1FZCA

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRIN
total genus 29
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcA00
1N86A 2XNXA 2OYIA 1LWUB 2FFDA 1LTJA 1M1JB 2A45I 2Z4EA 2FFDB 1RE3C 2HPCA 1JY2N 1LTJB 1FZEA 1M1JA 3GHGB 1RF1A 1FZFA 1W2EA 3HUSC 1JY2P 2HPCB 2OYHC 1JY3O 3GHGA 1RF1B 1LT9C 3H32B 2FFDC 1FZGA 1N73B 2OYIC 1FZCB 1RF0A 1RE4A 1LWUC 3H32A 1M1JC 1N73A 1FZCA 1JY3N 3E1IA 2OYHA 2A45G 2HLOA 1LT9A 3HUSA 1FZAA 1LTJC 1FZBA 2OYHB 3GHGC 1JY3P 1RF0C 1JY2O 3HUSB 1RE4C 1LT9B 1RE3A 2HODB 3BVHA 1N73C 1FZCC 1RF1C 2OYIB 2A45H 2H43A 1LWUA 2Q9IA 1T3UA 2HODA
chains in the Genus database with same CATH superfamily
4D6TE 2QM7A 1IJDB 4K3AA 1IFNA 1P84D 1GW4A 3H1KJ 1L0LD 2H89C 3P7KA 1M1JA 4WY4A 1Q81Q 1FJPA 2B9BA 2G3AA 2IBZD 3L36A 3PHLA 1NJIQ 2IZ1A 3GHGA 4BRYB 1M8OB 4WBAA 1JOCA 1LP1B 3EFGA 3AEEC 1JM0A 1NTMK 2ITAA 1AQTA 1JNMA 3AE8C 5AW0B 1PZQA 3RL0C 1AVOA 5KKZB 3H1JE 3ABVC 2YIUC 3CXHH 5KLIC 2P2UA 1VQNP 1KB9D 1KQLA 1URQB 2YKQA 1N7SD 3O6QA 1KD1Q 2R32A 3SFDC 2OYHB 3CC7P 1VQ9P 2GUSA 5AW7B 1GL2A 3H1JJ 2WSEJ 2JO1A 1PPJD 2AEJA 2HODB 3CI9A 1GK4A 5TISH 3A0HH 3TGUJ 2E43A 2RMZA 3JSVC 5AW3B 5BU8B 1KQGB 1KORA 4GOEA 3S1KA 3L35A 1Y8AA 4EDFA 4OGQD 2ZAEB 3Q5PA 2H88C 1HVVA 1DD3A 1GZLA 1L0NG 1J1DC 1PP9G 1URQD 1N7SB 1WT6A 2WZ7A 3A7OA 1IZNB 3BATA 3HUSC 4PD4I 1W2BO 1H8AA 1KQSO 1GDTA 1NGMB 3MHVA 2E5TA 2CPBA 2MKVA 2Q3EA 2WSFH 1IK9A 2WPVB 2P67A 3EQ2A 3BCCJ 2QRXA 4DZOA 2E75D 1R5SA 2FYUG 1KN7A 5KJ7D 2Q6QA 1BE3D 1BDDA 2YKPA 4GDOA 5KJ7C 5KLVK 1FOSE 1P84I 2KK7A 3F89A 1X22A 1VQOP 5E79E 1SQBE 1NTZK 2O1JA 5DJUB 4H0LB 3V4WA 1LT9B 1LNQA 2KXPB 2FXOA 4ASVA 1N8RQ 2CK3H 1LWUA 2HR3A 3H1HE 5CCGA 2WQYC 3A5TA 1SQPD 3IAOA 3Q5SA 1NKNA 3CCQP 2MJZA 4PJ0H 3BCCD 1E5WA 2QJPB 3P8CD 5CHXA 2J58A 1OMIA 2HG5D 4L73A 3USSA 3ZDMA 3L72J 4D6TJ 2J5UA 2JP3A 3L37A 2Z5HA 1IFPA 3L71G 2BCCD 4UB6H 4BWNA 4W7YA 2WMMA 5APVA 4GODA 1GMJA 2FFDA 1HGZA 3CCSP 4RO0A 2E42A 4U7JA 3FWLA 1SQQD 2DW3A 3O8ZA 3L70E 1GU4A 1RE4A 3H1KG 1LWUC 3H1JG 4Y99C 1PP9J 3PRJA 1SQQG 5CCGC 1S3JA 2IBZG 1JY3N 2M5AA 2WPQA 2YKOA 1KILE 2P10A 2ZJSE 2ZT9C 3L75D 3P8MC 4IL6H 3U1CA 1RY3A 1JO5A 1BGYE 3V5BA 1L0LJ 3NFQA 4YPCA 4U3FG 3TSIA 1KB9E 1L0NJ 3NXSA 1Q2NA 1MKMA 2PGDA 3AE6C 2D2CC 2O01H 1DH3A 1NO4A 3TNUB 2N1TD 2FYUE 4XFJA 2FBWC 1OZHA 2KSEA 3M0AA 2IX7C 2W90A 3SSUA 3CCVP 5KKZC 1PP9D 2QG4A 3FXDA 5APSA 1M56D 1L4AA 1RE3C 2JDIH 3L73G 4ASWA 1NAFA 2IBZI 5KAFE 2FYUJ 2V7QJ 3IR9A 1JCCA 2OYHC 3L74G 3G9RA 2HYNA 1ZOYC 3L71E 3RBXA 2FYZA 3GMAA 3HD7A 1DEEG 1EC5A 1KILB 1SQVK 3H32A 4I7ZB 3MIWA 1T3JA 1N73A 1VQMP 3L71J 3F5HA 3VP8A 5APTA 1NU1E 4H44C 3CXHD 1EDIA 1YITP 1Y9BA 1N7SC 1S5LX 4PD4H 3HUSB 4PJ0E 4ZKUA 1GU5A 1WRGA 2AXTE 1QEXA 2NPSC 3L72G 3IFMA 3GF3A 4BXLA 4M3LA 1OW6A 1AVYA 1SQVJ 2HODA 3AE3C 3HTKA 1HGVA 3I5CA 2FXPA 3M9BA 3MD0A 2E75B 4L74A 4WY4B 3RK3C 3RK3D 1R5LA 4R4LA 1QLED 3W67A 3H1HJ 1H0TA 4I2LC 1JY2N 2FY8A 2N9YB 1NTMG 1YI2P 1CW5A 3CX5D 2ZXXA 3HRNA 1NTKD 2A06E 5KLVJ 4AUWA 1EXIA 2KNCA 3AE5C 1LT1A 5AW4B 3MZWB 1SVFA 1RF0A 1S2EA 2E76B 2FKWB 2M5AB 2BCCE 2KOGA 3H6PA 3TGUD 1VQ5P 1M1JC 1YIJP 2P1JA 3KPEA 3AEAC 3A2AA 1NWQA 3I55P 3VTPC 1SQQE 1NYHA 2KUBA 5B66H 4EYYQ 1USEA 3HE5B 4Y28J 2B89A 1DD4A 2AEFA 1IO4A 2W8ZA 2Y0EA 1URQA 3O6QB 5B5EH 1SQQJ 5AVQB 1D7MA 2KP8A 2QE7H 3TNUA 1VQ8P 5KLVD 5H2FH 5L8RJ 2WPRA 2M8RA 1NU1K 1X8YA 1YTZI 5BVZA 1L4AB 1LWUB 2WITA 4Y99B 1L0LK 1KB9H 2ZT9B 1Y47A 3BRVB 2P58A 3U59A 4DT0A 1HUCA 5AW8B 1ZRTE 4YXDC 5KJ7A 4HJGH 3CX5I 4OVNF 3L73E 1YJ9P 2K9JA 2OTJP 1H0TB 3TYYA 3JCUH 1VQLP 1LTIC 2WSCH 1FAVA 4LLHA 3CCJP 3LW5J 5B66E 3L73J 3CWBJ 5AVVB 2ZYAA 5CCGD 2WT7B 1DX7A 5AVYB 5B5EE 3CCUP 2E5YA 3L74J 2H8PD 3HUSA 3SWYA 4DCKA 1SQPG 2L5GB 3G6EP 1NHLA 5CJ4A 1EZVE 2K9YA 1OW8A 3L72D 3A0BE 1NU1J 1MZ9A 3CMAP 1EXJA 1T3UA 3H1KE 5DJTB 1J1EC 2M3EA 1KILC 3AEDC 3IN6A 1X9VA 3PJSK 2N1TC 1ZLLA 4O9BA 4OGQC 5AVZB 1OIPA 1QL2A 2BEQD 3KZIE 3G4SP 3UIAA 3CCMP 4Z1MH 3M0DC 3CCEP 