1FZCA

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 29
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcA00
3HUSA 1FZFA 1LWUC 1LT9C 1JY3N 2OYHB 1M1JA 2HODA 2HPCB 1RE4A 1LWUB 1JY2O 1LT9B 1N73C 1N86A 1RE3C 1N73B 3GHGC 2HODB 1JY2P 2HPCA 3BVHA 2OYHA 1LWUA 1T3UA 1RF1C 1FZGA 1LT9A 3GHGB 1N73A 2Q9IA 1W2EA 2H43A 1RE3A 1RF1B 3H32B 1FZCC 1LTJC 3GHGA 2Z4EA 1RF1A 1LTJB 3H32A 2OYIC 1FZCB 2A45H 1JY2N 1FZEA 2A45G 2FFDC 1JY3O 2HLOA 2OYIB 1RF0C 1FZCA 1LTJA 2FFDB 1JY3P 3HUSC 2A45I 2OYIA 2XNXA 2FFDA 3E1IA 1M1JC 3HUSB 1RF0A 1FZAA 1RE4C 1FZBA 1M1JB 2OYHC
chains in the Genus database with same CATH superfamily
4D6TJ 1NTMK 1S72P 5B66H 2N1TD 2FYNC 4H0LD 2ZT9C 1J1DC 3CMAP 3ITKA 2QA4P 2WPSA 3A5TA 4PJ0E 3CCRP 2A06E 1NWQA 4JF7A 1L0NE 3L71E 1FZGA 5BU8B 1URQA 3FWNA 4KHXA 3USSA 2KNCB 2YMYA 1NTZK 2AXCA 1SQQD 4PV1C 1KQFB 2Q5UA 3D71A 3E7KA 3V5BA 5KLVD 1NJIQ 5AW6B 3A7OA 2K9YA 2WSSH 4OWFA 4HJGH 3KZIE 3VYIA 1S9KD 3L73D 4R4LA 5APUA 2K3RA 2IX7C 1KYOD 1FJPA 2N9BA 3RL0B 1PIXA 1Q86Q 4MN4C 1MFZA 2E74D 2NRGA 1HTLC 3TYYA 1K8AQ 2FBWC 1NU1J 2V7QH 3V4WA 2KS1B 5AVVB 3RK2D 1NTMD 3CC2P 1JCDA 2B9BA 1E79H 1KILA 2M5AA 1GL2D 3BCCJ 2NPSB 2FFDC 1HH0A 1SQVK 3HD7A 2PP6A 2ZYDA 2WITA 1KN7A 2WPQA 1QGKB 2A06G 1KD1Q 1N7SC 5AW3B 1ZMEC 1RE3C 1L0NG 2IBZE 2O01N 2ZFCA 1LT9A 2ITAA 1NO4A 3L36A 3L72G 3VP8A 1A02F 2QJPC 1L4AB 3RL0g 4OGQD 1NTKK 1FOSF 2R3SA 2WWWA 1NTZD 3H1LD 4GDOA 1PGOA 1JY2O 4IFFA 3MTUE 2G8YA 1KQLA 1MV8A 1K73Q 3OAKA 2QIWA 1VQ9P 1DEBA 2QM8A 1AVYA 2KNCA 2YXRB 3O6QB 1GW3A 3F89A 1SVFA 3S9OA 4CPGA 1JUNA 1P84D 2P67A 5CJ0A 3NFQA 4Y99C 1VQ6P 1EZVE 2Y0EA 5KLIC 4IFMA 2Y0DA 1DD4A 4AYCA 1NOHA 4AUWA 4PD4E 4RKUJ 2OYHB 4WWIA 2KSEA 1WMKA 3BRVB 2A45G 3BASA 4EIJA 3P8MC 3PLNA 3OW2O 1SQVD 4ZMDA 3H1IE 1N73B 2IBZG 3VP9A 2KS1A 3L74E 1EDLA 1SS1A 2NPSA 1IFDA 1R5LA 1QL2A 3JSVC 5M1BA 3L75E 2ZT9D 4H13C 2BEQD 3SFEC 1JY3N 4ZKUA 4IL6H 1NTKD 3BRTB 1VQOP 4K35A 4EDFA 3G4SP 1PPJE 3P8CD 4HYTB 3L70E 4W7ZA 1T2KC 3H1JD 1L4AA 1HJ0A 2P2UA 3CL3D 5CBNA 3ABVC 5CCHC 2KZIA 1SQBG 1BSNA 4BXLA 4GOEA 2E76C 1EZVG 2QEXP 1CSBA 4YPCA 5CJ4A 1QX8A 2LKMA 4H44C 1YJ9P 1M1KQ 2R3CA 1YYCA 2WSEJ 2A06D 2FXOA 1RY3A 2K88A 3O6QA 2KLUA 3L71D 3H1KJ 3C9IA 1YTZT 