1FZ9E

Methane monooxygenase hydroxylase, form ii cocrystallized with iodoethane
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 60
structure length 167
sequence length 167
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz9E01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fz9E02
1FYZE 1XMFE 1FZ9E 1FZ4E 1MHYG 1MTYG 1FZ3E 1FZ5E 1XVBE 1MHZG 1XU5E 1FZ1E 1MMOG 1FZIE 1FZ6E 1FZHE 4GAMC 1XMGE 1XU3E 1XVCE 1FZ2E 1XVEE 1XMHE 1FZ8E 1XVDE 1FZ0E 1XVGE 1FZ7E 1XVFE
chains in the Genus database with same CATH superfamily
4AKHA 4M3YA 4FVMA 3L0MA 4FJLA 2FW3A 2OVPB 2P1QB 2K5SA 5H37A 4FJGA 3S9HA 3RWUA 4X5MA 3QNNA 2P5OA 3C95A 3OGKB 4IT5A 2JH8A 4RNGA 3J2PA 1XU5E 4EPHA 4DTXA 2VIXA 3RMBA 1FZ6E 2DTUA 2OVRB 3SI6A 4KHNA 3N1EA 1FXXA 3OGLB 3NCIA 1XVCE 4M3RA 3SUOA 4ADOA 1FZ2E 4FK0A 4M3WA 3CFOA 3V7DB 4J2BA 3TAGA 4JRQA 1XVDE 1FZ0E 4QNDA 3J27A 1FZ7E 2P1PB 1XVFE 4RL5A 2VJ5A 2LF6A 4DTSA 1FZ9E 3TJYA 3UO3A 1FPOA 3L2OB 3SQ1A 4FJ5A 3C6OB 1MHYG 3TABA 2OZMA 1MTYG 2H4TA 2P1OB 3KD1E 2JPNA 2MZWB 2MW2A 1IG9A 4FJXA 1XVBE 4KHYA 1IH7A 4M41A 2PFTA 4DTUA 1MHZG 1FS1A 4DU3A 4AI6A 4B08A 3LD8A 1FZIE 4E4BA 2OZSA 4QNCA 2OYQA 1FZHE 1NEXB 2OVQB 2VJ4A 3QEVA 1Q9YA 4M3TA 4DTRA 3LDBA 2JQTA 3SPZA 1WAJA 4FJJA 4M42A 3QETA 3QERA 4HCBA 1CLQA 1XVGE 5IZ7A 4AKGA 3LZJA 2P5GA 2RKHA 2JHPA 1FYZE 4DTNA 3LZIA 3SVIA 3E4WA 4HCCA 3C94A 1JW2A 1Q9XA 4FJ9A 4JS5A 2ATQA 3MKSB 2E32A 3TAEA 2B8IA 4JS4A 3HL8A 4J2EA 1FZ3E 3QESA 1FZ5E 4J2AA 2P1NB 4DU1A 2QXFA 5IBKB 3RMAA 4DTOA 4FJKA 4FK4A 4DTPA 3C6PB 3CQ8A 3L8BA 3CFPA 3SUPA 4KI4A 1FZ1E 4RG8A 1MMOG 3K2OA 2HD0A 3QEPA 4FJ7A 4M3UA 4DU4A 4J2DA 3SCXA 1XU3E 2RCUA 4KHWA 2JHCA 3LDSA 3TL8B 3NE6A 3C6NB 3NGIA 4DTMA 3QEWA 1N1CA 3SJJA 4FK2A 1XMHE 4E3SA 3SPYA 1FZ8E 3QEXA 2FYOA 2MMBA 4I9LA 4M3XA 3NHGA 3RMCA 4ICGC 4DTJA 3SQ4A 4KI6A 4EYWA 2JH9A 2JHAA 1XL3C 3UIQA 2PFVA 1WAFA 1XMFE 3SQ2A 1FZ4E 3NDKA 3SQ0A 3UO2A 2B1EA 4I6JB 3NAEA 3CFRA 3TAFA 3SUNA 2P1MB 3E4YA 3RMDA 4FJMA 3WSOA 4M3ZA 3SNNA 3HP9A 2DY4A 4ADNA 3OGMB 5IREA 4FJIA 4FJNA 3L1NA 4GAMC 4JRPA 3QEIA 4KHUA 1XMGE 3HGLA 4EP9A 4KHSA 3SUQA 2YB5A 1XVEE 2B7MA 3HGKE 1LDKE 2E31A 2LF3A 4AKIA 4X5NA 3N1BA 3QNOA 3KD5E 4I9QA 3BVOA 1P22A 2DEBA 4FJ8A 4KHQA 4M45A 4FJHA
chains in the Genus database with same CATH topology
