1FZ8E

Methane monooxygenase hydroxylase, form ii cocrystallized with dibromomethane
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
167
structure length
167
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz8E02
1MTYG 1XVDE 1XU5E 1XMHE 1FZ2E 1FZ9E 4GAMC 1FYZE 1XVEE 1FZ1E 1FZHE 1FZ7E 1FZ4E 1XMGE 1XU3E 1XVCE 1FZ3E 1XVFE 1XVGE 1FZIE 1FZ5E 1FZ6E 1MHYG 1FZ8E 1MMOG 1XVBE 1MHZG 1XMFE 1FZ0E
chains in the Genus database with same CATH superfamily
1MTYG 2OYQA 4M3UA 2ATQA 1XU5E 1XMHE 4FJMA 4KI4A 4FVMA 1CLQA 3QETA 4RNGA 3SQ1A 1FZ2E 3LZJA 3SQ2A 2DEBA 3SUQA 3N1EA 1FZ9E 4GAMC 1P22A 3QERA 3TAEA 4B08A 4DU1A 2OZSA 3SUNA 2VIXA 1XMGE 1XU3E 3LD8A 1FZ3E 4JRPA 4X5NA 4DTUA 4KHYA 3HP9A 3J2PA 4I9QA 2OVRB 4I6JB 2MW2A 3QEVA 1FXXA 4E3SA 4AKHA 4KHWA 2P1QB 2VJ4A 3SPYA 2P5OA 3OGLB 3MKSB 4DTJA 3CFOA 3CQ8A 1XMFE 1FZ0E 4M45A 4KHSA 3QEWA 3QEXA 4EP9A 3TJYA 4QNDA 1IG9A 3C95A 3HGKE 3RMAA 5IREA 4M3YA 2P1NB 4FJGA 4EYWA 2RCUA 2JHPA 3RWUA 2PFVA 1IH7A 2QXFA 4J2EA 3NDKA 4J2AA 2JHCA 4DTNA 1FYZE 1XVEE 2P1OB 2YB5A 5H37A 4FJ9A 3SPZA 4FJ5A 3C94A 1XVGE 1Q9YA 4M41A 3RMDA 4FJ7A 3S9HA 3L8BA 3KD5E 1FZIE 3SI6A 1LDKE 3KD1E 2FW3A 4M3ZA 3QEIA 4AKIA 3RMBA 2E32A 2B8IA 2JH9A 4RG8A 1XVBE 3NAEA 4DTSA 4DTOA 3N1BA 5IZ7A 4J2BA 1MHZG 2MZWB 4IT5A 1FPOA 4FK4A 3E4WA 4DU3A 3CFRA 3C6OB 4FJ8A 3SQ0A 1WAJA 4E4BA 3TABA 4KHNA 3OGMB 3UO2A 4M3WA 3OGKB 2LF6A 4FK2A 4HCCA 3SJJA 3QEPA 2JPNA 4AI6A 3NE6A 3TL8B 1FZ1E 2H4TA 4HCBA 1FZ7E 1FZ4E 3LZIA 4KI6A 3BVOA 2JQTA 3HL8A 4ICGC 2PFTA 4KHQA 3SVIA 3L2OB 1WAFA 3CFPA 2B7MA 2OZMA 1XL3C 3V7DB 3LDSA 4KHUA 1FZ5E 3C6NB 3C6PB 1MHYG 4AKGA 2DY4A 4DTXA 4ADOA 3L1NA 2P1MB 4JS5A 2MMBA 4JRQA 4FJKA 3SUOA 3HGLA 2DTUA 2LF3A 3UO3A 4JS4A 3WSOA 4FJJA 2B1EA 1N1CA 2HD0A 4X5MA 4DTRA 4FJLA 1XVDE 1NEXB 2K5SA 3NHGA 3TAGA 3LDBA 4ADNA 3SNNA 1JW2A 3K2OA 1FS1A 4M42A 4DTPA 3QNNA 3SUPA 2P1PB 4FJXA 3SQ4A 1Q9XA 1FZHE 1XVCE 2OVPB 4I9LA 2FYOA 4M3RA 1XVFE 2RKHA 3J27A 3TAFA 4FJNA 4FK0A 3L0MA 3QNOA 3RMCA 2P5GA 4RL5A 1FZ6E 4FJHA 4DTMA 4FJIA 4DU4A 3SCXA 3E4YA 2E31A 1FZ8E 3NGIA 1MMOG 4EPHA 3NCIA 2OVQB 5IBKB 3QESA 4M3XA 3UIQA 4M3TA 4J2DA 2JH8A 4QNCA 2JHAA 2VJ5A
chains in the Genus database with same CATH topology
