1FZ9E

Methane monooxygenase hydroxylase, form ii cocrystallized with iodoethane
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 60
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz9E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz9E02
1XMHE 1XMFE 1FZ8E 1FZ5E 1XVDE 4GAMC 1XVFE 1MMOG 1XU5E 1FZ0E 1FZ6E 1FZ3E 1FZ1E 1MTYG 1FZHE 1XU3E 1FZ4E 1FZ7E 1XMGE 1FZ9E 1XVCE 1XVEE 1FZ2E 1MHYG 1FZIE 1XVBE 1FYZE 1MHZG 1XVGE
chains in the Genus database with same CATH superfamily
1FPOA 2PFTA 1N1CA 1XL3C 3LD8A 1XMHE 3SUQA 3LDBA 3OGMB 4M41A 3KD1E 2OVQB 1XVDE 4ICGC 1XVFE 4M3RA 4DU4A 3HGLA 3HP9A 4DTSA 4M45A 3NCIA 4KHYA 3J27A 4QNDA 4X5NA 4HCCA 4JRQA 4FJ9A 4KI6A 1FZ1E 3QNNA 2OZSA 1XU3E 3C6NB 4J2AA 2P1PB 4QNCA 3E4YA 4KHSA 2DEBA 3TAFA 1FS1A 3L0MA 4DTNA 4FVMA 2E32A 3SI6A 3QEXA 3SPZA 2JHPA 4FJ5A 3OGLB 5H37A 4DTXA 1WAJA 2PFVA 2FYOA 3UO2A 3NGIA 2RKHA 1FZIE 5IREA 2MW2A 1CLQA 2OVPB 3CQ8A 3NAEA 1XVGE 3SQ1A 4FJKA 4FJGA 2P1OB 3C95A 3QETA 3SQ2A 4E4BA 4DU3A 1IG9A 3SCXA 4FK0A 3RMAA 3SVIA 3L2OB 2JPNA 1XU5E 1FZ0E 3K2OA 3L8BA 2OVRB 3TABA 3QEVA 4JS5A 4KHUA 5IBKB 1MTYG 4IT5A 2JH8A 2OZMA 3WSOA 2MMBA 3SQ0A 3HL8A 1FZ4E 1NEXB 2E31A 4FJ7A 1FZ7E 4J2DA 4JS4A 3KD5E 1P22A 2B8IA 1FXXA 1XVCE 2VIXA 3BVOA 4I9LA 3QESA 3SQ4A 1WAFA 3UO3A 4FJNA 1IH7A 3QEPA 1FZ2E 2DY4A 4RG8A 1XVBE 3NDKA 3LZIA 4FJLA 2LF6A 4J2BA 4I6JB 3NHGA 2DTUA 3HGKE 2HD0A 4I9QA 4M42A 3RWUA 2FW3A 4EYWA 4DTRA 1FZ8E 3QERA 4B08A 4M3WA 2RCUA 3E4WA 4KI4A 4FK4A 4AKGA 2OYQA 1LDKE 3NE6A 4GAMC 1MMOG 2P1NB 3N1BA 1FZ6E 3SUPA 3V7DB 1FZ3E 4M3ZA 2LF3A 4FJIA 2P5GA 1FZHE 3SUNA 3J2PA 4FJHA 3TL8B 4RL5A 4M3YA 4FJ8A 4M3UA 4M3XA 1XMGE 4AKHA 4ADOA 4X5MA 3LZJA 4FJXA 4EP9A 4E3SA 4DTOA 3SNNA 1MHYG 4AKIA 2MZWB 2H4TA 3L1NA 4DTMA 3TAEA 3S9HA 1MHZG 4AI6A 2B7MA 2JHAA 3C6PB 3QEIA 4DU1A 4DTUA 1XMFE 2VJ5A 3N1EA 4EPHA 4FJMA 4JRPA 3CFPA 2P5OA 1FZ5E 3MKSB 3SJJA 3UIQA 3TAGA 3C6OB 1Q9XA 4HCBA 4FK2A 4M3TA 2P1QB 3RMCA 4FJJA 4KHNA 4J2EA 2B1EA 3SUOA 3TJYA 4RNGA 4DTPA 2QXFA 2VJ4A 3OGKB 3RMDA 3QEWA 3QNOA 3SPYA 2P1MB 3CFOA 3LDSA 2JH9A 2JHCA 5IZ7A 1Q9YA 4KHWA 1FZ9E 2YB5A 3RMBA 4DTJA 3CFRA 2K5SA 1XVEE 2JQTA 4ADNA 4KHQA 3C94A 2ATQA 1JW2A 1FYZE
chains in the Genus database with same CATH topology