4AKHA 4M3YA 4FVMA 3L0MA 4FJLA 2FW3A 2OVPB 2P1QB 4FJGA 5H37A 3S9HA 3RWUA 4X5MA 3QNNA 2P5OA 3C95A 3OGKB 2JH8A 4RNGA 3J2PA 1XU5E 4EPHA 4DTXA 2VIXA 3RMBA 1FZ6E 2DTUA 2OVRB 3SI6A 4KHNA 3N1EA 1FXXA 3OGLB 3NCIA 1XVCE 4M3RA 3SUOA 4ADOA 1FZ2E 4FK0A 4M3WA 3CFOA 3V7DB 4J2BA 3TAGA 4JRQA 1XVDE 1FZ0E 4QNDA 3J27A 1FZ7E 2P1PB 1XVFE 4RL5A 2VJ5A 2LF6A 4DTSA 1FZ9E 3TJYA 3L2OB 3SQ1A 4FJ5A 3C6OB 1MHYG 3TABA 2OZMA 1MTYG 2H4TA 2P1OB 3KD1E 2JPNA 2MZWB 1IG9A 4FJXA 1XVBE 4KHYA 1IH7A 4M41A 2PFTA 4DTUA 1MHZG 1FS1A 4DU3A 4AI6A 4B08A 3LD8A 1FZIE 4E4BA 2OZSA 4QNCA 2OYQA 1FZHE 1NEXB 2OVQB 2VJ4A 3QEVA 1Q9YA 4M3TA 4DTRA 3LDBA 3SPZA 1WAJA 4FJJA 4M42A 3QETA 3QERA 4HCBA 1CLQA 1XVGE 5IZ7A 4AKGA 3LZJA 2P5GA 2JHPA 1FYZE 4DTNA 3LZIA 3SVIA 3E4WA 4HCCA 3C94A 1Q9XA 4FJ9A 4JS5A 2ATQA 3MKSB 2E32A 3TAEA 2B8IA 4JS4A 3HL8A 4J2EA 1FZ3E 3QESA 1FZ5E 4J2AA 2P1NB 4DU1A 2QXFA 5IBKB 3RMAA 4DTOA 4FJKA 4FK4A 4DTPA 3C6PB 3CQ8A 3L8BA 3CFPA 3SUPA 4KI4A 1FZ1E 4RG8A 1MMOG 3K2OA 2HD0A 3QEPA 4FJ7A 4M3UA 4DU4A 4J2DA 3SCXA 1XU3E 2RCUA 4KHWA 2JHCA 3LDSA 3TL8B 3NE6A 3C6NB 3NGIA 4DTMA 3QEWA 3SJJA 4FK2A 1XMHE 4E3SA 3SPYA 1FZ8E 3QEXA 2FYOA 2MMBA 4I9LA 4M3XA 3NHGA 3RMCA 4DTJA 3SQ4A 4KI6A 4EYWA 2JH9A 2JHAA 1XL3C 3UIQA 2PFVA 1WAFA 1XMFE 3SQ2A 1FZ4E 3NDKA 3SQ0A 2B1EA 4I6JB 3NAEA 3CFRA 3TAFA 3SUNA 2P1MB 3E4YA 3RMDA 4FJMA 3WSOA 4M3ZA 3SNNA 3HP9A 2DY4A 4ADNA 3OGMB 5IREA 4FJIA 4FJNA 3L1NA 4GAMC 4JRPA 3QEIA 4KHUA 1XMGE 3HGLA 4EP9A 4KHSA 3SUQA 2YB5A 1XVEE 2B7MA 3HGKE 1LDKE 2E31A 2LF3A 4AKIA 4X5NA 3N1BA 3QNOA 3KD5E 4I9QA 1P22A 2DEBA 4FJ8A 4KHQA 4M45A 4FJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYZ E;  1XMF E;  1FZ9 E;  1FZ4 E;  1MHY G;  1MTY G;  1FZ3 E;  1FZ5 E;  1XVB E;  1MHZ G;  1XU5 E;  1FZ1 E;  1MMO G;  1FZI E;  1FZ6 E;  1FZH E;  4GAM C;  1XMG E;  1XU3 E;  1XVC E;  1FZ2 E;  1XVE E;  1XMH E;  1FZ8 E;  1XVD E;  1FZ0 E;  1XVG E;  1FZ7 E;  1XVF E; 
#chains in the Genus database with same CATH topology
 4AKH A;  4M3Y A;  4FVM A;  3L0M A;  4FJL A;  2FW3 A;  2OVP B;  2P1Q B;  2K5S A;  5H37 A;  4FJG A;  3S9H A;  3RWU A;  4X5M A;  3QNN A;  2P5O A;  3C95 A;  3OGK B;  4IT5 A;  2JH8 A;  4RNG A;  3J2P A;  1XU5 E;  4EPH A;  4DTX A;  2VIX A;  3RMB A;  1FZ6 E;  2DTU A;  2OVR B;  3SI6 A;  4KHN A;  3N1E A;  1FXX A;  3OGL B;  3NCI A;  1XVC E;  4M3R A;  3SUO