N B;  2P5O A;  3SQ1 A;  1FS1 A;  4DTP A;  4KHY A;  4DTU A;  3QEV A;  4I9Q A;  4JRP A;  4B08 A;  3SQ0 A;  3S9H A;  2OZM A;  4M3Y A;  3LD8 A;  4I6J B;  2FW3 A;  4HCC A;  1Q9X A;  4FJJ A;  4E4B A;  2B1E A;  3J2P A;  5IZ7 A;  4M42 A;  2PFV A;  1Q9Y A;  4M45 A;  2DY4 A;  4FJ5 A;  3QER A;  3J27 A;  3KD1 E;  3NCI A;  1XMF E;  3KD5 E;  4DU4 A;  4J2A A;  4M3W A;  4FJ8 A;  3QEP A;  4FJK A;  3N1E A;  1XVG E;  4DTO A;  3CFP A;  3LZJ A;  3V7D B;  3NHG A;  4DTS A;  4M3X A;  1XVF E;  1XU3 E;  4RNG A;  3TAF A;  2P1P B;  3C6P B;  4EP9 A;  3WSO A;  4DTJ A;  3L2O B;  2P1O B;  4FJ7 A;  3L1N A;  3RWU A;  3TJY A;  4FJL A;  3SJJ A;  3SVI A;  1FZI E;  4ADN A;  4X5M A;  3OGK B;  4FK0 A;  1XU5 E;  3E4Y A;  1FZ6 E;  3QEW A;  4E3S A;  3SUO A;  3SNN A;  4ADO A;  3LDS A;  1XL3 C;  2JH8 A;  3SUQ A;  2B7M A;  3C6O B;  1FZ8 E;  4JRQ A;  4DTN A;  4RG8 A;  1FXX A;  3SUP A;  1XMH E;  1NEX B;  1WAJ A;  1WAF A;  3RMD A;  3TAE A;  2OZS A;  4KHN A;  4DTR A;  1LDK E;  1XVB E;  1FZ9 E;  3CFO A;  1FZ4 E;  3K2O A;  4AKG A;  4DTM A;  4X5N A;  4FJH A;  4DU3 A;  3RMA A;  1IH7 A;  2H4T A;  1MMO G;  2PFT A;  2P1Q B;  4GAM C;  3SUN A;  4AI6 A;  3TAB A;  3CQ8 A;  5IBK B;  1IG9 A;  1FZ5 E;  3C6N B;  2MMB A;  3SI6 A;  2OVP B;  2QXF A;  1FZ2 E;  1MHY G;  3TL8 B;  4M3U A;  4AKH A;  3HGK E;  1XVC E;  2B8I A;  2MZW B;  3LDB A;  4FJI A;  1MTY G;  4KHW A;  4AKI A;  4HCB A;  4QND A;  4DTX A;  4KI4 A;  2OVR B;  3OGL B;  3L8B A;  3L0M A;  4M3T A;  1CLQ A;  4FJG A;  4JS4 A;  3C95 A;  2P5G A;  1FZ1 E;  2LF3 A;  4FK2 A;  4M41 A;  3UIQ A;  3NE6 A;  3MKS B;  4JS5 A;  3OGM B;  3SQ2 A;  4M3Z A;  2JPN A;  2FYO A;  4QNC A;  4FJN A;  3QES A;  4KI6 A;  3RMC A;  1FYZ E;  3HGL A;  3N1B A;  4FJM A;  4KHS A;  3HP9 A;  2VIX A;  4FVM A;  2JHP A;  4KHQ A;  2VJ4 A;  3SPY A;  1P22 A;  5IRE A;  3E4W A;  1FZH E;  2JH9 A;  2RCU A;  2JHA A;  3RMB A;  1FZ3 E;  1FZ0 E;  2HD0 A;  2JHC A;  3QNN A;  4KHU A;  3SCX A;  3HL8 A;  2LF6 A;  1FZ7 E;  2DEB A;  3NDK A;  4J2E A;  2OVQ B;  4FK4 A;  3CFR A;  3QET A;  4M3R A;  3SPZ A;  3TAG A;  4EPH A;  4I9L A;  3NAE A;  4J2D A;  2YB5 A;  3QEI A;  3NGI A;  4FJ9 A;  4DU1 A;  2E31 A;  2P1M B;  3SQ4 A;  2ATQ A;  4EYW A;  4RL5 A;  5H37 A;  1XMG E;  3QNO A;  2DTU A;  1XVE E;  2OYQ A;  1MHZ G;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...