2PFTA 1XL3C 3LD8A 1XMHE 3SUQA 3LDBA 3OGMB 4M41A 3KD1E 2OVQB 1XVDE 4M3RA 1XVFE 4DTSA 4DU4A 3HGLA 3HP9A 4M45A 3NCIA 4KHYA 3J27A 4QNDA 4X5NA 4HCCA 4JRQA 4FJ9A 4KI6A 1FZ1E 3QNNA 2OZSA 1XU3E 3C6NB 4J2AA 2P1PB 4QNCA 3E4YA 4KHSA 2DEBA 3TAFA 1FS1A 3L0MA 4DTNA 4FVMA 2E32A 3SI6A 3QEXA 3SPZA 2JHPA 4FJ5A 3OGLB 5H37A 4DTXA 1WAJA 2PFVA 2FYOA 3NGIA 1FZIE 5IREA 1CLQA 2OVPB 3CQ8A 3NAEA 1XVGE 3SQ1A 4FJKA 4FJGA 2P1OB 3C95A 3QETA 3SQ2A 4E4BA 4DU3A 1IG9A 3SCXA 4FK0A 3RMAA 3SVIA 3L2OB 2JPNA 1XU5E 1FZ0E 3K2OA 3L8BA 2OVRB 3TABA 3QEVA 4JS5A 4KHUA 5IBKB 1MTYG 2JH8A 2OZMA 3WSOA 2MMBA 3SQ0A 3HL8A 1FZ4E 1NEXB 2E31A 4FJ7A 1FZ7E 4J2DA 4JS4A 3KD5E 1P22A 2B8IA 1FXXA 1XVCE 2VIXA 3QESA 4I9LA 3SQ4A 1WAFA 4FJNA 2DY4A 1IH7A 3QEPA 1FZ2E 4RG8A 1XVBE 3NDKA 3LZIA 4FJLA 2LF6A 4J2BA 4I6JB 3NHGA 2DTUA 3HGKE 2HD0A 4I9QA 4M42A 3RWUA 2FW3A 4EYWA 4DTRA 1FZ8E 3QERA 4B08A 4M3WA 2RCUA 3E4WA 4KI4A 4FK4A 4AKGA 2OYQA 1LDKE 3NE6A 4GAMC 1MMOG 2P1NB 3N1BA 1FZ6E 3SUPA 3V7DB 1FZ3E 4M3ZA 2LF3A 4FJIA 2P5GA 1FZHE 3SUNA 3J2PA 4FJHA 3TL8B 4RL5A 4M3YA 4FJ8A 4M3UA 4M3XA 1XMGE 4AKHA 4ADOA 4X5MA 3LZJA 4FJXA 4EP9A 4E3SA 4DTOA 3SNNA 1MHYG 4AKIA 2MZWB 2H4TA 3L1NA 4DTMA 3TAEA 3S9HA 1MHZG 4AI6A 2B7MA 2JHAA 3C6PB 3QEIA 4DU1A 4DTUA 1XMFE 2VJ5A 3N1EA 4EPHA 4FJMA 4JRPA 3CFPA 2P5OA 1FZ5E 3MKSB 3SJJA 3UIQA 3TAGA 3C6OB 1Q9XA 4HCBA 4FK2A 4M3TA 2P1QB 3RMCA 4FJJA 4KHNA 4J2EA 2B1EA 3SUOA 3TJYA 4RNGA 4DTPA 2QXFA 2VJ4A 3OGKB 3RMDA 3QEWA 3QNOA 3SPYA 2P1MB 3CFOA 3LDSA 2JH9A 2JHCA 5IZ7A 1Q9YA 4KHWA 1FZ9E 2YB5A 3RMBA 4DTJA 3CFRA 1XVEE 4KHQA 4ADNA 3C94A 2ATQA 1FYZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMH E;  1XMF E;  1FZ8 E;  1FZ5 E;  1XVD E;  4GAM C;  1XVF E;  1MMO G;  1XU5 E;  1FZ0 E;  1FZ6 E;  1FZ3 E;  1FZ1 E;  1MTY G;  1FZH E;  1XU3 E;  1FZ4 E;  1FZ7 E;  1XMG E;  1FZ9 E;  1XVC E;  1XVE E;  1FZ2 E;  1MHY G;  1FZI E;  1XVB E;  1FYZ E;  1MHZ G;  1XVG E; 
#chains in the Genus database with same CATH topology
 1FPO A;  2PFT A;  1N1C A;  1XL3 C;  3LD8 A;  1XMH E;  3SUQ A;  3LDB A;  3OGM B;  4M41 A;  3KD1 E;  2OVQ B;  1XVD E;  4ICG C;  1XVF E;  4M3R A;  4DU4 A;  3HGL A;  3HP9 A;  4DTS A;  4M45 A;  3NCI A;  4KHY A;  3J27 A;  4QND A;  4X5N A;  4HCC A;  4JRQ A;  4FJ9 A;  4KI6 A;  1FZ1 E;  3QNN A;  2OZS A;  1XU3 E;  3C6N B;  4J2A A;  2P1P B;  4QNC A;  3E4Y A;  4KHS A;  2DEB A;  