A;  4ADO A;  1FZ2 E;  4FK0 A;  4M3W A;  3CFO A;  3V7D B;  4J2B A;  3TAG A;  4JRQ A;  1XVD E;  1FZ0 E;  4QND A;  3J27 A;  1FZ7 E;  2P1P B;  1XVF E;  4RL5 A;  2VJ5 A;  2LF6 A;  4DTS A;  1FZ9 E;  3TJY A;  3UO3 A;  1FPO A;  3L2O B;  3SQ1 A;  4FJ5 A;  3C6O B;  1MHY G;  3TAB A;  2OZM A;  1MTY G;  2H4T A;  2P1O B;  3KD1 E;  2JPN A;  2MZW B;  2MW2 A;  1IG9 A;  4FJX A;  1XVB E;  4KHY A;  1IH7 A;  4M41 A;  2PFT A;  4DTU A;  1MHZ G;  1FS1 A;  4DU3 A;  4AI6 A;  4B08 A;  3LD8 A;  1FZI E;  4E4B A;  2OZS A;  4QNC A;  2OYQ A;  1FZH E;  1NEX B;  2OVQ B;  2VJ4 A;  3QEV A;  1Q9Y A;  4M3T A;  4DTR A;  3LDB A;  2JQT A;  3SPZ A;  1WAJ A;  4FJJ A;  4M42 A;  3QET A;  3QER A;  4HCB A;  1CLQ A;  1XVG E;  5IZ7 A;  4AKG A;  3LZJ A;  2P5G A;  2RKH A;  2JHP A;  1FYZ E;  4DTN A;  3LZI A;  3SVI A;  3E4W A;  4HCC A;  3C94 A;  1JW2 A;  1Q9X A;  4FJ9 A;  4JS5 A;  2ATQ A;  3MKS B;  2E32 A;  3TAE A;  2B8I A;  4JS4 A;  3HL8 A;  4J2E A;  1FZ3 E;  3QES A;  1FZ5 E;  4J2A A;  2P1N B;  4DU1 A;  2QXF A;  5IBK B;  3RMA A;  4DTO A;  4FJK A;  4FK4 A;  4DTP A;  3C6P B;  3CQ8 A;  3L8B A;  3CFP A;  3SUP A;  4KI4 A;  1FZ1 E;  4RG8 A;  1MMO G;  3K2O A;  2HD0 A;  3QEP A;  4FJ7 A;  4M3U A;  4DU4 A;  4J2D A;  3SCX A;  1XU3 E;  2RCU A;  4KHW A;  2JHC A;  3LDS A;  3TL8 B;  3NE6 A;  3C6N B;  3NGI A;  4DTM A;  3QEW A;  1N1C A;  3SJJ A;  4FK2 A;  1XMH E;  4E3S A;  3SPY A;  1FZ8 E;  3QEX A;  2FYO A;  2MMB A;  4I9L A;  4M3X A;  3NHG A;  3RMC A;  4ICG C;  4DTJ A;  3SQ4 A;  4KI6 A;  4EYW A;  2JH9 A;  2JHA A;  1XL3 C;  3UIQ A;  2PFV A;  1WAF A;  1XMF E;  3SQ2 A;  1FZ4 E;  3NDK A;  3SQ0 A;  3UO2 A;  2B1E A;  4I6J B;  3NAE A;  3CFR A;  3TAF A;  3SUN A;  2P1M B;  3E4Y A;  3RMD A;  4FJM A;  3WSO A;  4M3Z A;  3SNN A;  3HP9 A;  2DY4 A;  4ADN A;  3OGM B;  5IRE A;  4FJI A;  4FJN A;  3L1N A;  4GAM C;  4JRP A;  3QEI A;  4KHU A;  1XMG E;  3HGL A;  4EP9 A;  4KHS A;  3SUQ A;  2YB5 A;  1XVE E;  2B7M A;  3HGK E;  1LDK E;  2E31 A;  2LF3 A;  4AKI A;  4X5N A;  3N1B A;  3QNO A;  3KD5 E;  4I9Q A;  3BVO A;  1P22 A;  2DEB A;  4FJ8 A;  4KHQ A;  4M45 A;  4FJH A; 
#chains in the Genus database with same CATH homology
