1FZ8E

Methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E02
1FYZE 1XVDE 1FZ0E 1XVCE 1FZ9E 1XMFE 1FZ1E 1FZ3E 1XMGE 1FZ5E 1FZ6E 1FZIE 4GAMC 1XMHE 1XVBE 1FZ7E 1XU5E 1MMOG 1MTYG 1XVFE 1MHYG 1FZ8E 1XU3E 1MHZG 1FZ4E 1FZ2E 1XVGE 1XVEE 1FZHE
chains in the Genus database with same CATH superfamily
3QEWA 4DTMA 2DTUA 2E32A 4FJXA 2OVRB 3SJJA 3C94A 3TJYA 1WAJA 4HCCA 3CFOA 5IREA 4DTJA 4X5MA 3RMAA 3HL8A 3SQ4A 4J2DA 2MW2A 4GAMC 4FK2A 4I9QA 1FZ7E 2P5GA 4ADNA 3QETA 1MTYG 2LF6A 3C95A 4FK0A 4FJ9A 1XVFE 4M3TA 3SUQA 4DU3A 4FJHA 5IZ7A 4KHQA 3TAGA 1FZ4E 2P1MB 3QEPA 3NCIA 4AI6A 4KHUA 1FZ2E 5H37A 4DU1A 3SUPA 1Q9YA 3QNOA 4DTXA 4AKHA 4E4BA 4FJLA 2MZWB 1CLQA 3V7DB 2FW3A 2P1QB 5IBKB 3SCXA 3SNNA 2OZMA 2JPNA 3SUOA 3SPYA 4FJGA 3QEVA 1XVCE 2JHCA 4DU4A 4AKIA 2K5SA 4JRQA 4M3YA 4KHWA 3NGIA 1FZ3E 4RNGA 2PFTA 2RCUA 1XMGE 1FZ6E 1FZIE 4J2EA 1JW2A 3L0MA 3TAFA 4DTRA 3NE6A 1XU5E 4M3WA 4DTOA 3NAEA 1FZ8E 3UO3A 4FJMA 3QEIA 4KI6A 2B1EA 3LDSA 3E4WA 4RL5A 4JRPA 4J2AA 4ADOA 3QERA 3QEXA 4FJNA 4AKGA 3NDKA 3SI6A 4DTUA 2B8IA 2PFVA 2OVPB 4E3SA 1N1CA 2B7MA 3TAEA 3RMDA 3RMBA 3L8BA 3TL8B 4M3XA 3N1BA 3S9HA 4JS4A 1XL3C 4KHSA 2JH8A 3C6PB 1FYZE 1XVDE 4FJ8A 2VJ4A 3MKSB 3J27A 1FZ9E 4FJIA 3C6OB 4QNDA 2E31A 2DY4A 2OVQB 1FZ1E 3OGMB 3WSOA 4J2BA 2P1NB 2VJ5A 1FPOA 1XVBE 3CFPA 3LZIA 4B08A 1FXXA 2ATQA 3QNNA 4IT5A 1MMOG 3SQ1A 2QXFA 2P5OA 4M3ZA 3OGLB 1MHYG 4RG8A 3TABA 3UO2A 2DEBA 2JHPA 2MMBA 4EPHA 3CQ8A 2JH9A 3BVOA 1MHZG 1XU3E 3N1EA 4I9LA 4KHNA 4DTPA 3LD8A 3OGKB 2RKHA 4JS5A 2LF3A 3HP9A 3E4YA 4QNCA 2JQTA 1XVEE 2YB5A 3C6NB 3J2PA 4FVMA 2JHAA 2H4TA 4M3RA 2OYQA 2OZSA 2P1PB 4KI4A 4EP9A 4I6JB 3K2OA 3LZJA 4FK4A 3L2OB 4DTNA 4FJKA 3L1NA 3SUNA 3RWUA 4X5NA 1FZ0E 3HGKE 3NHGA 1IG9A 4DTSA 2P1OB 3SQ0A 1XMFE 3KD5E 4M42A 4M41A 1FZ5E 1NEXB 1P22A 1IH7A 1XMHE 3SQ2A 3RMCA 1FS1A 4FJ5A 1Q9XA 2HD0A 2FYOA 3QESA 3UIQA 2VIXA 4M3UA 1LDKE 4HCBA 3SVIA 1WAFA 3CFRA 3KD1E 4FJ7A 4KHYA 4EYWA 1XVGE 4FJJA 4M45A 3HGLA 3SPZA 3LDBA 1FZHE 4ICGC
chains in the Genus database with same CATH topology
