1FZ8E

Methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E02
1XVDE 1XVCE 1FZ8E 1FZHE 1FZ0E 1FZIE 1XMGE 1XU5E 1FZ2E 1FZ1E 1FZ4E 1XVEE 1XMFE 1MTYG 4GAMC 1MMOG 1MHZG 1XMHE 1XVGE 1FZ3E 1XVFE 1FZ7E 1FZ6E 1XU3E 1XVBE 1FZ5E 1FYZE 1MHYG 1FZ9E
chains in the Genus database with same CATH superfamily
3QEVA 1WAFA 1FZHE 2B8IA 4M3ZA 4J2AA 4FK2A 1FZ1E 2HD0A 1LDKE 2MZWB 2QXFA 3SUOA 3SNNA 4KHSA 4I9QA 4M41A 3QEPA 4E3SA 4E4BA 4I9LA 1XMFE 1P22A 3QNNA 2E31A 4FK4A 2DEBA 3HP9A 4RL5A 2JHAA 3LD8A 4FJKA 3L1NA 5H37A 4AKIA 3C6NB 1N1CA 2OYQA 3CFPA 4I6JB 4DTMA 4J2DA 2LF3A 1XVFE 3CFRA 4FJHA 1FZ7E 4M3RA 1XVBE 4DU1A 1FZ5E 3TAFA 1FYZE 3TL8B 3RMAA 2MMBA 4EYWA 2P5OA 2JH9A 4KHUA 4RG8A 3SVIA 3V7DB 2ATQA 3TJYA 1FZ8E 4FJ5A 2VIXA 4QNDA 3KD5E 1XMGE 3CFOA 4M42A 1FXXA 2VJ4A 3L0MA 1FZ4E 4FK0A 1XVEE 3MKSB 2RCUA 4FJ9A 3HL8A 2PFVA 4M3TA 5IREA 4FJMA 2FW3A 4GAMC 3SPZA 4JRPA 4HCCA 3E4YA 3RMBA 4J2BA 3OGMB 2LF6A 4JS4A 3SQ0A 4M3UA 1XVGE 4M3WA 3SQ2A 1FZ3E 4DU3A 3E4WA 3NDKA 3QEIA 3N1EA 1NEXB 3NAEA 1IH7A 4ICGC 3L8BA 3SPYA 5IZ7A 1FZ9E 4FVMA 3UO2A 1JW2A 2MW2A 2P1PB 3SUNA 2P1MB 1CLQA 2YB5A 3QNOA 3L2OB 1XU5E 1FZ2E 3S9HA 4DTJA 2RKHA 3QEXA 4EP9A 3C95A 3SUPA 4FJ8A 3LDSA 3QERA 4KHYA 2JPNA 4ADOA 4JRQA 4DTUA 3C6PB 3WSOA 3TAEA 4DTNA 3UO3A 4HCBA 1MHZG 4DTRA 4KHQA 1FS1A 4KHWA 3HGLA 3LZJA 3RMDA 3UIQA 4KHNA 4M45A 3SQ4A 4FJGA 3SQ1A 2E32A 2P1QB 1Q9YA 4KI6A 2DY4A 1Q9XA 3RWUA 3K2OA 3LDBA 1XU3E 3J2PA 3KD1E 3N1BA 3NHGA 3C6OB 4FJJA 2FYOA 2PFTA 4DTPA 3SI6A 3OGKB 4FJXA 1XVDE 3OGLB 3NCIA 4DTSA 3RMCA 1XVCE 4DTOA 3QEWA 3SCXA 2P5GA 4J2EA 2DTUA 1FZ0E 1FZIE 4EPHA 4M3YA 4RNGA 3BVOA 1IG9A 4X5MA 2JH8A 4FJ7A 3TABA 3NGIA 3J27A 4DU4A 2K5SA 2P1NB 4KI4A 3LZIA 4DTXA 4AKHA 2JHCA 4B08A 1MTYG 4FJNA 3C94A 4X5NA 2JQTA 4IT5A 1MMOG 4FJLA 2OVRB 2B7MA 4QNCA 4JS5A 3SUQA 4AI6A 1XMHE 1FPOA 4AKGA 1XL3C 2P1OB 3HGKE 3NE6A 5IBKB 3CQ8A 3QESA 2VJ5A 2OVQB 2OZMA 1FZ6E 1WAJA 3QETA 3TAGA 3SJJA 2OZSA 4ADNA 4FJIA 1MHYG 2JHPA 4M3XA 2OVPB 2B1EA 2H4TA
chains in the Genus database with same CATH topology