3BRTB 3CXHI 5TJHA 1OVVA 3TGUG 3SWKA 1BCCD 1KV4A 1N2DC 4KT0J 1RF1B 1N7LA 4GIFA 1M7LA 2LXBA 1SQBD 2NPSB 1FE6A 1NTKG 1OXZA 1UIXA 1G2CB 1ZW0A 2SPZA 1SFCA 3CX5E 2OYIC 2XU6A 1NTKE 2A06D 3AE1C 3WU2H 4UB8E 1LP1A 3RBZA 1EDJA 5AVTB 3RK3B 4I1LA 3U1AA 5KLVG 2LR2A 2R5BA 3L75G 1SQBG 3QH9A 3TGUE 1EDLA 1OX3A 2BCCJ 1R8EA 1LTAC 3A0HE 3D71A 2E74B 3H1IE 4EI2A 1GW3A 1VQKP 1SS1A 1FZCC 2J59M 1K04A 1LTTC 1JTHA 1QX8A 5APUA 2O1KA 4N3YB 3HD7D 3OW2O 1M1JB 3CMEP 3L70D 2C0WA 2OTKE 1JMBA 3B5NA 3HD7C 3TDKA 3G3ZA 5CCHA 1S72P 5AW5B 1SQPE 2FFDB 4HKZH 1X79B 3BCCE 2FYNB 1GTWA 1NKZB 2FFDC 3GLMA 1SQPJ 2LKMA 3AECC 3V2NA 2KNCB 3TK1A 3B8EB 1HH0A 1L4AC 1SFCB 5E79H 1SQXD 2KB7P 2FYUD 1K05A 2B87B 2YNYA 3IF4A 3V6IA 1FZBA 1MUUA 3GHGC 1JY3P 3L75E 1P84E 1JY2O 1SLQA 1S9KE 3CWBG 1M90Q 1IFDA 1AA0A 1XTGB 2JKVA 4HYTB 1UIIA 5KAIE 2GA1A 3L75J 1PGOA 3RL0B 5EFWB 3H1LJ 3VMYA 3NMDA 5GTIE 3AE2C 5KLIB 1BSHA 1L0LG 4XE5B 4DOJA 3RK2C 4U3FJ 4UB6E 1T8ZA 3D6ZA 1LTJB 1NU1G 2WVRA 1ZP0C 1U57A 1WMKA 3B5NB 1GL2C 2ZVNB 1PV3A 2NPSA 3H1JD 1NU1D 1PP9E 2HPCB 1AFOA 2ZFCA 3KZIH 4NPFX 1HTLC 3H32B 1G1IA 2BCCG 2Y0DA 3E1RA 4CPGA 1RHZB 1EZVI 4N6JA 4C46A 4JYCA 2Y9ZA 3GG2A 1BGYJ 3RL0D 2YMKA 4AYCA 1J1EB 4ZMDA 3GF7A 3VN0A 2ZYDA 1J1DB 3I56P 2W6JH 1FC2C 5AVUB 1U7MA 2GM4A 1NTKJ 3WU2E 4U3FD 2IFMA 2QIWA 5APQA 2M3BA 1RF0C 1JUNA 1ZMEC 1RH5B 2NZ2A 3CXHE 4HH2A 1RQUA 3WUVA 1Q7YQ 1RF1C 2H43A 4C7NA 5AVRB 2W83C 1HJBA 4XA4A 5CJ0A 1QVGO 1AV1A 1VF5B 3H25A 2C9NY 2A45I 2IYOA 1VL2A 1AJYA 2NRGA 1NTME 1ZR2A 2K9JB 3A3YB 2YIUB 4JBZA 1IK7A 1ZV8A 2G8YA 2PAJA 2YXRB 4EIJA 1W2EA 4YXWH 4R4MA 5APXA 1A02J 2K3RA 2WSEH 3B4SA 3L70G 4UB8H 1FZCB 1LTSC 1IFMA 1SQPK 3WUUA 2R3SA 2IPPA 3AEFC 3W68A 3CCLP 4PD4E 5AVWB 3WUTA 3R4YA 1H89A 1NTZD 1U7JA 3H1LG 3CCRP 3ITKA 2WSCJ 1SQVE 2ZXEB 1NTZG 3P32A 1SQXE 3PLNA 1RE3A 3PP5A 1ZRTD 1LGHB 1BE3G 2RKLA 5CCHC 2E76D 2QEXP 4ZKPA 1JEKA 3C1LA 1J2JB 2ZYGA 2BASA 1SFCD 3PH0A 5KLVE 2Z4EA 1SFCC 2O01N 3T97A 3VP9A 2C9LY 1BGYG 1FDOA 1KFNA 1EDKA 2AEMA 5APWA 1NOHA 4IFMA 3L4FA 2PRRA 2I1JA 5AVSB 1KYOD 1FDIA 3Q2YA 1LT9C 2W6BA 2YO3A 1FBMA 2OARA 1K9MQ 3Q1MA 2K37A 2QVAA 3L72E 2POHA 3P8CE 1SQQK 4RKUJ 5C39A 1PGJA 3H1KD 3JCUE 5KTBA 2Q3IA 2ZT9D 2V7QH 1P84H 1L0NE 2BEZF 3RK2B 3L70J 4JF7A 1LTJC 1PIXA 2KZJA 2Q1KA 3B5ND 3WMM0 5CCHD 1YQ4C 3CPWO 1RQVA 3V2PA 4D6TD 3HE5A 4N78E 3SFEC 1G1JA 2O01J 2CPSA 5M1BA 1KILD 1S1CX 3CC2P 5CBNA 2WTYA 1L0LE 1LJ2A 1N86A 2KLUA 5TISE 1ZR4A 1JTHB 1CI6A 3C8VA 1IFJA 1KMIZ 1JMMA 1YQ3C 2B88A 2KI7B 2KYVA 3MGNA 3RK2D 1A02F 3V2QA 1PFIA 2RH0A 3L74D 2LXCB 3CWBE 1JY2P 3VOPA 1K73Q 4GOFA 2Z5IA 1Z56A 4IFFA 1YJWP 3KXDA 1NVOA 2HFED 5BU5A 2KS1B 2Y9YA 2I8DA 1BCCE 1JB0J 1SQBK 1DEBA 2D2CB 2M0BA 2QM8A 3M06A 4IL6E 5AVXB 1VF5D 5CBOA 4AQRD 3OJAB 1CSBA 2P7JA 1VF5C 3E1IA 2H7HA 3KHUA 2IBZE 1QGKB 1PPJE 2IZ0A 1BCCJ 3RK3E 3BVHA 1YJNP 4OH8B 1KTMA 2QJKB 2K1AA 1RE4C 3M9QA 4HB1A 4RJTA 1OWAA 1NTZE 2NPSD 3D6YA 4TLFA 4LC1A 2QA4P 3S4RA 1VQ7P 2N9BA 4DJGA 1SQBJ 3H1ID 3RL0g 3EWKA 1SQXJ 5KAIH 4I7ZC 1LTJA 2JJLA 3Q3DA 2AXTH 1T2KD 1NTZJ 1USDA 3V2RA 4IFDK 4WVZA 2RN0A 3AEGC 2HPCA 2Q9IA 1S5LH 1YTZT 2OGUA 3N4XA 2QJYB 4H44B 2XZRA 3H1IG 1HF9A 1KFMA 3FX0A 3OA7A 4PV1D 2C0XA 1S9KD 2VRSA 3FXEA 2OTLP 1BSNA 2KZIA 3CD6P 1CZQA 1KYOE 2WSFJ 2WSSH 4NPEA 2IDBA 4H13C 4WY4D 3AE7C 2R3CA 4KHXA 3SWFA 1LTBC 2E75C 1W5CE 2W27A 4MN4C 4WY4C 2OYHA 1S4XA 2A45G 3LIDA 4W80A 5AW2B 1GD2E 1FZAA 4YTPC 3H1HD 2R5DA 1PPJG 2WPSA 1KB9I 3M0DA 4K35A 3AE4C 3FGAD 2WWWA 3JC22 3L73D 4I6MC 4PV1B 3V4QA 3LW5H 4D6TG 1N73C 2PP6A 2K88A 1BE3E 2E76C 2XNXA 3VMZA 1OFCX 4N78D 1QVFO 1HJ0A 1KZUB 1N7SA 3HTKB 3AEBC 2XV5A 3PTZA 3M9HA 5H2FE 1GL2D 1RF1A 1FZFA 3FWNA 3D70A 1Q86Q 1EZVG 1SQXK 1SQXG 3CL3D 3OAKA 4GKGA 5APYA 2QSIA 5KAFH 1EZVD 2XDJA 1IFIA 2XNDH 3L74E 1VQ6P 2N1TB 4IOIH 3TF5A 1KC8Q 1OVRA 1FZCA 3CX5H 4WWIA 2OQQA 3H1LD 5K5GB 1KQFB 1FOSF 3N7NA 2V4HA 3E7KA 2I1KA 1Q82Q 1M57D 4RESB 4IL6X 1ZN5A 5AW9B 3S9OA 4C7NB 1HWTC 2B87A 