3TAF A;  1FS1 A;  3L0M A;  4DTN A;  4FVM A;  2E32 A;  3SI6 A;  3QEX A;  3SPZ A;  2JHP A;  4FJ5 A;  3OGL B;  5H37 A;  4DTX A;  1WAJ A;  2PFV A;  2FYO A;  3UO2 A;  3NGI A;  2RKH A;  1FZI E;  5IRE A;  2MW2 A;  1CLQ A;  2OVP B;  3CQ8 A;  3NAE A;  1XVG E;  3SQ1 A;  4FJK A;  4FJG A;  2P1O B;  3C95 A;  3QET A;  3SQ2 A;  4E4B A;  4DU3 A;  1IG9 A;  3SCX A;  4FK0 A;  3RMA A;  3SVI A;  3L2O B;  2JPN A;  1XU5 E;  1FZ0 E;  3K2O A;  3L8B A;  2OVR B;  3TAB A;  3QEV A;  4JS5 A;  4KHU A;  5IBK B;  1MTY G;  4IT5 A;  2JH8 A;  2OZM A;  3WSO A;  2MMB A;  3SQ0 A;  3HL8 A;  1FZ4 E;  1NEX B;  2E31 A;  4FJ7 A;  1FZ7 E;  4J2D A;  4JS4 A;  3KD5 E;  1P22 A;  2B8I A;  1FXX A;  1XVC E;  2VIX A;  3BVO A;  4I9L A;  3QES A;  3SQ4 A;  1WAF A;  3UO3 A;  4FJN A;  1IH7 A;  3QEP A;  1FZ2 E;  2DY4 A;  4RG8 A;  1XVB E;  3NDK A;  3LZI A;  4FJL A;  2LF6 A;  4J2B A;  4I6J B;  3NHG A;  2DTU A;  3HGK E;  2HD0 A;  4I9Q A;  4M42 A;  3RWU A;  2FW3 A;  4EYW A;  4DTR A;  1FZ8 E;  3QER A;  4B08 A;  4M3W A;  2RCU A;  3E4W A;  4KI4 A;  4FK4 A;  4AKG A;  2OYQ A;  1LDK E;  3NE6 A;  4GAM C;  1MMO G;  2P1N B;  3N1B A;  1FZ6 E;  3SUP A;  3V7D B;  1FZ3 E;  4M3Z A;  2LF3 A;  4FJI A;  2P5G A;  1FZH E;  3SUN A;  3J2P A;  4FJH A;  3TL8 B;  4RL5 A;  4M3Y A;  4FJ8 A;  4M3U A;  4M3X A;  1XMG E;  4AKH A;  4ADO A;  4X5M A;  3LZJ A;  4FJX A;  4EP9 A;  4E3S A;  4DTO A;  3SNN A;  1MHY G;  4AKI A;  2MZW B;  2H4T A;  3L1N A;  4DTM A;  3TAE A;  3S9H A;  1MHZ G;  4AI6 A;  2B7M A;  2JHA A;  3C6P B;  3QEI A;  4DU1 A;  4DTU A;  1XMF E;  2VJ5 A;  3N1E A;  4EPH A;  4FJM A;  4JRP A;  3CFP A;  2P5O A;  1FZ5 E;  3MKS B;  3SJJ A;  3UIQ A;  3TAG A;  3C6O B;  1Q9X A;  4HCB A;  4FK2 A;  4M3T A;  2P1Q B;  3RMC A;  4FJJ A;  4KHN A;  4J2E A;  2B1E A;  3SUO A;  3TJY A;  4RNG A;  4DTP A;  2QXF A;  2VJ4 A;  3OGK B;  3RMD A;  3QEW A;  3QNO A;  3SPY A;  2P1M B;  3CFO A;  3LDS A;  2JH9 A;  2JHC A;  5IZ7 A;  1Q9Y A;  4KHW A;  1FZ9 E;  2YB5 A;  3RMB A;  4DTJ A;  3CFR A;  2K5S A;  1XVE E;  2JQT A;  4ADN A;  4KHQ A;  3C94 A;  2ATQ A;  1JW2 A;  1FYZ E; 
#chains in the Genus database with same CATH homology