3QEVA 1WAFA 1FZHE 2B8IA 4M3ZA 4J2AA 4FK2A 1FZ1E 2HD0A 1LDKE 2MZWB 2QXFA 3SUOA 3SNNA 4KHSA 4I9QA 4M41A 3QEPA 4E3SA 4E4BA 4I9LA 1XMFE 1P22A 3QNNA 2E31A 4FK4A 2DEBA 3HP9A 4RL5A 2JHAA 3LD8A 4FJKA 3L1NA 5H37A 4AKIA 3C6NB 2OYQA 3CFPA 4I6JB 4DTMA 4J2DA 2LF3A 1XVFE 3CFRA 4FJHA 1FZ7E 4M3RA 1XVBE 4DU1A 1FZ5E 3TAFA 1FYZE 3TL8B 3RMAA 2MMBA 4EYWA 2P5OA 2JH9A 4KHUA 4RG8A 3SVIA 3V7DB 2ATQA 3TJYA 1FZ8E 4FJ5A 2VIXA 4QNDA 3KD5E 1XMGE 3CFOA 4M42A 1FXXA 2VJ4A 3L0MA 1FZ4E 4FK0A 1XVEE 3MKSB 2RCUA 4FJ9A 3HL8A 2PFVA 4M3TA 5IREA 4FJMA 2FW3A 4GAMC 3SPZA 4JRPA 4HCCA 3E4YA 3RMBA 4J2BA 3OGMB 2LF6A 4JS4A 3SQ0A 4M3UA 1XVGE 4M3WA 3SQ2A 1FZ3E 4DU3A 3E4WA 3NDKA 3QEIA 3N1EA 1NEXB 3NAEA 1IH7A 3L8BA 3SPYA 5IZ7A 1FZ9E 4FVMA 2P1PB 3SUNA 2P1MB 1CLQA 2YB5A 3QNOA 3L2OB 1XU5E 1FZ2E 3S9HA 4DTJA 3QEXA 4EP9A 3C95A 3SUPA 4FJ8A 3LDSA 3QERA 4KHYA 2JPNA 4ADOA 4JRQA 4DTUA 3C6PB 3WSOA 3TAEA 4DTNA 4HCBA 1MHZG 4DTRA 4KHQA 1FS1A 4KHWA 3HGLA 3LZJA 3RMDA 3UIQA 4KHNA 4M45A 3SQ4A 4FJGA 3SQ1A 2E32A 2P1QB 1Q9YA 4KI6A 2DY4A 1Q9XA 3RWUA 3K2OA 3LDBA 1XU3E 3J2PA 3KD1E 3N1BA 3NHGA 3C6OB 4FJJA 2FYOA 2PFTA 4DTPA 3SI6A 3OGKB 4FJXA 1XVDE 3OGLB 3NCIA 4DTSA 3RMCA 1XVCE 4DTOA 3QEWA 3SCXA 2P5GA 4J2EA 2DTUA 1FZ0E 1FZIE 4EPHA 4M3YA 4RNGA 1IG9A 4X5MA 2JH8A 4FJ7A 3TABA 3NGIA 3J27A 4DU4A 2P1NB 4KI4A 3LZIA 4DTXA 4AKHA 2JHCA 4B08A 1MTYG 4FJNA 3C94A 4X5NA 1MMOG 4FJLA 2OVRB 2B7MA 4QNCA 4JS5A 3SUQA 4AI6A 1XMHE 4AKGA 1XL3C 2P1OB 3HGKE 3NE6A 5IBKB 3CQ8A 3QESA 2VJ5A 2OVQB 2OZMA 1FZ6E 1WAJA 3QETA 3TAGA 3SJJA 2OZSA 4ADNA 4FJIA 1MHYG 2JHPA 4M3XA 2OVPB 2B1EA 2H4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVD E;  1XVC E;  1FZ8 E;  1FZH E;  1FZ0 E;  1FZI E;  1XMG E;  1XU5 E;  1FZ2 E;  1FZ1 E;  1FZ4 E;  1XVE E;  1XMF E;  1MTY G;  4GAM C;  1MMO G;  1MHZ G;  1XMH E;  1XVG E;  1FZ3 E;  1XVF E;  1FZ7 E;  1FZ6 E;  1XU3 E;  1XVB E;  1FZ5 E;  1FYZ E;  1MHY G;  1FZ9 E; 
#chains in the Genus database with same CATH topology
 3QEV A;  1WAF A;  1FZH E;  2B8I A;  4M3Z A;  4J2A A;  4FK2 A;  1FZ1 E;  2HD0 A;  1LDK E;  2MZW B;  2QXF A;  3SUO A;  3SNN A;  4KHS A;  4I9Q A;  4M41 A;  3QEP A;  4E3S A;  4E4B A;  4I9L A;  1XMF E;  1P22 A;  3QNN A;  2E31 A;  4FK4 A;  2DEB A;  3HP9 A;  4RL5 A;  2JHA A;  3LD8 A;  4FJK A;  3L1N A;  5H37 A;  4AKI A;  3C6N B;  1N1C A;  2OYQ A;  3CFP A;  4I6J B;  4DTM A;  4J2D A;  2LF3 A;  1XVF E;  3CFR A;  4FJH A;  1FZ7 E;  4M3R A;  1XVB E;  4DU1 A;  1FZ5 E;  3TAF