1YYCA 1VQPP 2JR8A 2OYIB 1MV8A 4W7ZA 2Q5UA 1FJKA 4U3FE 3VYIA 2UWJE 2D2CD 1L0NK 4GT1A 1BCCG 3EFFK 3RGUA 1YBKA 1JCDA 1MFTA 4NPDA 1BGYD 3A0BH 4QMAA 1URQC 3CLQA 4L75A 1ZXGA 3L71D 1PGPA 2AXCA 2KSJA 3G71P 1DIPA 4PD4D 1AQ5A 1JY3O 1NTMD 2QJKC 1M1KQ 3CC4P 4EOTA 1E79H 1SQVD 1FU1A 1FZGA 4JYBA 4JPZB 4OWFA 3HD7B 1XTCC 1KILA 3H1IJ 3HE4A 3MP7B 4LGDE 4OGQB 2Q7CA 3AE9C 1SQVG 2WT7A 1LT9A 2XKMA 4H44D 3QWOC 5AW6B 1KYOH 1BDCA 1K8AQ 1FDMA 2QJYC 2A06G 2FYNC 2KLVA 3LIEA 3H1HG 5GTHE 1FS0E 1OW7A 1OVUA 1H88A 3MUDA 1NTMJ 2O3JA 3R2PA 4C7RA 1VQ4P 4JQ0D 1PGQA 2OYIA 5AW1B 3T97B 3KYQA 2JWDA 1S5LE 1NH4A 1VDFA 2IYPA 1X0TA 2YO2A 4H13B 4A7PA 1T2KC 2FYUK 2FXMA 4L76A 1MFZA 1NTKK 1T6AA 1KYOI 3II6A 3M91A 1IC2A 1FZEA 2JEEA 3GHGB 4BRYA 1BE3J 2GUVA 2YMYA 1TU3F 1GK6A 2OYOA 1L0ND 4H0LC 4H0LD 2E74D 2R44A 4KJMA 3MTUE 2E74C 2ZVOB 3B71A 1QL1A 2N1TA 4WB4A 1N73B 4PV1C 3MUDC 1PL5A 3GW6A 1L4AD 1VPCA 1SP4A 3KQGA 1G2CA 2KS1A 4H13D 5CMZA 2QJPC 5GTHH 4B86A 3Q5RA 2JWAA 3BASA 1NAYA 1GL2B 2HLOA 2IFNA 2W6AA 1LTGC 3B5NC 3HE4B 3NTNA 4TT3H 1HBWA 1L2PA 2KIKA 2L91A 1Q90D 3H1LE 2PFXA 3K5BA 5GTIH 2YXQB 3BCCG 3VMXA 4ZNCA 1YHQP 2A45H 1EQ7A 3C9IA 3CWBD 3VMAA 2Y0CA 1CI6B 3KDPB
chains in the Genus database with same CATH topology
2QM7A 1IJDB 1IFNA 3P7KA 1GW4A 4WY4A 1FJPA 1M1JA 3L36A 3GHGA 4WBAA 1JOCA 3EFGA 1NTMK 1JNMA 5AW0B 3RL0C 2P2UA 1KQLA 1URQB 2YKQA 1N7SD 2R32A 2OYHB 2GUSA 5AW7B 1GL2A 2HODB 3CI9A 1GK4A 2E43A 5AW3B 5BU8B 3L35A 1HVVA 1GZLA 1J1DC 1URQD 2WZ7A 1N7SB 1WT6A 3A7OA 3BATA 3HUSC 1GDTA 1H8AA 2CPBA 2WSFH 1IK9A 2P67A 3EQ2A 4DZOA 5KJ7D 5KLVK 5KJ7C 2YKPA 1FOSE 1NTZK 2O1JA 3V4WA 1LT9B 1LWUA 5CCGA 3A5TA 1NKNA 2MJZA 1E5WA 3P8CD 5CHXA 2J58A 2HG5D 3L37A 2Z5HA 4W7YA 5APVA 1HGZA 2E42A 1GU4A 3O8ZA 1RE4A 1LWUC 4Y99C 5CCGC 2WPQA 1JY3N 4C7RA 2YKOA 3P8MC 3U1CA 1RY3A 1JO5A 3V5BA 3NFQA 3TSIA 3NXSA 1DH3A 2O01H 1NO4A 3TNUB 2N1TD 2FFDA 3M0AA 2IX7C 5APSA 1RE3C 1L4AA 1NAFA 3IR9A 1JCCA 2OYHC 2HYNA 2FYZA 3HD7A 1KILB 1SQVK 3H32A 3MIWA 1T3JA 1N73A 3VP8A 5APTA 1N7SC 1GU5A 3HUSB 4ZKUA 1WRGA 2NPSC 3IFMA 4M3LA 2HODA 3HTKA 3I5CA 1HGVA 3RK3C 3M9BA 3MD0A 4WY4B 3RK3D 4I2LC 1JY2N 1CW5A 3HRNA 4AUWA 5AW4B 1SVFA 1RF0A 2FKWB 3H6PA 1HWTC 2KOGA 1M1JC 2P1JA 3KPEA 3A2AA 1NWQA 3VTPC 3HE5B 1IO4A 1URQA 5AVQB 2KP8A 3TNUA 2WPRA 2M8RA 1NU1K 1X8YA 1YTZI 5BVZA 1L4AB 1LWUB 2WITA 4Y99B 1L0LK 3BRVB 3U59A 1HUCA 5AW8B 5KJ7A 3TYYA 1LTIC 2WSCH 1FAVA 4LLHA 5AVVB 5CCGD 2WT7B 1DX7A 5AVYB 2H8PD 3HUSA 3SWYA 2L5GB 1NHLA 5CJ4A 1MZ9A 1T3UA 1J1EC 1KILC 4O9BA 1X9VA 5AVZB 2N1TC 1ZLLA 1QL2A 3UIAA 3M0DC 3BRTB 1N2DC 1RF1B 1N7LA 4GIFA 1M7LA 2NPSB 1OXZA 2OYIC 1G2CB 1SFCA 2XU6A 5AVTB 3RK3B 4I1LA 3U1AA 2R5BA 1LTAC 1GW3A 1FZCC 2J59M 1LTTC 1JTHA 5APUA 2O1KA 4N3YB 3HD7D 1M1JB 3B5NA 3HD7C 2C0WA 5CCHA 2FFDB 3G3ZA 5AW5B 1X79B 1GTWA 1NKZB 2FFDC 2LKMA 3V2NA 3TK1A 3B8EB 1HH0A 1L4AC 1SFCB 2KB7P 2YNYA 1FZBA 1MUUA 3GHGC 1JY3P 1S9KE 1JY2O 1SLQA 1IFDA 1XTGB 4HYTB 3RL0B 3VMYA 3NMDA 4XE5B 4DOJA 3RK2C 1T8ZA 1LTJB 3B5NB 1GL2C 2NPSA 2HPCB 1AFOA 2ZFCA 1HTLC 3H32B 1G1IA 4N6JA 4C46A 4JYCA 3RL0D 4AYCA 1J1EB 3VN0A 1J1DB 5AVUB 2GM4A 2IFMA 5APQA 2M3BA 1RF0C 1JUNA 4HH2A 1RF1C 2H43A 4C7NA 5AVRB 1HJBA 4XA4A 5CJ0A 2C9NY 2A45I 1ZR2A 3A3YB 1ZV8A 2PAJA 4EIJA 1W2EA 5APXA 1A02J 2WSEH 1FZCB 1LTSC 1IFMA 1SQPK 2IPPA 5AVWB 1H89A 2ZXEB 3P32A 3PP5A 1RE3A 1LGHB 4ZKPA 1J2JB 2BASA 1SFCD 2Z4EA 1SFCC 3T97A 2C9LY 3VP9A 5APWA 1KFNA 1NOHA 4IFMA 3L4FA 2I1JA 5AVSB 1LT9C 2W6BA 2YO3A 1FBMA 2OARA 2POHA 3P8CE 1SQQK 5KTBA 2Q3IA 3RK2B 4JF7A 1LTJC 3B5ND 3WMM0 5CCHD 3V2PA 3HE5A 4N78E 1G1JA 2CPSA 1KILD 2WTYA 1N86A 1ZR4A 1JTHB 1CI6A 1IFJA 1A02F 3MGNA 1JMMA 2KYVA 3RK2D 3V2QA 1PFIA 1JY2P 3VOPA 2Z5IA 1Z56A 4IFFA 2HFED 5BU5A 1SQBK 5AVXB 1DEBA 2QM8A 3M06A 4AQRD 3OJAB 1CSBA 2P7JA 2H7HA 3E1IA 4OH8B 1RE4C 3M9QA 1OWAA 2NPSD 4LC1A 2N9BA 1T2KD 1LTJA 2JJLA 3V2RA 4IFDK 2HPCA 1YTZT 3N4XA 2XZRA 1KFMA 3OA7A 2C0XA 1S9KD 2VRSA 1CZQA 4WY4D 