3V2NA 4IL6E 1M57D 1AV1A 1PL5A 3GMAA 3H1IG 2PFXA 2WSFJ 1HBWA 1KMIZ 4IOIH 2OYHA 1YITP 2QSIA 3B4SA 1N8RQ 2OTJP 3L74G 2GM4A 1FZEA 4ASVA 1QLED 5AW5B 4H0LB 3L75G 2P7JA 2P1JA 3U1CA 1KTMA 1JB0J 1EDIA 1S5LX 3CCEP 2AEMA 4PD4I 2M3BA 4U7JA 1N73A 1JO5A 1N2DC 1PPJG 2KOGA 1FZCB 2P58A 3L70G 5KAFE 1N7SD 2IZ0A 3CCMP 1OIPA 1P84H 2IYOA 1VF5C 3B8EB 5AW9B 1LWUC 3CD6P 3G71P 4XE5B 2Q1KA 4RO0A 5TISH 2IZ1A 4YTPC 1EDKA 1UIXA 2I1KA 3A0HH 2Q3IA 3H25A 1GL2C 4LLHA 3AE9C 1RE4A 2CPSA 2KP8A 2IBZD 3V2PA 1Y47A 5KLVG 3QWOC 1X22A 2ZYGA 2OYIB 2W27A 1LTJA 5APSA 2BEZF 1HF9A 2H88C 1VQ5P 2LXCB 1BCCE 3OJAB 1M56D 4NPDA 3JCUH 2RKLA 3AE7C 1S1CX 1CW5A 4EI2A 3PTZA 1NKNA 2W8ZA 1X0TA 2W6AA 3A3YB 4BRYB 1KILE 5TISE 2JP3A 3S4RA 2YO3A 3A0HE 4L74A 1W2EA 4TLFA 1YQ3C 1HGVA 1FBMA 1FE6A 1EZVD 5EFWB 5L8RJ 1YTZI 1OXZA 2J59M 1SQVE 2I1JA 3IFMA 1W5CE 2BCCE 1LNQA 4PD4D 3NMDA 4OGQB 1LTBC 1KILC 2O01J 5KJ7C 3GHGB 2Q9IA 1L0NJ 2ZJSE 2Z5IA 3Q1MA 3WUVA 3HD7C 3L72J 4H13D 1FJKA 3PP5A 3HUSB 3JC22 3I5CA 3B5NB 1IFPA 1OW8A 5H2FH 3JCUE 1LT9C 2XNDH 1NTKE 1T2KD 1GZLA 3MIWA 3P8CE 3L74D 1ZRTD 3H1JE 1BGYJ 5CCHD 5BU5A 1S3JA 5CCGA 3TGUE 1HUCA 2WVRA 1BCCG 1GU4A 1SQPE 2UWJE 3KZIH 2E76D 2ZYAA 2L91A 2ZVOB 3V6IA 2QJKB 1PPJD 4H44D 5DJTB 1SQXE 3L70D 3CX5E 1LJ2A 2OYIA 3NXSA 1LTAC 2JWAA 3FGAD 2IDBA 2C9LY 3KDPB 2KZJA 3U1AA 5H2FE 1Q2NA 1RF0A 4BRYA 3P7KA 1SQVG 2A45H 2POHA 2BCCG 2RN0A 2HG5D 1K9MQ 1GK6A 1BE3E 2FYUE 1GDTA 2N9YB 4I2LC 3RL0C 2FYNB 3CC7P 1IJDB 2H89C 3AEAC 3QH9A 1QVGO 1J1DB 3LW5J 2LXBA 2PRRA 1GMJA 2QJYC 2M0BA 3E1RA 3MGNA 3G6EP 1OW7A 1NTKG 1A02J 1KFMA 3L4FA 3R4YA 3HTKB 2ZVNB 3GHGA 3AE1C 3GG2A 4U3FE 3A2AA 1PP9E 3CMEP 1VF5D 3H1JG 3CWBE 3EFGA 2V7QJ 3PH0A 3TDKA 4D6TE 3TGUG 1FZBA 1QVFO 1OVUA 3HUSA 1MZ9A 1DIPA 3B5NA 1SQPG 3SWYA 3H1HJ 2BASA 4PV1B 1KB9I 1SQBJ 1DD3A 2E43A 1L4AC 1SQXG 3TSIA 3KPEA 3IR9A 1L0LJ 1USEA 2KLVA 3WUUA 3FX0A 5AW0B 1JCCA 4RESB 5CMZA 3L71G 1ZW0A 4PD4H 3GW6A 1PV3A 1H88A 3T97B 1J1EB 1RH5B 2V4HA 1HJBA 1JNMA 1Z56A 5AW8B 2K9JB 2FYUG 1NVOA 4WY4C 3H1IJ 2MJZA 3PHLA 1FDMA 3M9HA 1J2JB 1OMIA 2YIUB 2OTKE 2FFDB 2WQYC 1FAVA 1ZXGA 3CX5I 1Q90D 2OYHC 3L75J 1SQPK 3RK3B 4ZKPA 1BCCD 1OFCX 2GA1A 3A0BH 4U3FG 3VMAA 2KXPB 1SQXK 2JDIH 3W68A 1ZN5A 