1MTYG 2OYQA 4M3UA 2ATQA 1XU5E 1XMHE 4FJMA 4KI4A 4FVMA 1CLQA 3QETA 4RNGA 3SQ1A 1FZ2E 3LZJA 3SQ2A 2DEBA 3SUQA 3N1EA 1FZ9E 4GAMC 1P22A 3QERA 3TAEA 4B08A 4DU1A 2OZSA 3SUNA 2VIXA 1XMGE 1XU3E 3LD8A 1FZ3E 4JRPA 4X5NA 4DTUA 4KHYA 3HP9A 3J2PA 4I9QA 2OVRB 4I6JB 3QEVA 1FXXA 4E3SA 4AKHA 4KHWA 2P1QB 2VJ4A 3SPYA 2P5OA 3OGLB 3MKSB 4DTJA 3CFOA 3CQ8A 1XMFE 1FZ0E 4M45A 4KHSA 3QEWA 3QEXA 4EP9A 3TJYA 4QNDA 1IG9A 3C95A 3HGKE 3RMAA 5IREA 4M3YA 2P1NB 4FJGA 4EYWA 2RCUA 2JHPA 3RWUA 2PFVA 1IH7A 2QXFA 4J2EA 3NDKA 4J2AA 2JHCA 4DTNA 1FYZE 1XVEE 2P1OB 2YB5A 5H37A 4FJ9A 3SPZA 4FJ5A 3C94A 1XVGE 1Q9YA 4M41A 3RMDA 4FJ7A 3S9HA 3L8BA 3KD5E 1FZIE 3SI6A 1LDKE 3KD1E 2FW3A 4M3ZA 3QEIA 4AKIA 3RMBA 2E32A 2B8IA 2JH9A 4RG8A 1XVBE 3NAEA 4DTSA 4DTOA 3N1BA 5IZ7A 4J2BA 1MHZG 2MZWB 4FK4A 3E4WA 4DU3A 3CFRA 3C6OB 4FJ8A 3SQ0A 1WAJA 4E4BA 3TABA 4KHNA 3OGMB 4M3WA 3OGKB 2LF6A 4FK2A 4HCCA 3SJJA 3QEPA 2JPNA 4AI6A 3NE6A 3TL8B 1FZ1E 2H4TA 4HCBA 1FZ7E 1FZ4E 3LZIA 4KI6A 3HL8A 2PFTA 4KHQA 3SVIA 3L2OB 1WAFA 3CFPA 2B7MA 2OZMA 1XL3C 3V7DB 3LDSA 4KHUA 1FZ5E 3C6NB 3C6PB 1MHYG 4AKGA 2DY4A 4DTXA 4ADOA 3L1NA 2P1MB 4JS5A 2MMBA 4JRQA 4FJKA 3SUOA 3HGLA 2DTUA 2LF3A 4JS4A 3WSOA 4FJJA 2B1EA 2HD0A 4X5MA 4DTRA 4FJLA 1XVDE 1NEXB 3NHGA 3TAGA 3LDBA 4ADNA 3SNNA 3K2OA 1FS1A 4M42A 4DTPA 3QNNA 3SUPA 2P1PB 4FJXA 3SQ4A 1Q9XA 1FZHE 1XVCE 2OVPB 4I9LA 2FYOA 4M3RA 1XVFE 3J27A 3TAFA 4FJNA 4FK0A 3L0MA 3QNOA 3RMCA 2P5GA 4RL5A 1FZ6E 4FJHA 4DTMA 4FJIA 4DU4A 3SCXA 3E4YA 2E31A 1FZ8E 3NGIA 1MMOG 4EPHA 3NCIA 2OVQB 5IBKB 3QESA 4M3XA 3UIQA 4M3TA 4J2DA 2JH8A 4QNCA 2JHAA 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MTY G;  1XVD E;  1XU5 E;  1XMH E;  1FZ2 E;  1FZ9 E;  4GAM C;  1FYZ E;  1XVE E;  1FZ1 E;  1FZH E;  1FZ7 E;  1FZ4 E;  1XMG E;  1XU3 E;  1XVC E;  1FZ3 E;  1XVF E;  1XVG E;  1FZI E;  1FZ5 E;  1FZ6 E;  1MHY G;  1FZ8 E;  1MMO G;  1XVB E;  1MHZ G;  1XMF E;  1FZ0 E; 
#chains in the Genus database with same CATH topology
 1MTY G;  2OYQ A;  4M3U A;  2ATQ A;  1XU5 E;  1XMH E;  4FJM A;  4KI4 A;  4FVM A;  1CLQ A;  3QET A;  4RNG A;  3SQ1 A;  1FZ2 E;  3LZJ A;  3SQ2 A;  2DEB A;  3SUQ A;  3N1E A;  1FZ9 E;  4GAM C;  1P22 A;  3QER A;  3TAE A;  4B08 A;  4DU1 A;  2OZS A;  3SUN A;  2VIX A;  1XMG E;  1XU3 E;  3LD8 A;  1FZ3 E;  4JRP A;  4X5N A;  4DTU A;  4KHY A;  3HP9 A;  3J2P A;  4I9Q A;  2OVR B;  4I6J B;  