4KHXA 2R3CA 3SWFA 1LTBC 4WY4C 2OYHA 2W27A 2A45G 3LIDA 4W80A 5AW2B 1GD2E 1FZAA 2R5DA 2WPSA 3M0DA 3BVHA 3V4QA 4I6MC 2WWWA 1N73C 3LW5H 2PP6A 2XNXA 3VMZA 4N78D 1KZUB 1N7SA 3HTKB 2XV5A 3M9HA 1GL2D 1RF1A 1FZFA 1SQXK 3CL3D 4GKGA 3OAKA 5APYA 2XDJA 1IFIA 2N1TB 1FZCA 1FOSF 3N7NA 2I1KA 4RESB 1ZN5A 5AW9B 4C7NB 1YYCA 2OYIB 1MV8A 4W7ZA 2Q5UA 1FJKA 3VYIA 1L0NK 4GT1A 1JCDA 1URQC 3CLQA 2KSJA 1AQ5A 1JY3O 4EOTA 1FU1A 1FZGA 4JYBA 3HD7B 1XTCC 1KILA 3HE4A 4LGDE 2Q7CA 2WT7A 1LT9A 2XKMA 5AW6B 2KLVA 3LIEA 1H88A 3MUDA 3R2PA 2OYIA 5AW1B 3KYQA 1VDFA 1NH4A 2YO2A 1T2KC 2FYUK 2FXMA 3II6A 1MFZA 1NTKK 3M91A 1IC2A 1FZEA 2JEEA 3GHGB 2YMYA 2GUVA 1GK6A 3MTUE 4WB4A 1QL1A 2N1TA 1N73B 1L4AD 1VPCA 1SP4A 3KQGA 1G2CA 5CMZA 4B86A 3BASA 2HLOA 1GL2B 2IFNA 3NTNA 2W6AA 1LTGC 3B5NC 3HE4B 5CCHC 1HBWA 3VMXA 2A45H 1EQ7A 3C9IA 2Q9IA 1FDMA 1CI6B 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 A;  2XNX A;  2OYI A;  1LWU B;  2FFD A;  1LTJ A;  1M1J B;  2A45 I;  2Z4E A;  2FFD B;  1RE3 C;  2HPC A;  1JY2 N;  1LTJ B;  1FZE A;  1M1J A;  3GHG B;  1RF1 A;  1FZF A;  1W2E A;  3HUS C;  1JY2 P;  2HPC B;  2OYH C;  1JY3 O;  3GHG A;  1RF1 B;  1LT9 C;  3H32 B;  2FFD C;  1FZG A;  1N73 B;  2OYI C;  1FZC B;  1RF0 A;  1RE4 A;  1LWU C;  3H32 A;  1M1J C;  1N73 A;  1FZC A;  1JY3 N;  3E1I A;  2OYH A;  2A45 G;  2HLO A;  1LT9 A;  3HUS A;  1FZA A;  1LTJ C;  1FZB A;  2OYH B;  3GHG C;  1JY3 P;  1RF0 C;  1JY2 O;  3HUS B;  1RE4 C;  1LT9 B;  1RE3 A;  2HOD B;  3BVH A;  1N73 C;  1FZC C;  1RF1 C;  2OYI B;  2A45 H;  2H43 A;  1LWU A;  2Q9I A;  1T3U A;  2HOD A; 
#chains in the Genus database with same CATH topology
 4D6T E;  2QM7 A;  1IJD B;  4K3A A;  1IFN A;  1P84 D;  1GW4 A;  3H1K J;  1L0L D;  2H89 C;  3P7K A;  1M1J A;  4WY4 A;  1Q81 Q;  1FJP A;  2B9B A;  2G3A A;  2IBZ D;  3L36 A;  3PHL A;  1NJI Q;  2IZ1 A;  3GHG A;  4BRY B;  1M8O B;  4WBA A;  1JOC A;  1LP1 B;  3EFG A;  3AEE C;  1JM0 A;  1NTM K;  2ITA A;  1AQT A;  1JNM A;  3AE8 C;  5AW0 B;  1PZQ A;  3RL0 C;  1AVO A;  5KKZ B;  3H1J E;  3ABV C;  2YIU C;  3CXH H;  5KLI C;  2P2U A;  1VQN P;  1KB9 D;  1KQL A;  1URQ B;  2YKQ A;  1N7S D;  3O6Q A;  1KD1 Q;  2R32 A;  3SFD C;  2OYH B;  3CC7 P;  1VQ9 P;  2GUS A;  5AW7 B;  1GL2 A;  3H1J J;  2WSE J;  2JO1 A;  1PPJ D;  2AEJ A;  2HOD B;  3CI9 A;  1GK4 A;  5TIS H;  3A0H H;  3TGU J;  2E43 A;  2RMZ A;  3JSV C;  5AW3 B;  5BU8 B;  1KQG B;  1KOR A;  4GOE A;  3S1K A;  3L35 A;  1Y8A A;  4EDF A;  4OGQ D;  2ZAE B;  3Q5P A;  2H88 C;  1HVV A;  1DD3 A;  1GZL A;  1L0N G;  1J1D C;  1PP9 G;  1URQ D;  1N7S B;  1WT6 A;  2WZ7 A;  3A7O A;  1IZN B;  3BAT A;  3HUS C;  4PD4 I;  1W2B O;  1H8A A;  1KQS O;  1GDT A;  1NGM B;  3MHV A;  2E5T A;  2CPB A;  2MKV A;  2Q3E A;  2WSF H;  1IK9 A;  2WPV B;  2P67 A;  3EQ2 A;  3BCC J;  2QRX A;  4DZO A;  2E75 D;  1R5S A;  2FYU G;  1KN7 A;  5KJ7 D;  2Q6Q A;  1BE3 D;  1BDD A;  2YKP A;  4GDO A;  5KJ7 C;  5KLV K;  1FOS E;  1P84 I;  2KK7 A;  3F89 A;  1X22 A;  1VQO P;  5E79 E;  1SQB E;  1NTZ K;  2O1J A;  5DJU B;  4H0L B;  3V4W A;  1LT9 B;  1LNQ A;  2KXP B;  2FXO A;  4ASV A;  1N8R Q;  2CK3 H;  1LWU A;  2HR3 A;  3H1H E;  5CCG A;  2WQY C;  3A5T A;  1SQP D;  3IAO A;  3Q5S A;  1NKN A;  3CCQ P;  2MJZ A;  4PJ0 H;  3BCC D;  1E5W A;  2QJP B;  3P8C D;  5CHX A;  2J58 A;  1OMI A;  2HG5 D;  4L73 A;  3USS A;  3ZDM A;  3L72 J;  4D6T J;  2J5U A;  2JP3 A;  3L37 A;  2Z5H A;  1IFP A;  3L71 G;  2BCC D;  4UB6 H;  4BWN A;  4W7Y A;  2WMM A;  5APV A;  4GOD A;  1GMJ A;  2FFD A;  1HGZ A;  3CCS P;  4RO0 A;  2E42 A;  4U7J A;  3FWL A;  1SQQ D;  2DW3 A;  3O8Z A;  3L70 E;  1GU4 A;  1RE4 A;  3H1K G;  1LWU C;  3H1J G;  4Y99 C;  1PP9 J;  3PRJ A;  1SQQ G;  5CCG C;  1S3J A;  2IBZ G;  1JY3 N;  2M5A A;  2WPQ A;  2YKO A;  1KIL E;  2P10 A;  2ZJS E;  2ZT9 C;  3L75 D;  3P8M C;  4IL6 H;  3U1C A;  1RY3 A;  1JO5 A;  1BGY E;  3V5B A;  1L0L J;  3NFQ A;  4YPC A;  4U3F