1FZ6E

Methane monooxygenase hydroxylase, form ii soaked in 1 m methanol
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of alcohol products bound at the active site of soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 62
structure length 166
sequence length 166
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz6E02
1XU5E 1MTYG 1XVEE 1FZ1E 1XVFE 4GAMC 1XU3E 1FZ2E 1FZ0E 1XVCE 1XMHE 1FZ4E 1FZHE 1FZ7E 1FZ8E 1MHYG 1FYZE 1XVDE 1FZ3E 1MHZG 1XVGE 1FZ5E 1FZIE 1MMOG 1XMFE 1FZ6E 1XVBE 1XMGE 1FZ9E
chains in the Genus database with same CATH superfamily
3QEXA 3NGIA 1MTYG 2HD0A 2RKHA 4M3TA 4DTRA 1CLQA 3KD1E 4JRPA 3CFOA 4DU3A 2P1PB 3RMCA 3LZJA 4GAMC 3L2OB 2OZMA 3MKSB 4AKIA 3QNOA 3QEIA 3J27A 4KHQA 1WAFA 2P1MB 2YB5A 1FZHE 4M42A 4FJJA 4I6JB 2E31A 2P1QB 4DTUA 3NHGA 4M3RA 3QERA 3L0MA 4KHYA 2H4TA 4X5NA 1FZ8E 3SQ2A 3LDBA 1IG9A 4IT5A 4RNGA 2DTUA 4FJ7A 1FZ3E 1XVGE 3C95A 1FZ5E 2P1NB 2B7MA 2P5OA 4AKGA 2VIXA 2OVRB 3SQ4A 1FXXA 2MZWB 2QXFA 3J2PA 4FK4A 2OVQB 3BVOA 4J2DA 4KHWA 1N1CA 1XU5E 3V7DB 4I9QA 4EPHA 1XVEE 3QETA 3QNNA 4DU4A 3TAEA 4FJIA 3OGKB 2P5GA 2MW2A 4DTPA 3UO3A 1XU3E 3SCXA 2JH8A 4DTJA 2VJ4A 4KI6A 3RMBA 2B8IA 1XMHE 1FZ4E 2MMBA 4FK2A 3E4WA 4FVMA 3CFRA 4DTMA 3SUOA 3TABA 4M3ZA 4RG8A 3WSOA 1XL3C 4JS4A 4ADNA 1NEXB 1IH7A 3SUPA 3TAGA 3N1BA 4DTSA 1P22A 3E4YA 4EYWA 1FZIE 2OZSA 3K2OA 4ADOA 1XMFE 2VJ5A 1FZ6E 1XVBE 4DU1A 4M45A 2JPNA 3N1EA 4DTNA 1FZ1E 4B08A 3LDSA 4DTOA 4FJLA 4J2BA 3HP9A 3LD8A 3OGMB 1XVFE 2PFTA 3SJJA 1FZ2E 4M41A 1FZ0E 2PFVA 3C94A 1XVCE 4FK0A 3TJYA 3L1NA 5IZ7A 3UIQA 4KHSA 4RL5A 3SUQA 4KI4A 1FZ7E 3HGLA 5H37A 3UO2A 4E4BA 1LDKE 4J2AA 4X5MA 4JRQA 3SQ0A 3SPZA 3NCIA 4HCCA 3QEVA 2FW3A 1FYZE 2ATQA 4I9LA 3CFPA 4M3XA 1MHZG 3RMDA 3QEPA 3SI6A 1JW2A 5IBKB 1FPOA 1Q9XA 2DEBA 2E32A 4JS5A 3SPYA 4FJXA 2FYOA 3QEWA 4FJKA 3LZIA 4M3UA 2DY4A 4QNCA 3NAEA 4HCBA 4M3YA 5IREA 4FJHA 2OVPB 4EP9A 4M3WA 3TL8B 4FJNA 1WAJA 4FJ9A 3C6OB 4KHUA 3KD5E 3RMAA 2JHAA 2JHCA 4J2EA 3HGKE 2LF6A 4E3SA 2JH9A 4FJGA 3SVIA 2JQTA 3OGLB 3NDKA 3L8BA 3S9HA 2P1OB 3RWUA 3SNNA 3C6PB 3NE6A 2RCUA 4KHNA 4AI6A 4FJ5A 4QNDA 1MHYG 2B1EA 3QESA 3SUNA 1XVDE 3C6NB 4ICGC 2JHPA 4FJMA 1MMOG 4AKHA 2LF3A 4DTXA 3SQ1A 2K5SA 2OYQA 3TAFA 1Q9YA 3HL8A 4FJ8A 3CQ8A 1FS1A 1XMGE 1FZ9E
chains in the Genus database with same CATH topology