2MW2 A;  3QEV A;  1FXX A;  4E3S A;  4AKH A;  4KHW A;  2P1Q B;  2VJ4 A;  3SPY A;  2P5O A;  3OGL B;  3MKS B;  4DTJ A;  3CFO A;  3CQ8 A;  1XMF E;  1FZ0 E;  4M45 A;  4KHS A;  3QEW A;  3QEX A;  4EP9 A;  3TJY A;  4QND A;  1IG9 A;  3C95 A;  3HGK E;  3RMA A;  5IRE A;  4M3Y A;  2P1N B;  4FJG A;  4EYW A;  2RCU A;  2JHP A;  3RWU A;  2PFV A;  1IH7 A;  2QXF A;  4J2E A;  3NDK A;  4J2A A;  2JHC A;  4DTN A;  1FYZ E;  1XVE E;  2P1O B;  2YB5 A;  5H37 A;  4FJ9 A;  3SPZ A;  4FJ5 A;  3C94 A;  1XVG E;  1Q9Y A;  4M41 A;  3RMD A;  4FJ7 A;  3S9H A;  3L8B A;  3KD5 E;  1FZI E;  3SI6 A;  1LDK E;  3KD1 E;  2FW3 A;  4M3Z A;  3QEI A;  4AKI A;  3RMB A;  2E32 A;  2B8I A;  2JH9 A;  4RG8 A;  1XVB E;  3NAE A;  4DTS A;  4DTO A;  3N1B A;  5IZ7 A;  4J2B A;  1MHZ G;  2MZW B;  4IT5 A;  1FPO A;  4FK4 A;  3E4W A;  4DU3 A;  3CFR A;  3C6O B;  4FJ8 A;  3SQ0 A;  1WAJ A;  4E4B A;  3TAB A;  4KHN A;  3OGM B;  3UO2 A;  4M3W A;  3OGK B;  2LF6 A;  4FK2 A;  4HCC A;  3SJJ A;  3QEP A;  2JPN A;  4AI6 A;  3NE6 A;  3TL8 B;  1FZ1 E;  2H4T A;  4HCB A;  1FZ7 E;  1FZ4 E;  3LZI A;  4KI6 A;  3BVO A;  2JQT A;  3HL8 A;  4ICG C;  2PFT A;  4KHQ A;  3SVI A;  3L2O B;  1WAF A;  3CFP A;  2B7M A;  2OZM A;  1XL3 C;  3V7D B;  3LDS A;  4KHU A;  1FZ5 E;  3C6N B;  3C6P B;  1MHY G;  4AKG A;  2DY4 A;  4DTX A;  4ADO A;  3L1N A;  2P1M B;  4JS5 A;  2MMB A;  4JRQ A;  4FJK A;  3SUO A;  3HGL A;  2DTU A;  2LF3 A;  3UO3 A;  4JS4 A;  3WSO A;  4FJJ A;  2B1E A;  1N1C A;  2HD0 A;  4X5M A;  4DTR A;  4FJL A;  1XVD E;  1NEX B;  2K5S A;  3NHG A;  3TAG A;  3LDB A;  4ADN A;  3SNN A;  1JW2 A;  3K2O A;  1FS1 A;  4M42 A;  4DTP A;  3QNN A;  3SUP A;  2P1P B;  4FJX A;  3SQ4 A;  1Q9X A;  1FZH E;  1XVC E;  2OVP B;  4I9L A;  2FYO A;  4M3R A;  1XVF E;  2RKH A;  3J27 A;  3TAF A;  4FJN A;  4FK0 A;  3L0M A;  3QNO A;  3RMC A;  2P5G A;  4RL5 A;  1FZ6 E;  4FJH A;  4DTM A;  4FJI A;  4DU4 A;  3SCX A;  3E4Y A;  2E31 A;  1FZ8 E;  3NGI A;  1MMO G;  4EPH A;  3NCI A;  2OVQ B;  5IBK B;  3QES A;  4M3X A;  3UIQ A;  4M3T A;  4J2D A;  2JH8 A;  4QNC A;  2JHA A;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 1MTY G;  2OYQ A;  4M3U A;  2ATQ A;  1XU5 E;  1XMH E;  4FJM A;  4KI4 A;  4FVM A;  1CLQ A;  3QET A;  4RNG A;  3SQ1 A;  1FZ2 E;  3LZJ A;  