G;  3TSI A;  1KB9 E;  1L0N J;  3NXS A;  1Q2N A;  1MKM A;  2PGD A;  3AE6 C;  2D2C C;  2O01 H;  1DH3 A;  1NO4 A;  3TNU B;  2N1T D;  2FYU E;  4XFJ A;  2FBW C;  1OZH A;  2KSE A;  3M0A A;  2IX7 C;  2W90 A;  3SSU A;  3CCV P;  5KKZ C;  1PP9 D;  2QG4 A;  3FXD A;  5APS A;  1M56 D;  1L4A A;  1RE3 C;  2JDI H;  3L73 G;  4ASW A;  1NAF A;  2IBZ I;  5KAF E;  2FYU J;  2V7Q J;  3IR9 A;  1JCC A;  2OYH C;  3L74 G;  3G9R A;  2HYN A;  1ZOY C;  3L71 E;  3RBX A;  2FYZ A;  3GMA A;  3HD7 A;  1DEE G;  1EC5 A;  1KIL B;  1SQV K;  3H32 A;  4I7Z B;  3MIW A;  1T3J A;  1N73 A;  1VQM P;  3L71 J;  3F5H A;  3VP8 A;  5APT A;  1NU1 E;  4H44 C;  3CXH D;  1EDI A;  1YIT P;  1Y9B A;  1N7S C;  1S5L X;  4PD4 H;  3HUS B;  4PJ0 E;  4ZKU A;  1GU5 A;  1WRG A;  2AXT E;  1QEX A;  2NPS C;  3L72 G;  3IFM A;  3GF3 A;  4BXL A;  4M3L A;  1OW6 A;  1AVY A;  1SQV J;  2HOD A;  3AE3 C;  3HTK A;  1HGV A;  3I5C A;  2FXP A;  3M9B A;  3MD0 A;  2E75 B;  4L74 A;  4WY4 B;  3RK3 C;  3RK3 D;  1R5L A;  4R4L A;  1QLE D;  3W67 A;  3H1H J;  1H0T A;  4I2L C;  1JY2 N;  2FY8 A;  2N9Y B;  1NTM G;  1YI2 P;  1CW5 A;  3CX5 D;  2ZXX A;  3HRN A;  1NTK D;  2A06 E;  5KLV J;  4AUW A;  1EXI A;  2KNC A;  3AE5 C;  1LT1 A;  5AW4 B;  3MZW B;  1SVF A;  1RF0 A;  1S2E A;  2E76 B;  2FKW B;  2M5A B;  2BCC E;  2KOG A;  3H6P A;  3TGU D;  1VQ5 P;  1M1J C;  1YIJ P;  2P1J A;  3KPE A;  3AEA C;  3A2A A;  1NWQ A;  3I55 P;  3VTP C;  1SQQ E;  1NYH A;  2KUB A;  5B66 H;  4EYY Q;  1USE A;  3HE5 B;  4Y28 J;  2B89 A;  1DD4 A;  2AEF A;  1IO4 A;  2W8Z A;  2Y0E A;  1URQ A;  3O6Q B;  5B5E H;  1SQQ J;  5AVQ B;  1D7M A;  2KP8 A;  2QE7 H;  3TNU A;  1VQ8 P;  5KLV D;  5H2F H;  5L8R J;  2WPR A;  2M8R A;  1NU1 K;  1X8Y A;  1YTZ I;  5BVZ A;  1L4A B;  1LWU B;  2WIT A;  4Y99 B;  1L0L K;  1KB9 H;  2ZT9 B;  1Y47 A;  3BRV B;  2P58 A;  3U59 A;  4DT0 A;  1HUC A;  5AW8 B;  1ZRT E;  4YXD C;  5KJ7 A;  4HJG H;  3CX5 I;  4OVN F;  3L73 E;  1YJ9 P;  2K9J A;  2OTJ P;  1H0T B;  3TYY A;  3JCU H;  1VQL P;  1LTI C;  2WSC H;  1FAV A;  4LLH A;  3CCJ P;  3LW5 J;  5B66 E;  3L73 J;  3CWB J;  5AVV B;  2ZYA A;  5CCG D;  2WT7 B;  1DX7 A;  5AVY B;  5B5E E;  3CCU P;  2E5Y A;  3L74 J;  2H8P D;  3HUS A;  3SWY A;  4DCK A;  1SQP G;  2L5G B;  3G6E P;  1NHL A;  5CJ4 A;  1EZV E;  2K9Y A;  1OW8 A;  3L72 D;  3A0B E;  1NU1 J;  1MZ9 A;  3CMA P;  1EXJ A;  1T3U A;  3H1K E;  5DJT B;  1J1E C;  2M3E A;  1KIL C;  3AED C;  3IN6 A;  1X9V A;  3PJS K;  2N1T C;  1ZLL A;  4O9B A;  4OGQ C;  5AVZ B;  1OIP A;  1QL2 A;  2BEQ D;  3KZI E;  3G4S P;  3UIA A;  3CCM P;  4Z1M H;  3M0D C;  3CCE P;  3BRT B;  3CXH I;  5TJH A;  1OVV A;  3TGU G;  3SWK A;  1BCC D;  1KV4 A;  1N2D C;  4KT0 J;  1RF1 B;  1N7L A;  4GIF A;  1M7L A;  2LXB A;  1SQB D;  2NPS B;  1FE6 A;  1NTK G;  1OXZ A;  1UIX A;  1G2C B;  1ZW0 A;  2SPZ A;  1SFC A;  3CX5 E;  2OYI C;  2XU6 A;  1NTK E;  2A06 D;  3AE1 C;  3WU2 H;  4UB8 E;  1LP1 A;  3RBZ A;  1EDJ A;  5AVT B;  3RK3 B;  4I1L A;  3U1A A;  5KLV G;  2LR2 A;  2R5B A;  3L75 G;  1SQB G;  3QH9 A;  3TGU E;  1EDL A;  1OX3 A;  2BCC J;  1R8E A;  1LTA C;  3A0H E;  3D71 A;  2E74 B;  3H1I E;  4EI2 A;  1GW3 A;  1VQK P;  1SS1 A;  1FZC C;  2J59 M;  1K04 A;  1LTT C;  1JTH A;  1QX8 A;  5APU A;  2O1K A;  4N3Y B;  3HD7 D;  3OW2 O;  1M1J B;  3CME P;  3L70 D;  2C0W A;  2OTK E;  1JMB A;  3B5N A;  3HD7 C;  3TDK A;  3G3Z A;  5CCH A;  1S72 P;  5AW5 B;  1SQP E;  2FFD B;  4HKZ H;  1X79 B;  3BCC E;  2FYN B;  1GTW A;  1NKZ B;  2FFD C;  3GLM A;  1SQP J;  2LKM A;  3AEC C;  3V2N A;  2KNC B;  3TK1 A;  3B8E B;  1HH0 A;  1L4A C;  1SFC B;  5E79 H;  1SQX D;  2KB7 P;  2FYU D;  1K05 A;  2B87 B;  2YNY A;  3IF4 A;  3V6I A;  1FZB A;  1MUU A;  3GHG C;  1JY3 P;  3L75 E;  1P84 E;  1JY2 O;  1SLQ A;  1S9K E;  3CWB G;  1M90 Q;  1IFD A;  1AA0 A;  1XTG B;  2JKV A;  4HYT B;  1UII A;  5KAI E;  2GA1 A;  3L75 J;  1PGO A;  3RL0 B;  5EFW B;  3H1L