 2PFT A;  1XL3 C;  3LD8 A;  1XMH E;  3SUQ A;  3LDB A;  3OGM B;  4M41 A;  3KD1 E;  2OVQ B;  1XVD E;  4M3R A;  1XVF E;  4DTS A;  4DU4 A;  3HGL A;  3HP9 A;  4M45 A;  3NCI A;  4KHY A;  3J27 A;  4QND A;  4X5N A;  4HCC A;  4JRQ A;  4FJ9 A;  4KI6 A;  1FZ1 E;  3QNN A;  2OZS A;  1XU3 E;  3C6N B;  4J2A A;  2P1P B;  4QNC A;  3E4Y A;  4KHS A;  2DEB A;  3TAF A;  1FS1 A;  3L0M A;  4DTN A;  4FVM A;  2E32 A;  3SI6 A;  3QEX A;  3SPZ A;  2JHP A;  4FJ5 A;  3OGL B;  5H37 A;  4DTX A;  1WAJ A;  2PFV A;  2FYO A;  3NGI A;  1FZI E;  5IRE A;  1CLQ A;  2OVP B;  3CQ8 A;  3NAE A;  1XVG E;  3SQ1 A;  4FJK A;  4FJG A;  2P1O B;  3C95 A;  3QET A;  3SQ2 A;  4E4B A;  4DU3 A;  1IG9 A;  3SCX A;  4FK0 A;  3RMA A;  3SVI A;  3L2O B;  2JPN A;  1XU5 E;  1FZ0 E;  3K2O A;  3L8B A;  2OVR B;  3TAB A;  3QEV A;  4JS5 A;  4KHU A;  5IBK B;  1MTY G;  2JH8 A;  2OZM A;  3WSO A;  2MMB A;  3SQ0 A;  3HL8 A;  1FZ4 E;  1NEX B;  2E31 A;  4FJ7 A;  1FZ7 E;  4J2D A;  4JS4 A;  3KD5 E;  1P22 A;  2B8I A;  1FXX A;  1XVC E;  2VIX A;  3QES A;  4I9L A;  3SQ4 A;  1WAF A;  4FJN A;  2DY4 A;  1IH7 A;  3QEP A;  1FZ2 E;  4RG8 A;  1XVB E;  3NDK A;  3LZI A;  4FJL A;  2LF6 A;  4J2B A;  4I6J B;  3NHG A;  2DTU A;  3HGK E;  2HD0 A;  4I9Q A;  4M42 A;  3RWU A;  2FW3 A;  4EYW A;  4DTR A;  1FZ8 E;  3QER A;  4B08 A;  4M3W A;  2RCU A;  3E4W A;  4KI4 A;  4FK4 A;  4AKG A;  2OYQ A;  1LDK E;  3NE6 A;  4GAM C;  1MMO G;  2P1N B;  3N1B A;  1FZ6 E;  3SUP A;  3V7D B;  1FZ3 E;  4M3Z A;  2LF3 A;  4FJI A;  2P5G A;  1FZH E;  3SUN A;  3J2P A;  4FJH A;  3TL8 B;  4RL5 A;  4M3Y A;  4FJ8 A;  4M3U A;  4M3X A;  1XMG E;  4AKH A;  4ADO A;  4X5M A;  3LZJ A;  4FJX A;  4EP9 A;  4E3S A;  4DTO A;  3SNN A;  1MHY G;  4AKI A;  2MZW B;  2H4T A;  3L1N A;  4DTM A;  3TAE A;  3S9H A;  1MHZ G;  4AI6 A;  2B7M A;  2JHA A;  3C6P B;  3QEI A;  4DU1 A;  4DTU A;  1XMF E;  2VJ5 A;  3N1E A;  4EPH A;  4FJM A;  4JRP A;  3CFP A;  2P5O A;  1FZ5 E;  3MKS B;  3SJJ A;  3UIQ A;  3TAG A;  3C6O B;  1Q9X A;  4HCB A;  4FK2 A;  4M3T A;  2P1Q B;  3RMC A;  4FJJ A;  4KHN A;  4J2E A;  2B1E A;  3SUO A;  3TJY A;  4RNG A;  4DTP A;  2QXF A;  2VJ4 A;  3OGK B;  3RMD A;  3QEW A;  3QNO A;  3SPY A;  2P1M B;  3CFO A;  3LDS A;  2JH9 A;  2JHC A;  5IZ7 A;  1Q9Y A;  4KHW A;  1FZ9 E;  2YB5 A;  3RMB A;  4DTJ A;  3CFR A;  1XVE E;  4KHQ A;  4ADN A;  3C94 A;  2ATQ A;  1FYZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...