3SQ2 A;  2DEB A;  3SUQ A;  3N1E A;  1FZ9 E;  4GAM C;  1P22 A;  3QER A;  3TAE A;  4B08 A;  4DU1 A;  2OZS A;  3SUN A;  2VIX A;  1XMG E;  1XU3 E;  3LD8 A;  1FZ3 E;  4JRP A;  4X5N A;  4DTU A;  4KHY A;  3HP9 A;  3J2P A;  4I9Q A;  2OVR B;  4I6J B;  3QEV A;  1FXX A;  4E3S A;  4AKH A;  4KHW A;  2P1Q B;  2VJ4 A;  3SPY A;  2P5O A;  3OGL B;  3MKS B;  4DTJ A;  3CFO A;  3CQ8 A;  1XMF E;  1FZ0 E;  4M45 A;  4KHS A;  3QEW A;  3QEX A;  4EP9 A;  3TJY A;  4QND A;  1IG9 A;  3C95 A;  3HGK E;  3RMA A;  5IRE A;  4M3Y A;  2P1N B;  4FJG A;  4EYW A;  2RCU A;  2JHP A;  3RWU A;  2PFV A;  1IH7 A;  2QXF A;  4J2E A;  3NDK A;  4J2A A;  2JHC A;  4DTN A;  1FYZ E;  1XVE E;  2P1O B;  2YB5 A;  5H37 A;  4FJ9 A;  3SPZ A;  4FJ5 A;  3C94 A;  1XVG E;  1Q9Y A;  4M41 A;  3RMD A;  4FJ7 A;  3S9H A;  3L8B A;  3KD5 E;  1FZI E;  3SI6 A;  1LDK E;  3KD1 E;  2FW3 A;  4M3Z A;  3QEI A;  4AKI A;  3RMB A;  2E32 A;  2B8I A;  2JH9 A;  4RG8 A;  1XVB E;  3NAE A;  4DTS A;  4DTO A;  3N1B A;  5IZ7 A;  4J2B A;  1MHZ G;  2MZW B;  4FK4 A;  3E4W A;  4DU3 A;  3CFR A;  3C6O B;  4FJ8 A;  3SQ0 A;  1WAJ A;  4E4B A;  3TAB A;  4KHN A;  3OGM B;  4M3W A;  3OGK B;  2LF6 A;  4FK2 A;  4HCC A;  3SJJ A;  3QEP A;  2JPN A;  4AI6 A;  3NE6 A;  3TL8 B;  1FZ1 E;  2H4T A;  4HCB A;  1FZ7 E;  1FZ4 E;  3LZI A;  4KI6 A;  3HL8 A;  2PFT A;  4KHQ A;  3SVI A;  3L2O B;  1WAF A;  3CFP A;  2B7M A;  2OZM A;  1XL3 C;  3V7D B;  3LDS A;  4KHU A;  1FZ5 E;  3C6N B;  3C6P B;  1MHY G;  4AKG A;  2DY4 A;  4DTX A;  4ADO A;  3L1N A;  2P1M B;  4JS5 A;  2MMB A;  4JRQ A;  4FJK A;  3SUO A;  3HGL A;  2DTU A;  2LF3 A;  4JS4 A;  3WSO A;  4FJJ A;  2B1E A;  2HD0 A;  4X5M A;  4DTR A;  4FJL A;  1XVD E;  1NEX B;  3NHG A;  3TAG A;  3LDB A;  4ADN A;  3SNN A;  3K2O A;  1FS1 A;  4M42 A;  4DTP A;  3QNN A;  3SUP A;  2P1P B;  4FJX A;  3SQ4 A;  1Q9X A;  1FZH E;  1XVC E;  2OVP B;  4I9L A;  2FYO A;  4M3R A;  1XVF E;  3J27 A;  3TAF A;  4FJN A;  4FK0 A;  3L0M A;  3QNO A;  3RMC A;  2P5G A;  4RL5 A;  1FZ6 E;  4FJH A;  4DTM A;  4FJI A;  4DU4 A;  3SCX A;  3E4Y A;  2E31 A;  1FZ8 E;  3NGI A;  1MMO G;  4EPH A;  3NCI A;  2OVQ B;  5IBK B;  3QES A;  4M3X A;  3UIQ A;  4M3T A;  4J2D A;  2JH8 A;  4QNC A;  2JHA A;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...