J;  3VMY A;  3NMD A;  5GTI E;  3AE2 C;  5KLI B;  1BSH A;  1L0L G;  4XE5 B;  4DOJ A;  3RK2 C;  4U3F J;  4UB6 E;  1T8Z A;  3D6Z A;  1LTJ B;  1NU1 G;  2WVR A;  1ZP0 C;  1U57 A;  1WMK A;  3B5N B;  1GL2 C;  2ZVN B;  1PV3 A;  2NPS A;  3H1J D;  1NU1 D;  1PP9 E;  2HPC B;  1AFO A;  2ZFC A;  3KZI H;  4NPF X;  1HTL C;  3H32 B;  1G1I A;  2BCC G;  2Y0D A;  3E1R A;  4CPG A;  1RHZ B;  1EZV I;  4N6J A;  4C46 A;  4JYC A;  2Y9Z A;  3GG2 A;  1BGY J;  3RL0 D;  2YMK A;  4AYC A;  1J1E B;  4ZMD A;  3GF7 A;  3VN0 A;  2ZYD A;  1J1D B;  3I56 P;  2W6J H;  1FC2 C;  5AVU B;  1U7M A;  2GM4 A;  1NTK J;  3WU2 E;  4U3F D;  2IFM A;  2QIW A;  5APQ A;  2M3B A;  1RF0 C;  1JUN A;  1ZME C;  1RH5 B;  2NZ2 A;  3CXH E;  4HH2 A;  1RQU A;  3WUV A;  1Q7Y Q;  1RF1 C;  2H43 A;  4C7N A;  5AVR B;  2W83 C;  1HJB A;  4XA4 A;  5CJ0 A;  1QVG O;  1AV1 A;  1VF5 B;  3H25 A;  2C9N Y;  2A45 I;  2IYO A;  1VL2 A;  1AJY A;  2NRG A;  1NTM E;  1ZR2 A;  2K9J B;  3A3Y B;  2YIU B;  4JBZ A;  1IK7 A;  1ZV8 A;  2G8Y A;  2PAJ A;  2YXR B;  4EIJ A;  1W2E A;  4YXW H;  4R4M A;  5APX A;  1A02 J;  2K3R A;  2WSE H;  3B4S A;  3L70 G;  4UB8 H;  1FZC B;  1LTS C;  1IFM A;  1SQP K;  3WUU A;  2R3S A;  2IPP A;  3AEF C;  3W68 A;  3CCL P;  4PD4 E;  5AVW B;  3WUT A;  3R4Y A;  1H89 A;  1NTZ D;  1U7J A;  3H1L G;  3CCR P;  3ITK A;  2WSC J;  1SQV E;  2ZXE B;  1NTZ G;  3P32 A;  1SQX E;  3PLN A;  1RE3 A;  3PP5 A;  1ZRT D;  1LGH B;  1BE3 G;  2RKL A;  5CCH C;  2E76 D;  2QEX P;  4ZKP A;  1JEK A;  3C1L A;  1J2J B;  2ZYG A;  2BAS A;  1SFC D;  3PH0 A;  5KLV E;  2Z4E A;  1SFC C;  2O01 N;  3T97 A;  3VP9 A;  2C9L Y;  1BGY G;  1FDO A;  1KFN A;  1EDK A;  2AEM A;  5APW A;  1NOH A;  4IFM A;  3L4F A;  2PRR A;  2I1J A;  5AVS B;  1KYO D;  1FDI A;  3Q2Y A;  1LT9 C;  2W6B A;  2YO3 A;  1FBM A;  2OAR A;  1K9M Q;  3Q1M A;  2K37 A;  2QVA A;  3L72 E;  2POH A;  3P8C E;  1SQQ K;  4RKU J;  5C39 A;  1PGJ A;  3H1K D;  3JCU E;  5KTB A;  2Q3I A;  2ZT9 D;  2V7Q H;  1P84 H;  1L0N E;  2BEZ F;  3RK2 B;  3L70 J;  4JF7 A;  1LTJ C;  1PIX A;  2KZJ A;  2Q1K A;  3B5N D;  3WMM 0;  5CCH D;  1YQ4 C;  3CPW O;  1RQV A;  3V2P A;  4D6T D;  3HE5 A;  4N78 E;  3SFE C;  1G1J A;  2O01 J;  2CPS A;  5M1B A;  1KIL D;  1S1C X;  3CC2 P;  5CBN A;  2WTY A;  1L0L E;  1LJ2 A;  1N86 A;  2KLU A;  5TIS E;  1ZR4 A;  1JTH B;  1CI6 A;  3C8V A;  1IFJ A;  1KMI Z;  1JMM A;  1YQ3 C;  2B88 A;  2KI7 B;  2KYV A;  3MGN A;  3RK2 D;  1A02 F;  3V2Q A;  1PFI A;  2RH0 A;  3L74 D;  2LXC B;  3CWB E;  1JY2 P;  3VOP A;  1K73 Q;  4GOF A;  2Z5I A;  1Z56 A;  4IFF A;  1YJW P;  3KXD A;  1NVO A;  2HFE D;  5BU5 A;  2KS1 B;  2Y9Y A;  2I8D A;  1BCC E;  1JB0 J;  1SQB K;  1DEB A;  2D2C B;  2M0B A;  2QM8 A;  3M06 A;  4IL6 E;  5AVX B;  1VF5 D;  5CBO A;  4AQR D;  3OJA B;  1CSB A;  2P7J A;  1VF5 C;  3E1I A;  2H7H A;  3KHU A;  2IBZ E;  1QGK B;  1PPJ E;  2IZ0 A;  1BCC J;  3RK3 E;  3BVH A;  1YJN P;  4OH8 B;  1KTM A;  2QJK B;  2K1A A;  1RE4 C;  3M9Q A;  4HB1 A;  4RJT A;  1OWA A;  1NTZ E;  2NPS D;  3D6Y A;  4TLF A;  4LC1 A;  2QA4 P;  3S4R A;  1VQ7 P;  2N9B A;  4DJG A;  1SQB J;  3H1I D;  3RL0 g;  3EWK A;  1SQX J;  5KAI H;  4I7Z C;  1LTJ A;  2JJL A;  3Q3D A;  2AXT H;  1T2K D;  1NTZ J;  1USD A;  3V2R A;  4IFD K;  4WVZ A;  2RN0 A;  3AEG C;  2HPC A;  2Q9I A;  1S5L H;  1YTZ T;  2OGU A;  3N4X A;  2QJY B;  4H44 B;  2XZR A;  3H1I G;  1HF9 A;  1KFM A;  3FX0 A;  3OA7 A;  4PV1 D;  2C0X A;  1S9K D;  2VRS A;  3FXE A;  2OTL P;  1BSN A;  2KZI A;  3CD6 P;  1CZQ A;  1KYO E;  2WSF J;  2WSS H;  4NPE A;  2IDB A;  4H13 C;  4WY4 D;  3AE7 C;  2R3C A;  4KHX A;  3SWF A;  1LTB C;  2E75 C;  1W5C E;  2W27 A;  4MN4 C;  4WY4 C;  2OYH A;  1S4X A;  2A45 G;  3LID A;  4W80 A;  5AW2 B;  1GD2 E;  1FZA A;  4YTP C;  3H1H D;  2R5D A;  1PPJ G;  2WPS A;  1KB9 I;  3M0D A;  4K35 A;  3AE4 C;  3FGA D;  2WWW A;  3JC2 2;  3L73 D;  4I6M C;  4PV1 B;  3V4Q A;  3LW5 