3QEWA 4DTMA 2DTUA 2E32A 4FJXA 2OVRB 3SJJA 3C94A 3TJYA 1WAJA 4HCCA 3CFOA 5IREA 4DTJA 4X5MA 3RMAA 3HL8A 3SQ4A 4J2DA 4GAMC 4FK2A 4I9QA 1FZ7E 2P5GA 4ADNA 3QETA 1MTYG 2LF6A 3C95A 4FK0A 4FJ9A 1XVFE 4M3TA 3SUQA 4DU3A 4FJHA 5IZ7A 4KHQA 3TAGA 1FZ4E 2P1MB 3QEPA 3NCIA 4AI6A 4KHUA 1FZ2E 5H37A 4DU1A 3SUPA 1Q9YA 3QNOA 4DTXA 4AKHA 4E4BA 4FJLA 2MZWB 1CLQA 3V7DB 2FW3A 2P1QB 5IBKB 3SCXA 3SNNA 2OZMA 2JPNA 3SUOA 3SPYA 4FJGA 3QEVA 1XVCE 2JHCA 4DU4A 4AKIA 4JRQA 4M3YA 4KHWA 3NGIA 1FZ3E 4RNGA 2PFTA 2RCUA 1XMGE 1FZ6E 1FZIE 4J2EA 3L0MA 3TAFA 4DTRA 3NE6A 1XU5E 4M3WA 4DTOA 3NAEA 1FZ8E 4FJMA 3QEIA 4KI6A 2B1EA 3LDSA 3E4WA 4RL5A 4JRPA 4J2AA 4ADOA 3QERA 3QEXA 4FJNA 4AKGA 3NDKA 3SI6A 4DTUA 2B8IA 2PFVA 2OVPB 4E3SA 2B7MA 3TAEA 3RMDA 3RMBA 3L8BA 3TL8B 4M3XA 3N1BA 3S9HA 4JS4A 1XL3C 4KHSA 2JH8A 3C6PB 1FYZE 1XVDE 4FJ8A 2VJ4A 3MKSB 3J27A 1FZ9E 4FJIA 3C6OB 4QNDA 2E31A 2DY4A 2OVQB 1FZ1E 3OGMB 3WSOA 4J2BA 2P1NB 2VJ5A 1XVBE 3CFPA 3LZIA 4B08A 1FXXA 2ATQA 3QNNA 3SQ1A 1MMOG 2P5OA 2QXFA 4M3ZA 3OGLB 1MHYG 4RG8A 3TABA 2DEBA 2JHPA 2MMBA 4EPHA 3CQ8A 2JH9A 3N1EA 1MHZG 1XU3E 4KHNA 4I9LA 4DTPA 3LD8A 3OGKB 4JS5A 2LF3A 3HP9A 3E4YA 4QNCA 3C6NB 1XVEE 2YB5A 3J2PA 4FVMA 2JHAA 2H4TA 4M3RA 2OYQA 2OZSA 2P1PB 4KI4A 4EP9A 4I6JB 3K2OA 3LZJA 4FK4A 3L2OB 4DTNA 4FJKA 3L1NA 3SUNA 3RWUA 4X5NA 1FZ0E 3HGKE 3NHGA 1IG9A 4DTSA 2P1OB 3SQ0A 1XMFE 3KD5E 4M42A 4M41A 1FZ5E 1NEXB 1P22A 1IH7A 1XMHE 3SQ2A 3RMCA 1FS1A 4FJ5A 1Q9XA 2HD0A 2FYOA 3QESA 3UIQA 2VIXA 4M3UA 1LDKE 4HCBA 3SVIA 1WAFA 3CFRA 3KD1E 4FJ7A 4KHYA 4EYWA 1XVGE 4FJJA 4M45A 3HGLA 3SPZA 3LDBA 1FZHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYZ E;  1XVD E;  1FZ0 E;  1XVC E;  1FZ9 E;  1XMF E;  1FZ1 E;  1FZ3 E;  1XMG E;  1FZ5 E;  1FZ6 E;  1FZI E;  4GAM C;  1XMH E;  1XVB E;  1FZ7 E;  1XU5 E;  1MMO G;  1MTY G;  1XVF E;  1MHY G;  1FZ8 E;  1XU3 E;  1MHZ G;  1FZ4 E;  1FZ2 E;  1XVG E;  1XVE E;  1FZH E; 
#chains in the Genus database with same CATH topology
 3QEW A;  4DTM A;  2DTU A;  2E32 A;  4FJX A;  2OVR B;  3SJJ A;  3C94 A;  3TJY A;  1WAJ A;  4HCC A;  3CFO A;  5IRE A;  4DTJ A;  4X5M A;  3RMA A;  3HL8 A;  3SQ4 A;  4J2D A;  2MW2 A;  4GAM C;  4FK2 A;  4I9Q A;  1FZ7 E;  2P5G A;  4ADN A;  3QET A;  1MTY G;  2LF6 A;  3C95 A;  4FK0 A;  4FJ9 A;  1XVF E;  4M3T A;  3SUQ A;  4DU3 A;  4FJH A;  5IZ7 A;  4KHQ A;  3TAG A;  1FZ4 E;  2P1M B;  3QEP A;  3NCI A;  4AI6 A;  4KHU A;  1FZ2 E;  5H37 A;  4DU1 A;  3SUP A;  1Q9Y A;  3QNO