 4AKH A;  4M3Y A;  4FVM A;  3L0M A;  4FJL A;  2FW3 A;  2OVP B;  2P1Q B;  4FJG A;  5H37 A;  3S9H A;  3RWU A;  4X5M A;  3QNN A;  2P5O A;  3C95 A;  3OGK B;  2JH8 A;  4RNG A;  3J2P A;  1XU5 E;  4EPH A;  4DTX A;  2VIX A;  3RMB A;  1FZ6 E;  2DTU A;  2OVR B;  3SI6 A;  4KHN A;  3N1E A;  1FXX A;  3OGL B;  3NCI A;  1XVC E;  4M3R A;  3SUO A;  4ADO A;  1FZ2 E;  4FK0 A;  4M3W A;  3CFO A;  3V7D B;  4J2B A;  3TAG A;  4JRQ A;  1XVD E;  1FZ0 E;  4QND A;  3J27 A;  1FZ7 E;  2P1P B;  1XVF E;  4RL5 A;  2VJ5 A;  2LF6 A;  4DTS A;  1FZ9 E;  3TJY A;  3L2O B;  3SQ1 A;  4FJ5 A;  3C6O B;  1MHY G;  3TAB A;  2OZM A;  1MTY G;  2H4T A;  2P1O B;  3KD1 E;  2JPN A;  2MZW B;  1IG9 A;  4FJX A;  1XVB E;  4KHY A;  1IH7 A;  4M41 A;  2PFT A;  4DTU A;  1MHZ G;  1FS1 A;  4DU3 A;  4AI6 A;  4B08 A;  3LD8 A;  1FZI E;  4E4B A;  2OZS A;  4QNC A;  2OYQ A;  1FZH E;  1NEX B;  2OVQ B;  2VJ4 A;  3QEV A;  1Q9Y A;  4M3T A;  4DTR A;  3LDB A;  3SPZ A;  1WAJ A;  4FJJ A;  4M42 A;  3QET A;  3QER A;  4HCB A;  1CLQ A;  1XVG E;  5IZ7 A;  4AKG A;  3LZJ A;  2P5G A;  2JHP A;  1FYZ E;  4DTN A;  3LZI A;  3SVI A;  3E4W A;  4HCC A;  3C94 A;  1Q9X A;  4FJ9 A;  4JS5 A;  2ATQ A;  3MKS B;  2E32 A;  3TAE A;  2B8I A;  4JS4 A;  3HL8 A;  4J2E A;  1FZ3 E;  3QES A;  1FZ5 E;  4J2A A;  2P1N B;  4DU1 A;  2QXF A;  5IBK B;  3RMA A;  4DTO A;  4FJK A;  4FK4 A;  4DTP A;  3C6P B;  3CQ8 A;  3L8B A;  3CFP A;  3SUP A;  4KI4 A;  1FZ1 E;  4RG8 A;  1MMO G;  3K2O A;  2HD0 A;  3QEP A;  4FJ7 A;  4M3U A;  4DU4 A;  4J2D A;  3SCX A;  1XU3 E;  2RCU A;  4KHW A;  2JHC A;  3LDS A;  3TL8 B;  3NE6 A;  3C6N B;  3NGI A;  4DTM A;  3QEW A;  3SJJ A;  4FK2 A;  1XMH E;  4E3S A;  3SPY A;  1FZ8 E;  3QEX A;  2FYO A;  2MMB A;  4I9L A;  4M3X A;  3NHG A;  3RMC A;  4DTJ A;  3SQ4 A;  4KI6 A;  4EYW A;  2JH9 A;  2JHA A;  1XL3 C;  3UIQ A;  2PFV A;  1WAF A;  1XMF E;  3SQ2 A;  1FZ4 E;  3NDK A;  3SQ0 A;  2B1E A;  4I6J B;  3NAE A;  3CFR A;  3TAF A;  3SUN A;  2P1M B;  3E4Y A;  3RMD A;  4FJM A;  3WSO A;  4M3Z A;  3SNN A;  3HP9 A;  2DY4 A;  4ADN A;  3OGM B;  5IRE A;  4FJI A;  4FJN A;  3L1N A;  4GAM C;  4JRP A;  3QEI A;  4KHU A;  1XMG E;  3HGL A;  4EP9 A;  4KHS A;  3SUQ A;  2YB5 A;  1XVE E;  2B7M A;  3HGK E;  1LDK E;  2E31 A;  2LF3 A;  4AKI A;  4X5N A;  3N1B A;  3QNO A;  3KD5 E;  4I9Q A;  1P22 A;  2DEB A;  4FJ8 A;  4KHQ A;  4M45 A;  4FJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...