H;  4D6T G;  1N73 C;  2PP6 A;  2K88 A;  1BE3 E;  2E76 C;  2XNX A;  3VMZ A;  1OFC X;  4N78 D;  1QVF O;  1HJ0 A;  1KZU B;  1N7S A;  3HTK B;  3AEB C;  2XV5 A;  3PTZ A;  3M9H A;  5H2F E;  1GL2 D;  1RF1 A;  1FZF A;  3FWN A;  3D70 A;  1Q86 Q;  1EZV G;  1SQX K;  1SQX G;  3CL3 D;  3OAK A;  4GKG A;  5APY A;  2QSI A;  5KAF H;  1EZV D;  2XDJ A;  1IFI A;  2XND H;  3L74 E;  1VQ6 P;  2N1T B;  4IOI H;  3TF5 A;  1KC8 Q;  1OVR A;  1FZC A;  3CX5 H;  4WWI A;  2OQQ A;  3H1L D;  5K5G B;  1KQF B;  1FOS F;  3N7N A;  2V4H A;  3E7K A;  2I1K A;  1Q82 Q;  1M57 D;  4RES B;  4IL6 X;  1ZN5 A;  5AW9 B;  3S9O A;  4C7N B;  1HWT C;  2B87 A;  1YYC A;  1VQP P;  2JR8 A;  2OYI B;  1MV8 A;  4W7Z A;  2Q5U A;  1FJK A;  4U3F E;  3VYI A;  2UWJ E;  2D2C D;  1L0N K;  4GT1 A;  1BCC G;  3EFF K;  3RGU A;  1YBK A;  1JCD A;  1MFT A;  4NPD A;  1BGY D;  3A0B H;  4QMA A;  1URQ C;  3CLQ A;  4L75 A;  1ZXG A;  3L71 D;  1PGP A;  2AXC A;  2KSJ A;  3G71 P;  1DIP A;  4PD4 D;  1AQ5 A;  1JY3 O;  1NTM D;  2QJK C;  1M1K Q;  3CC4 P;  4EOT A;  1E79 H;  1SQV D;  1FU1 A;  1FZG A;  4JYB A;  4JPZ B;  4OWF A;  3HD7 B;  1XTC C;  1KIL A;  3H1I J;  3HE4 A;  3MP7 B;  4LGD E;  4OGQ B;  2Q7C A;  3AE9 C;  1SQV G;  2WT7 A;  1LT9 A;  2XKM A;  4H44 D;  3QWO C;  5AW6 B;  1KYO H;  1BDC A;  1K8A Q;  1FDM A;  2QJY C;  2A06 G;  2FYN C;  2KLV A;  3LIE A;  3H1H G;  5GTH E;  1FS0 E;  1OW7 A;  1OVU A;  1H88 A;  3MUD A;  1NTM J;  2O3J A;  3R2P A;  4C7R A;  1VQ4 P;  4JQ0 D;  1PGQ A;  2OYI A;  5AW1 B;  3T97 B;  3KYQ A;  2JWD A;  1S5L E;  1NH4 A;  1VDF A;  2IYP A;  1X0T A;  2YO2 A;  4H13 B;  4A7P A;  1T2K C;  2FYU K;  2FXM A;  4L76 A;  1MFZ A;  1NTK K;  1T6A A;  1KYO I;  3II6 A;  3M91 A;  1IC2 A;  1FZE A;  2JEE A;  3GHG B;  4BRY A;  1BE3 J;  2GUV A;  2YMY A;  1TU3 F;  1GK6 A;  2OYO A;  1L0N D;  4H0L C;  4H0L D;  2E74 D;  2R44 A;  4KJM A;  3MTU E;  2E74 C;  2ZVO B;  3B71 A;  1QL1 A;  2N1T A;  4WB4 A;  1N73 B;  4PV1 C;  3MUD C;  1PL5 A;  3GW6 A;  1L4A D;  1VPC A;  1SP4 A;  3KQG A;  1G2C A;  2KS1 A;  4H13 D;  5CMZ A;  2QJP C;  5GTH H;  4B86 A;  3Q5R A;  2JWA A;  3BAS A;  1NAY A;  1GL2 B;  2HLO A;  2IFN A;  2W6A A;  1LTG C;  3B5N C;  3HE4 B;  3NTN A;  4TT3 H;  1HBW A;  1L2P A;  2KIK A;  2L91 A;  1Q90 D;  3H1L E;  2PFX A;  3K5B A;  5GTI H;  2YXQ B;  3BCC G;  3VMX A;  4ZNC A;  1YHQ P;  2A45 H;  1EQ7 A;  3C9I A;  3CWB D;  3VMA A;  2Y0C A;  1CI6 B;  3KDP B; 
#chains in the Genus database with same CATH homology
 2QM7 A;  1IJD B;  1IFN A;  3P7K A;  1GW4 A;  4WY4 A;  1FJP A;  1M1J A;  3L36 A;  3GHG A;  4WBA A;  1JOC A;  3EFG A;  1NTM K;  1JNM A;  5AW0 B;  3RL0 C;  2P2U A;  1KQL A;  1URQ B;  2YKQ A;  1N7S D;  2R32 A;  2OYH B;  2GUS A;  5AW7 B;  1GL2 A;  2HOD B;  3CI9 A;  1GK4 A;  2E43 A;  5AW3 B;  5BU8 B;  3L35 A;  1HVV A;  1GZL A;  1J1D C;  1URQ D;  2WZ7 A;  1N7S B;  1WT6 A;  3A7O A;  3BAT A;  3HUS C;  1GDT A;  1H8A A;  2CPB A;  2WSF H;  1IK9 A;  2P67 A;  3EQ2 A;  4DZO A;  5KJ7 D;  5KLV K;  5KJ7 C;  2YKP A;  1FOS E;  1NTZ K;  2O1J A;  3V4W A;  1LT9 B;  1LWU A;  5CCG A;  3A5T A;  1NKN A;  2MJZ A;  1E5W A;  3P8C D;  5CHX A;  2J58 A;  2HG5 D;  3L37 A;  2Z5H A;  4W7Y A;  5APV A;  1HGZ A;  2E42 A;  1GU4 A;  3O8Z A;  1RE4 A;  1LWU C;  4Y99 C;  5CCG C;  2WPQ A;  1JY3 N;  4C7R A;  2YKO A;  3P8M C;  3U1C A;  1RY3 A;  1JO5 A;  3V5B A;  3NFQ A;  3TSI A;  3NXS A;  1DH3 A;  2O01 H;  1NO4 A;  3TNU B;  2N1T D;  2FFD A;  3M0A A;  2IX7 C;  5APS A;  1RE3 C;  1L4A A;  1NAF A;  3IR9 A;  1JCC A;  2OYH C;  2HYN A;  2FYZ A;  3HD7 A;  1KIL B;  1SQV K;  3H32 A;  3MIW A;  1T3J A;  1N73 A;  3VP8 A;  5APT A;  1N7S C;  1GU5 A;  3HUS B;  4ZKU A;  1WRG A;  2NPS C;  3IFM A;  4M3L A;  2HOD A;  3HTK A;  3I5C A;  1HGV A;  3RK3 C;  3M9B A;  3MD0 A;  4WY4 B;  3RK3 D;  4I2L C;  1JY2 N;  1CW5 A;  3HRN A;  4AUW A;  5AW4 B;  1SVF A;  1RF0 A;  2FKW B;  3H6P A;  1HWT