3QEXA 3NGIA 1MTYG 2HD0A 4M3TA 4DTRA 1CLQA 3KD1E 4JRPA 3CFOA 4DU3A 2P1PB 3RMCA 3LZJA 4GAMC 3L2OB 2OZMA 3MKSB 4AKIA 3QNOA 3QEIA 3J27A 4KHQA 1WAFA 2P1MB 2YB5A 1FZHE 4M42A 4FJJA 4I6JB 2E31A 2P1QB 4DTUA 3NHGA 4M3RA 3QERA 3L0MA 4KHYA 2H4TA 4X5NA 1FZ8E 3SQ2A 3LDBA 1IG9A 4RNGA 2DTUA 4FJ7A 1FZ3E 1XVGE 1FZ5E 2P1NB 3C95A 2B7MA 2P5OA 4AKGA 2VIXA 2OVRB 3SQ4A 1FXXA 2MZWB 2QXFA 3J2PA 4FK4A 2OVQB 4J2DA 4KHWA 1XU5E 3V7DB 4I9QA 4EPHA 1XVEE 3QETA 3QNNA 4DU4A 3TAEA 4FJIA 3OGKB 2P5GA 4DTPA 1XU3E 3SCXA 2JH8A 4DTJA 2VJ4A 4KI6A 3RMBA 2B8IA 1XMHE 1FZ4E 2MMBA 4FK2A 3E4WA 4FVMA 3CFRA 4DTMA 3SUOA 3TABA 4M3ZA 4RG8A 3WSOA 1XL3C 4JS4A 4ADNA 1NEXB 1IH7A 3SUPA 3TAGA 3N1BA 4DTSA 1P22A 3E4YA 4EYWA 1FZIE 2OZSA 3K2OA 4ADOA 1XMFE 2VJ5A 1FZ6E 1XVBE 4DU1A 4M45A 2JPNA 3N1EA 4DTNA 1FZ1E 4B08A 3LDSA 4DTOA 4FJLA 4J2BA 3HP9A 3LD8A 3OGMB 1XVFE 2PFTA 3SJJA 1FZ2E 4M41A 1FZ0E 2PFVA 3C94A 1XVCE 4FK0A 3TJYA 3L1NA 5IZ7A 3UIQA 4KHSA 4RL5A 3SUQA 4KI4A 1FZ7E 3HGLA 5H37A 4E4BA 4J2AA 1LDKE 4X5MA 4JRQA 3SQ0A 3SPZA 3NCIA 4HCCA 3QEVA 2FW3A 1FYZE 2ATQA 4I9LA 3CFPA 4M3XA 1MHZG 3RMDA 3QEPA 3SI6A 5IBKB 1Q9XA 2DEBA 2E32A 4JS5A 3SPYA 4FJXA 2FYOA 3QEWA 4FJKA 3LZIA 4M3UA 2DY4A 4QNCA 3NAEA 4HCBA 4M3YA 5IREA 4FJHA 2OVPB 4EP9A 4M3WA 3TL8B 4FJNA 1WAJA 4FJ9A 3C6OB 4KHUA 3KD5E 3RMAA 2JHAA 2JHCA 4J2EA 3HGKE 2LF6A 4E3SA 2JH9A 4FJGA 3SVIA 3OGLB 3NDKA 3L8BA 3S9HA 2P1OB 3RWUA 3SNNA 3C6PB 3NE6A 2RCUA 4KHNA 4AI6A 4FJ5A 4QNDA 1MHYG 2B1EA 3QESA 3SUNA 1XVDE 3C6NB 2JHPA 4FJMA 1MMOG 4AKHA 2LF3A 4DTXA 3SQ1A 2OYQA 3TAFA 1Q9YA 3HL8A 4FJ8A 3CQ8A 1FS1A 1XMGE 1FZ9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU5 E;  1MTY G;  1XVE E;  1FZ1 E;  1XVF E;  4GAM C;  1XU3 E;  1FZ2 E;  1FZ0 E;  1XVC E;  1XMH E;  1FZ4 E;  1FZH E;  1FZ7 E;  1FZ8 E;  1MHY G;  1FYZ E;  1XVD E;  1FZ3 E;  1MHZ G;  1XVG E;  1FZ5 E;  1FZI E;  1MMO G;  1XMF E;  1FZ6 E;  1XVB E;  1XMG E;  1FZ9 E; 
#chains in the Genus database with same CATH topology
 3QEX A;  3NGI A;  1MTY G;  2HD0 A;  2RKH A;  4M3T A;  4DTR A;  1CLQ A;  3KD1 E;  4JRP A;  3CFO A;  4DU3 A;  2P1P B;  3RMC A;  3LZJ A;  4GAM C;  3L2O B;  2OZM A;  3MKS B;  4AKI A;  3QNO A;  3QEI A;  3J27 A;  4KHQ A;  1WAF A;  2P1M B;  2YB5 A;  1FZH E;  4M42 A;  4FJJ A;  4I6J B;  2E31 A;  2P1Q B;  4DTU A;  3NHG A;  4M3R A;  3QER