A;  1FYZ E;  3TL8 B;  3RMA A;  2MMB A;  4EYW A;  2P5O A;  2JH9 A;  4KHU A;  4RG8 A;  3SVI A;  3V7D B;  2ATQ A;  3TJY A;  1FZ8 E;  4FJ5 A;  2VIX A;  4QND A;  3KD5 E;  1XMG E;  3CFO A;  4M42 A;  1FXX A;  2VJ4 A;  3L0M A;  1FZ4 E;  4FK0 A;  1XVE E;  3MKS B;  2RCU A;  4FJ9 A;  3HL8 A;  2PFV A;  4M3T A;  5IRE A;  4FJM A;  2FW3 A;  4GAM C;  3SPZ A;  4JRP A;  4HCC A;  3E4Y A;  3RMB A;  4J2B A;  3OGM B;  2LF6 A;  4JS4 A;  3SQ0 A;  4M3U A;  1XVG E;  4M3W A;  3SQ2 A;  1FZ3 E;  4DU3 A;  3E4W A;  3NDK A;  3QEI A;  3N1E A;  1NEX B;  3NAE A;  1IH7 A;  4ICG C;  3L8B A;  3SPY A;  5IZ7 A;  1FZ9 E;  4FVM A;  3UO2 A;  1JW2 A;  2MW2 A;  2P1P B;  3SUN A;  2P1M B;  1CLQ A;  2YB5 A;  3QNO A;  3L2O B;  1XU5 E;  1FZ2 E;  3S9H A;  4DTJ A;  2RKH A;  3QEX A;  4EP9 A;  3C95 A;  3SUP A;  4FJ8 A;  3LDS A;  3QER A;  4KHY A;  2JPN A;  4ADO A;  4JRQ A;  4DTU A;  3C6P B;  3WSO A;  3TAE A;  4DTN A;  3UO3 A;  4HCB A;  1MHZ G;  4DTR A;  4KHQ A;  1FS1 A;  4KHW A;  3HGL A;  3LZJ A;  3RMD A;  3UIQ A;  4KHN A;  4M45 A;  3SQ4 A;  4FJG A;  3SQ1 A;  2E32 A;  2P1Q B;  1Q9Y A;  4KI6 A;  2DY4 A;  1Q9X A;  3RWU A;  3K2O A;  3LDB A;  1XU3 E;  3J2P A;  3KD1 E;  3N1B A;  3NHG A;  3C6O B;  4FJJ A;  2FYO A;  2PFT A;  4DTP A;  3SI6 A;  3OGK B;  4FJX A;  1XVD E;  3OGL B;  3NCI A;  4DTS A;  3RMC A;  1XVC E;  4DTO A;  3QEW A;  3SCX A;  2P5G A;  4J2E A;  2DTU A;  1FZ0 E;  1FZI E;  4EPH A;  4M3Y A;  4RNG A;  3BVO A;  1IG9 A;  4X5M A;  2JH8 A;  4FJ7 A;  3TAB A;  3NGI A;  3J27 A;  4DU4 A;  2K5S A;  2P1N B;  4KI4 A;  3LZI A;  4DTX A;  4AKH A;  2JHC A;  4B08 A;  1MTY G;  4FJN A;  3C94 A;  4X5N A;  2JQT A;  4IT5 A;  1MMO G;  4FJL A;  2OVR B;  2B7M A;  4QNC A;  4JS5 A;  3SUQ A;  4AI6 A;  1XMH E;  1FPO A;  4AKG A;  1XL3 C;  2P1O B;  3HGK E;  3NE6 A;  5IBK B;  3CQ8 A;  3QES A;  2VJ5 A;  2OVQ B;  2OZM A;  1FZ6 E;  1WAJ A;  3QET A;  3TAG A;  3SJJ A;  2OZS A;  4ADN A;  4FJI A;  1MHY G;  2JHP A;  4M3X A;  2OVP B;  2B1E A;  2H4T A; 
#chains in the Genus database with same CATH homology