C;  2KOG A;  1M1J C;  2P1J A;  3KPE A;  3A2A A;  1NWQ A;  3VTP C;  3HE5 B;  1IO4 A;  1URQ A;  5AVQ B;  2KP8 A;  3TNU A;  2WPR A;  2M8R A;  1NU1 K;  1X8Y A;  1YTZ I;  5BVZ A;  1L4A B;  1LWU B;  2WIT A;  4Y99 B;  1L0L K;  3BRV B;  3U59 A;  1HUC A;  5AW8 B;  5KJ7 A;  3TYY A;  1LTI C;  2WSC H;  1FAV A;  4LLH A;  5AVV B;  5CCG D;  2WT7 B;  1DX7 A;  5AVY B;  2H8P D;  3HUS A;  3SWY A;  2L5G B;  1NHL A;  5CJ4 A;  1MZ9 A;  1T3U A;  1J1E C;  1KIL C;  4O9B A;  1X9V A;  5AVZ B;  2N1T C;  1ZLL A;  1QL2 A;  3UIA A;  3M0D C;  3BRT B;  1N2D C;  1RF1 B;  1N7L A;  4GIF A;  1M7L A;  2NPS B;  1OXZ A;  2OYI C;  1G2C B;  1SFC A;  2XU6 A;  5AVT B;  3RK3 B;  4I1L A;  3U1A A;  2R5B A;  1LTA C;  1GW3 A;  1FZC C;  2J59 M;  1LTT C;  1JTH A;  5APU A;  2O1K A;  4N3Y B;  3HD7 D;  1M1J B;  3B5N A;  3HD7 C;  2C0W A;  5CCH A;  2FFD B;  3G3Z A;  5AW5 B;  1X79 B;  1GTW A;  1NKZ B;  2FFD C;  2LKM A;  3V2N A;  3TK1 A;  3B8E B;  1HH0 A;  1L4A C;  1SFC B;  2KB7 P;  2YNY A;  1FZB A;  1MUU A;  3GHG C;  1JY3 P;  1S9K E;  1JY2 O;  1SLQ A;  1IFD A;  1XTG B;  4HYT B;  3RL0 B;  3VMY A;  3NMD A;  4XE5 B;  4DOJ A;  3RK2 C;  1T8Z A;  1LTJ B;  3B5N B;  1GL2 C;  2NPS A;  2HPC B;  1AFO A;  2ZFC A;  1HTL C;  3H32 B;  1G1I A;  4N6J A;  4C46 A;  4JYC A;  3RL0 D;  4AYC A;  1J1E B;  3VN0 A;  1J1D B;  5AVU B;  2GM4 A;  2IFM A;  5APQ A;  2M3B A;  1RF0 C;  1JUN A;  4HH2 A;  1RF1 C;  2H43 A;  4C7N A;  5AVR B;  1HJB A;  4XA4 A;  5CJ0 A;  2C9N Y;  2A45 I;  1ZR2 A;  3A3Y B;  1ZV8 A;  2PAJ A;  4EIJ A;  1W2E A;  5APX A;  1A02 J;  2WSE H;  1FZC B;  1LTS C;  1IFM A;  1SQP K;  2IPP A;  5AVW B;  1H89 A;  2ZXE B;  3P32 A;  3PP5 A;  1RE3 A;  1LGH B;  4ZKP A;  1J2J B;  2BAS A;  1SFC D;  2Z4E A;  1SFC C;  3T97 A;  2C9L Y;  3VP9 A;  5APW A;  1KFN A;  1NOH A;  4IFM A;  3L4F A;  2I1J A;  5AVS B;  1LT9 C;  2W6B A;  2YO3 A;  1FBM A;  2OAR A;  2POH A;  3P8C E;  1SQQ K;  5KTB A;  2Q3I A;  3RK2 B;  4JF7 A;  1LTJ C;  3B5N D;  3WMM 0;  5CCH D;  3V2P A;  3HE5 A;  4N78 E;  1G1J A;  2CPS A;  1KIL D;  2WTY A;  1N86 A;  1ZR4 A;  1JTH B;  1CI6 A;  1IFJ A;  1A02 F;  3MGN A;  1JMM A;  2KYV A;  3RK2 D;  3V2Q A;  1PFI A;  1JY2 P;  3VOP A;  2Z5I A;  1Z56 A;  4IFF A;  2HFE D;  5BU5 A;  1SQB K;  5AVX B;  1DEB A;  2QM8 A;  3M06 A;  4AQR D;  3OJA B;  1CSB A;  2P7J A;  2H7H A;  3E1I A;  4OH8 B;  1RE4 C;  3M9Q A;  1OWA A;  2NPS D;  4LC1 A;  2N9B A;  1T2K D;  1LTJ A;  2JJL A;  3V2R A;  4IFD K;  2HPC A;  1YTZ T;  3N4X A;  2XZR A;  1KFM A;  3OA7 A;  2C0X A;  1S9K D;  2VRS A;  1CZQ A;  4WY4 D;  4KHX A;  2R3C A;  3SWF A;  1LTB C;  4WY4 C;  2OYH A;  2W27 A;  2A45 G;  3LID A;  4W80 A;  5AW2 B;  1GD2 E;  1FZA A;  2R5D A;  2WPS A;  3M0D A;  3BVH A;  3V4Q A;  4I6M C;  2WWW A;  1N73 C;  3LW5 H;  2PP6 A;  2XNX A;  3VMZ A;  4N78 D;  1KZU B;  1N7S A;  3HTK B;  2XV5 A;  3M9H A;  1GL2 D;  1RF1 A;  1FZF A;  1SQX K;  3CL3 D;  4GKG A;  3OAK A;  5APY A;  2XDJ A;  1IFI A;  2N1T B;  1FZC A;  1FOS F;  3N7N A;  2I1K A;  4RES B;  1ZN5 A;  5AW9 B;  4C7N B;  1YYC A;  2OYI B;  1MV8 A;  4W7Z A;  2Q5U A;  1FJK A;  3VYI A;  1L0N K;  4GT1 A;  1JCD A;  1URQ C;  3CLQ A;  2KSJ A;  1AQ5 A;  1JY3 O;  4EOT A;  1FU1 A;  1FZG A;  4JYB A;  3HD7 B;  1XTC C;  1KIL A;  3HE4 A;  4LGD E;  2Q7C A;  2WT7 A;  1LT9 A;  2XKM A;  5AW6 B;  2KLV A;  3LIE A;  1H88 A;  3MUD A;  3R2P A;  2OYI A;  5AW1 B;  3KYQ A;  1VDF A;  1NH4 A;  2YO2 A;  1T2K C;  2FYU K;  2FXM A;  3II6 A;  1MFZ A;  1NTK K;  3M91 A;  1IC2 A;  1FZE A;  2JEE A;  3GHG B;  2YMY A;  2GUV A;  1GK6 A;  3MTU E;  4WB4 A;  1QL1 A;  2N1T A;  1N73 B;  1L4A D;  1VPC A;  1SP4 A;  3KQG A;  1G2C A;  5CMZ A;  4B86 A;  3BAS A;  2HLO A;  1GL2 B;  2IFN A;  3NTN A;  2W6A A;  1LTG C;  3B5N C;  3HE4 B;  5CCH C;  1HBW A;  3VMX A;  2A45 H;  1EQ7 A;  3C9I A;  2Q9I A;  1FDM A;  1CI6 B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...