A;  3L0M A;  4KHY A;  2H4T A;  4X5N A;  1FZ8 E;  3SQ2 A;  3LDB A;  1IG9 A;  4IT5 A;  4RNG A;  2DTU A;  4FJ7 A;  1FZ3 E;  1XVG E;  3C95 A;  1FZ5 E;  2P1N B;  2B7M A;  2P5O A;  4AKG A;  2VIX A;  2OVR B;  3SQ4 A;  1FXX A;  2MZW B;  2QXF A;  3J2P A;  4FK4 A;  2OVQ B;  3BVO A;  4J2D A;  4KHW A;  1N1C A;  1XU5 E;  3V7D B;  4I9Q A;  4EPH A;  1XVE E;  3QET A;  3QNN A;  4DU4 A;  3TAE A;  4FJI A;  3OGK B;  2P5G A;  2MW2 A;  4DTP A;  3UO3 A;  1XU3 E;  3SCX A;  2JH8 A;  4DTJ A;  2VJ4 A;  4KI6 A;  3RMB A;  2B8I A;  1XMH E;  1FZ4 E;  2MMB A;  4FK2 A;  3E4W A;  4FVM A;  3CFR A;  4DTM A;  3SUO A;  3TAB A;  4M3Z A;  4RG8 A;  3WSO A;  1XL3 C;  4JS4 A;  4ADN A;  1NEX B;  1IH7 A;  3SUP A;  3TAG A;  3N1B A;  4DTS A;  1P22 A;  3E4Y A;  4EYW A;  1FZI E;  2OZS A;  3K2O A;  4ADO A;  1XMF E;  2VJ5 A;  1FZ6 E;  1XVB E;  4DU1 A;  4M45 A;  2JPN A;  3N1E A;  4DTN A;  1FZ1 E;  4B08 A;  3LDS A;  4DTO A;  4FJL A;  4J2B A;  3HP9 A;  3LD8 A;  3OGM B;  1XVF E;  2PFT A;  3SJJ A;  1FZ2 E;  4M41 A;  1FZ0 E;  2PFV A;  3C94 A;  1XVC E;  4FK0 A;  3TJY A;  3L1N A;  5IZ7 A;  3UIQ A;  4KHS A;  4RL5 A;  3SUQ A;  4KI4 A;  1FZ7 E;  3HGL A;  5H37 A;  3UO2 A;  4E4B A;  1LDK E;  4J2A A;  4X5M A;  4JRQ A;  3SQ0 A;  3SPZ A;  3NCI A;  4HCC A;  3QEV A;  2FW3 A;  1FYZ E;  2ATQ A;  4I9L A;  3CFP A;  4M3X A;  1MHZ G;  3RMD A;  3QEP A;  3SI6 A;  1JW2 A;  5IBK B;  1FPO A;  1Q9X A;  2DEB A;  2E32 A;  4JS5 A;  3SPY A;  4FJX A;  2FYO A;  3QEW A;  4FJK A;  3LZI A;  4M3U A;  2DY4 A;  4QNC A;  3NAE A;  4HCB A;  4M3Y A;  5IRE A;  4FJH A;  2OVP B;  4EP9 A;  4M3W A;  3TL8 B;  4FJN A;  1WAJ A;  4FJ9 A;  3C6O B;  4KHU A;  3KD5 E;  3RMA A;  2JHA A;  2JHC A;  4J2E A;  3HGK E;  2LF6 A;  4E3S A;  2JH9 A;  4FJG A;  3SVI A;  2JQT A;  3OGL B;  3NDK A;  3L8B A;  3S9H A;  2P1O B;  3RWU A;  3SNN A;  3C6P B;  3NE6 A;  2RCU A;  4KHN A;  4AI6 A;  4FJ5 A;  4QND A;  1MHY G;  2B1E A;  3QES A;  3SUN A;  1XVD E;  3C6N B;  4ICG C;  2JHP A;  4FJM A;  1MMO G;  4AKH A;  2LF3 A;  4DTX A;  3SQ1 A;  2K5S A;  2OYQ A;  3TAF A;  1Q9Y A;  3HL8 A;  4FJ8 A;  3CQ8 A;  1FS1 A;  1XMG E;  1FZ9 E; 
#chains in the Genus database with same CATH homology