 3QEV A;  1WAF A;  1FZH E;  2B8I A;  4M3Z A;  4J2A A;  4FK2 A;  1FZ1 E;  2HD0 A;  1LDK E;  2MZW B;  2QXF A;  3SUO A;  3SNN A;  4KHS A;  4I9Q A;  4M41 A;  3QEP A;  4E3S A;  4E4B A;  4I9L A;  1XMF E;  1P22 A;  3QNN A;  2E31 A;  4FK4 A;  2DEB A;  3HP9 A;  4RL5 A;  2JHA A;  3LD8 A;  4FJK A;  3L1N A;  5H37 A;  4AKI A;  3C6N B;  2OYQ A;  3CFP A;  4I6J B;  4DTM A;  4J2D A;  2LF3 A;  1XVF E;  3CFR A;  4FJH A;  1FZ7 E;  4M3R A;  1XVB E;  4DU1 A;  1FZ5 E;  3TAF A;  1FYZ E;  3TL8 B;  3RMA A;  2MMB A;  4EYW A;  2P5O A;  2JH9 A;  4KHU A;  4RG8 A;  3SVI A;  3V7D B;  2ATQ A;  3TJY A;  1FZ8 E;  4FJ5 A;  2VIX A;  4QND A;  3KD5 E;  1XMG E;  3CFO A;  4M42 A;  1FXX A;  2VJ4 A;  3L0M A;  1FZ4 E;  4FK0 A;  1XVE E;  3MKS B;  2RCU A;  4FJ9 A;  3HL8 A;  2PFV A;  4M3T A;  5IRE A;  4FJM A;  2FW3 A;  4GAM C;  3SPZ A;  4JRP A;  4HCC A;  3E4Y A;  3RMB A;  4J2B A;  3OGM B;  2LF6 A;  4JS4 A;  3SQ0 A;  4M3U A;  1XVG E;  4M3W A;  3SQ2 A;  1FZ3 E;  4DU3 A;  3E4W A;  3NDK A;  3QEI A;  3N1E A;  1NEX B;  3NAE A;  1IH7 A;  3L8B A;  3SPY A;  5IZ7 A;  1FZ9 E;  4FVM A;  2P1P B;  3SUN A;  2P1M B;  1CLQ A;  2YB5 A;  3QNO A;  3L2O B;  1XU5 E;  1FZ2 E;  3S9H A;  4DTJ A;  3QEX A;  4EP9 A;  3C95 A;  3SUP A;  4FJ8 A;  3LDS A;  3QER A;  4KHY A;  2JPN A;  4ADO A;  4JRQ A;  4DTU A;  3C6P B;  3WSO A;  3TAE A;  4DTN A;  4HCB A;  1MHZ G;  4DTR A;  4KHQ A;  1FS1 A;  4KHW A;  3HGL A;  3LZJ A;  3RMD A;  3UIQ A;  4KHN A;  4M45 A;  3SQ4 A;  4FJG A;  3SQ1 A;  2E32 A;  2P1Q B;  1Q9Y A;  4KI6 A;  2DY4 A;  1Q9X A;  3RWU A;  3K2O A;  3LDB A;  1XU3 E;  3J2P A;  3KD1 E;  3N1B A;  3NHG A;  3C6O B;  4FJJ A;  2FYO A;  2PFT A;  4DTP A;  3SI6 A;  3OGK B;  4FJX A;  1XVD E;  3OGL B;  3NCI A;  4DTS A;  3RMC A;  1XVC E;  4DTO A;  3QEW A;  3SCX A;  2P5G A;  4J2E A;  2DTU A;  1FZ0 E;  1FZI E;  4EPH A;  4M3Y A;  4RNG A;  1IG9 A;  4X5M A;  2JH8 A;  4FJ7 A;  3TAB A;  3NGI A;  3J27 A;  4DU4 A;  2P1N B;  4KI4 A;  3LZI A;  4DTX A;  4AKH A;  2JHC A;  4B08 A;  1MTY G;  4FJN A;  3C94 A;  4X5N A;  1MMO G;  4FJL A;  2OVR B;  2B7M A;  4QNC A;  4JS5 A;  3SUQ A;  4AI6 A;  1XMH E;  4AKG A;  1XL3 C;  2P1O B;  3HGK E;  3NE6 A;  5IBK B;  3CQ8 A;  3QES A;  2VJ5 A;  2OVQ B;  2OZM A;  1FZ6 E;  1WAJ A;  3QET A;  3TAG A;  3SJJ A;  2OZS A;  4ADN A;  4FJI A;  1MHY G;  2JHP A;  4M3X A;  2OVP B;  2B1E A;  2H4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...