A;  4DTX A;  4AKH A;  4E4B A;  4FJL A;  2MZW B;  1CLQ A;  3V7D B;  2FW3 A;  2P1Q B;  5IBK B;  3SCX A;  3SNN A;  2OZM A;  2JPN A;  3SUO A;  3SPY A;  4FJG A;  3QEV A;  1XVC E;  2JHC A;  4DU4 A;  4AKI A;  2K5S A;  4JRQ A;  4M3Y A;  4KHW A;  3NGI A;  1FZ3 E;  4RNG A;  2PFT A;  2RCU A;  1XMG E;  1FZ6 E;  1FZI E;  4J2E A;  1JW2 A;  3L0M A;  3TAF A;  4DTR A;  3NE6 A;  1XU5 E;  4M3W A;  4DTO A;  3NAE A;  1FZ8 E;  3UO3 A;  4FJM A;  3QEI A;  4KI6 A;  2B1E A;  3LDS A;  3E4W A;  4RL5 A;  4JRP A;  4J2A A;  4ADO A;  3QER A;  3QEX A;  4FJN A;  4AKG A;  3NDK A;  3SI6 A;  4DTU A;  2B8I A;  2PFV A;  2OVP B;  4E3S A;  1N1C A;  2B7M A;  3TAE A;  3RMD A;  3RMB A;  3L8B A;  3TL8 B;  4M3X A;  3N1B A;  3S9H A;  4JS4 A;  1XL3 C;  4KHS A;  2JH8 A;  3C6P B;  1FYZ E;  1XVD E;  4FJ8 A;  2VJ4 A;  3MKS B;  3J27 A;  1FZ9 E;  4FJI A;  3C6O B;  4QND A;  2E31 A;  2DY4 A;  2OVQ B;  1FZ1 E;  3OGM B;  3WSO A;  4J2B A;  2P1N B;  2VJ5 A;  1FPO A;  1XVB E;  3CFP A;  3LZI A;  4B08 A;  1FXX A;  2ATQ A;  3QNN A;  4IT5 A;  1MMO G;  3SQ1 A;  2QXF A;  2P5O A;  4M3Z A;  3OGL B;  1MHY G;  4RG8 A;  3TAB A;  3UO2 A;  2DEB A;  2JHP A;  2MMB A;  4EPH A;  3CQ8 A;  2JH9 A;  3BVO A;  1MHZ G;  1XU3 E;  3N1E A;  4I9L A;  4KHN A;  4DTP A;  3LD8 A;  3OGK B;  2RKH A;  4JS5 A;  2LF3 A;  3HP9 A;  3E4Y A;  4QNC A;  2JQT A;  1XVE E;  2YB5 A;  3C6N B;  3J2P A;  4FVM A;  2JHA A;  2H4T A;  4M3R A;  2OYQ A;  2OZS A;  2P1P B;  4KI4 A;  4EP9 A;  4I6J B;  3K2O A;  3LZJ A;  4FK4 A;  3L2O B;  4DTN A;  4FJK A;  3L1N A;  3SUN A;  3RWU A;  4X5N A;  1FZ0 E;  3HGK E;  3NHG A;  1IG9 A;  4DTS A;  2P1O B;  3SQ0 A;  1XMF E;  3KD5 E;  4M42 A;  4M41 A;  1FZ5 E;  1NEX B;  1P22 A;  1IH7 A;  1XMH E;  3SQ2 A;  3RMC A;  1FS1 A;  4FJ5 A;  1Q9X A;  2HD0 A;  2FYO A;  3QES A;  3UIQ A;  2VIX A;  4M3U A;  1LDK E;  4HCB A;  3SVI A;  1WAF A;  3CFR A;  3KD1 E;  4FJ7 A;  4KHY A;  4EYW A;  1XVG E;  4FJJ A;  4M45 A;  3HGL A;  3SPZ A;  3LDB A;  1FZH E;  4ICG C; 
#chains in the Genus database with same CATH homology