 3QEX A;  3NGI A;  1MTY G;  2HD0 A;  4M3T A;  4DTR A;  1CLQ A;  3KD1 E;  4JRP A;  3CFO A;  4DU3 A;  2P1P B;  3RMC A;  3LZJ A;  4GAM C;  3L2O B;  2OZM A;  3MKS B;  4AKI A;  3QNO A;  3QEI A;  3J27 A;  4KHQ A;  1WAF A;  2P1M B;  2YB5 A;  1FZH E;  4M42 A;  4FJJ A;  4I6J B;  2E31 A;  2P1Q B;  4DTU A;  3NHG A;  4M3R A;  3QER A;  3L0M A;  4KHY A;  2H4T A;  4X5N A;  1FZ8 E;  3SQ2 A;  3LDB A;  1IG9 A;  4RNG A;  2DTU A;  4FJ7 A;  1FZ3 E;  1XVG E;  1FZ5 E;  2P1N B;  3C95 A;  2B7M A;  2P5O A;  4AKG A;  2VIX A;  2OVR B;  3SQ4 A;  1FXX A;  2MZW B;  2QXF A;  3J2P A;  4FK4 A;  2OVQ B;  4J2D A;  4KHW A;  1XU5 E;  3V7D B;  4I9Q A;  4EPH A;  1XVE E;  3QET A;  3QNN A;  4DU4 A;  3TAE A;  4FJI A;  3OGK B;  2P5G A;  4DTP A;  1XU3 E;  3SCX A;  2JH8 A;  4DTJ A;  2VJ4 A;  4KI6 A;  3RMB A;  2B8I A;  1XMH E;  1FZ4 E;  2MMB A;  4FK2 A;  3E4W A;  4FVM A;  3CFR A;  4DTM A;  3SUO A;  3TAB A;  4M3Z A;  4RG8 A;  3WSO A;  1XL3 C;  4JS4 A;  4ADN A;  1NEX B;  1IH7 A;  3SUP A;  3TAG A;  3N1B A;  4DTS A;  1P22 A;  3E4Y A;  4EYW A;  1FZI E;  2OZS A;  3K2O A;  4ADO A;  1XMF E;  2VJ5 A;  1FZ6 E;  1XVB E;  4DU1 A;  4M45 A;  2JPN A;  3N1E A;  4DTN A;  1FZ1 E;  4B08 A;  3LDS A;  4DTO A;  4FJL A;  4J2B A;  3HP9 A;  3LD8 A;  3OGM B;  1XVF E;  2PFT A;  3SJJ A;  1FZ2 E;  4M41 A;  1FZ0 E;  2PFV A;  3C94 A;  1XVC E;  4FK0 A;  3TJY A;  3L1N A;  5IZ7 A;  3UIQ A;  4KHS A;  4RL5 A;  3SUQ A;  4KI4 A;  1FZ7 E;  3HGL A;  5H37 A;  4E4B A;  4J2A A;  1LDK E;  4X5M A;  4JRQ A;  3SQ0 A;  3SPZ A;  3NCI A;  4HCC A;  3QEV A;  2FW3 A;  1FYZ E;  2ATQ A;  4I9L A;  3CFP A;  4M3X A;  1MHZ G;  3RMD A;  3QEP A;  3SI6 A;  5IBK B;  1Q9X A;  2DEB A;  2E32 A;  4JS5 A;  3SPY A;  4FJX A;  2FYO A;  3QEW A;  4FJK A;  3LZI A;  4M3U A;  2DY4 A;  4QNC A;  3NAE A;  4HCB A;  4M3Y A;  5IRE A;  4FJH A;  2OVP B;  4EP9 A;  4M3W A;  3TL8 B;  4FJN A;  1WAJ A;  4FJ9 A;  3C6O B;  4KHU A;  3KD5 E;  3RMA A;  2JHA A;  2JHC A;  4J2E A;  3HGK E;  2LF6 A;  4E3S A;  2JH9 A;  4FJG A;  3SVI A;  3OGL B;  3NDK A;  3L8B A;  3S9H A;  2P1O B;  3RWU A;  3SNN A;  3C6P B;  3NE6 A;  2RCU A;  4KHN A;  4AI6 A;  4FJ5 A;  4QND A;  1MHY G;  2B1E A;  3QES A;  3SUN A;  1XVD E;  3C6N B;  2JHP A;  4FJM A;  1MMO G;  4AKH A;  2LF3 A;  4DTX A;  3SQ1 A;  2OYQ A;  3TAF A;  1Q9Y A;  3HL8 A;  4FJ8 A;  3CQ8 A;  1FS1 A;  1XMG E;  1FZ9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...