 3QEW A;  4DTM A;  2DTU A;  2E32 A;  4FJX A;  2OVR B;  3SJJ A;  3C94 A;  3TJY A;  1WAJ A;  4HCC A;  3CFO A;  5IRE A;  4DTJ A;  4X5M A;  3RMA A;  3HL8 A;  3SQ4 A;  4J2D A;  4GAM C;  4FK2 A;  4I9Q A;  1FZ7 E;  2P5G A;  4ADN A;  3QET A;  1MTY G;  2LF6 A;  3C95 A;  4FK0 A;  4FJ9 A;  1XVF E;  4M3T A;  3SUQ A;  4DU3 A;  4FJH A;  5IZ7 A;  4KHQ A;  3TAG A;  1FZ4 E;  2P1M B;  3QEP A;  3NCI A;  4AI6 A;  4KHU A;  1FZ2 E;  5H37 A;  4DU1 A;  3SUP A;  1Q9Y A;  3QNO A;  4DTX A;  4AKH A;  4E4B A;  4FJL A;  2MZW B;  1CLQ A;  3V7D B;  2FW3 A;  2P1Q B;  5IBK B;  3SCX A;  3SNN A;  2OZM A;  2JPN A;  3SUO A;  3SPY A;  4FJG A;  3QEV A;  1XVC E;  2JHC A;  4DU4 A;  4AKI A;  4JRQ A;  4M3Y A;  4KHW A;  3NGI A;  1FZ3 E;  4RNG A;  2PFT A;  2RCU A;  1XMG E;  1FZ6 E;  1FZI E;  4J2E A;  3L0M A;  3TAF A;  4DTR A;  3NE6 A;  1XU5 E;  4M3W A;  4DTO A;  3NAE A;  1FZ8 E;  4FJM A;  3QEI A;  4KI6 A;  2B1E A;  3LDS A;  3E4W A;  4RL5 A;  4JRP A;  4J2A A;  4ADO A;  3QER A;  3QEX A;  4FJN A;  4AKG A;  3NDK A;  3SI6 A;  4DTU A;  2B8I A;  2PFV A;  2OVP B;  4E3S A;  2B7M A;  3TAE A;  3RMD A;  3RMB A;  3L8B A;  3TL8 B;  4M3X A;  3N1B A;  3S9H A;  4JS4 A;  1XL3 C;  4KHS A;  2JH8 A;  3C6P B;  1FYZ E;  1XVD E;  4FJ8 A;  2VJ4 A;  3MKS B;  3J27 A;  1FZ9 E;  4FJI A;  3C6O B;  4QND A;  2E31 A;  2DY4 A;  2OVQ B;  1FZ1 E;  3OGM B;  3WSO A;  4J2B A;  2P1N B;  2VJ5 A;  1XVB E;  3CFP A;  3LZI A;  4B08 A;  1FXX A;  2ATQ A;  3QNN A;  3SQ1 A;  1MMO G;  2P5O A;  2QXF A;  4M3Z A;  3OGL B;  1MHY G;  4RG8 A;  3TAB A;  2DEB A;  2JHP A;  2MMB A;  4EPH A;  3CQ8 A;  2JH9 A;  3N1E A;  1MHZ G;  1XU3 E;  4KHN A;  4I9L A;  4DTP A;  3LD8 A;  3OGK B;  4JS5 A;  2LF3 A;  3HP9 A;  3E4Y A;  4QNC A;  3C6N B;  1XVE E;  2YB5 A;  3J2P A;  4FVM A;  2JHA A;  2H4T A;  4M3R A;  2OYQ A;  2OZS A;  2P1P B;  4KI4 A;  4EP9 A;  4I6J B;  3K2O A;  3LZJ A;  4FK4 A;  3L2O B;  4DTN A;  4FJK A;  3L1N A;  3SUN A;  3RWU A;  4X5N A;  1FZ0 E;  3HGK E;  3NHG A;  1IG9 A;  4DTS A;  2P1O B;  3SQ0 A;  1XMF E;  3KD5 E;  4M42 A;  4M41 A;  1FZ5 E;  1NEX B;  1P22 A;  1IH7 A;  1XMH E;  3SQ2 A;  3RMC A;  1FS1 A;  4FJ5 A;  1Q9X A;  2HD0 A;  2FYO A;  3QES A;  3UIQ A;  2VIX A;  4M3U A;  1LDK E;  4HCB A;  3SVI A;  1WAF A;  3CFR A;  3KD1 E;  4FJ7 A;  4KHY A;  4EYW A;  1XVG E;  4FJJ A;  4M45 A;  3HGL A;  3SPZ A;  3LDB A;  1FZH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...