2QE7H 2JR8A 2QJPB 1JY3P 1NU1E 4C7RA 3HE5B 4D6TG 1KILD 2HYNA 5KJ7D 2E5TA 2AEFA 4WB4A 1NHLA 2W6JH 5TJHA 5AVZB 2C0WA 3HD7D 1YI2P 3BCCE 3HTKA 3AE2C 5KKZB 3CCJP 3B71A 1IK9A 1YHQP 1Q7YQ 3M06A 1ZV8A 4JYBA 2FYUK 2YKPA 3MHVA 2BCCD 2P10A 1LT1A 1SQQJ 3C1LA 1NKZB 2XDJA 1SFCB 4GKGA 3HE4B 5KLVJ 2E75C 1VQPP 5KAIE 4LC1A 4Y99B 1ZRTE 4N6JA 3KHUA 1HVVA 1M1JB 2IFMA 3VMXA 3Q5SA 3P32A 3A0BE 3L73J 4KT0J 1XTCC 1RF1B 3TNUB 1IFIA 1LTJC 3FXDA 1VQLP 1JY2N 4L73A 1JTHB 3T97A 2WZ7A 2Q6QA 3CCSP 4DZOA 3KQGA 3V2RA 3TGUD 1PGQA 2K9JA 1BDCA 2ZXXA 1SQPD 2E5YA 5BVZA 1NTMJ 1R5SA 1M90Q 1NU1G 1SQXD 3CX5D 2FFDA 5KAFH 1LTTC 2OYOA 3RL0D 1U7MA 1JMMA 3EWKA 5AVXB 2QG4A 1BDDA 1RE3A 3AEDC 4EOTA 3S1KA 2PAJA 1KQGB 3M91A 2AXTH 2JKVA 3Q2YA 3HE5A 1EDJA 2IFNA 1FZFA 2OARA 1GW4A 3CI9A 1S5LE 1BE3D 1NTZJ 2NPSD 2FYUD 3H1LJ 3I56P 1ZR2A 3N7NA 2R32A 3M0AA 2B89A 1JEKA 1YBKA 4KJMA 2E76B 2N1TB 4HH2A 2H7HA 1H89A 1PZQA 4H44B 3AE3C 1YJWP 2FYZA 1L4AD 2WSFH 2ZAEB 1T3UA 4I7ZB 1IFMA 1IC2A 2QM7A 1SFCA 4U3FD 3HE4A 1PP9D 1NU1K 4N78E 3BATA 1YIJP 3SFDC 1BSHA 3CLQA 5CCGC 1KV4A 1VQ7P 1LTGC 3CWBD 5GTHH 4D6TD 1Y8AA 1MFTA 1M1JA 1R8EA 1N86A 4UB6H 2E42A 1IFNA 5AW4B 4WVZA 1PGJA 1RF1A 2OYIC 2AXTE 5GTIH 3EQ2A 1JTHA 2M8RA 4WY4D 2JEEA 1PGPA 2HR3A 4A7PA 1SQVJ 1URQC 2L5GB 3MD0A 2O3JA 3V4QA 1KB9H 1PFIA 3LIDA 3M0DA 1K05A 2R44A 5K5GB 2WSCH 1AA0A 2E74B 1AJYA 1LWUB 1VQNP 3I55P 1NTKJ 3UIAA 2D2CC 5APVA 1IO4A 1FS0E 4GOFA 2RMZA 5GTHE 3RK2B 4EYYQ 3TF5A 2KSJA 3LIEA 4XFJA 2IYPA 3H1JJ 2LR2A 1OX3A 1AQ5A 1GL2B 4UB6E 3U59A 3Q5PA 2HPCB 2OQQA 3GHGC 3AEBC 1YQ4C 5GTIE 5APYA 2Q3EA 3WU2H 1ZLLA 5AVUB 3HUSC 1NU1D 2N1TA 3II6A 5AVYB 1G2CB 3B5NC 3CX5H 5AVTB 3K5BA 1KB9E 2E75D 3RBXA 3BCCD 3L71J 2KK7A 4ASWA 1HGZA 5B5EE 1FZCA 1N7LA 1TU3F 1EXJA 1VL2A 3PJSK 2C9NY 1VQKP 3D70A 2SPZA 1KYOI 2Y0CA 4BWNA 2PGDA 1M7LA 3CCQP 2OGUA 4UB8H 4B86A 1ZOYC 3L35A 1KQSO 4JYCA 2OTLP 1SLQA 4OH8B 5AVSB 3L37A 3WU2E 3AEGC 3CXHI 3VN0A 3OA7A 1X9VA 2Y9ZA 4RJTA 4L76A 3VMYA 3D6YA 2HODB 4JPZB 1VPCA 1LT9B 3SWKA 3H6PA 1LWUA 2H43A 3GF3A 1LTIC 2Z4EA 4ZNCA 1ZR4A 5AVWB 1KFNA 1IZNB 3HRNA 1GL2A 2HPCA 2GUVA 3H32B 2WT7B 2ZT9B 3L72E 4UB8E 3M9BA 1G1IA 1S2EA 2JJLA 5APTA 1L2PA 3CPWO 3WMM0 1G2CA 4DCKA 3RBZA 3AEFC 1OW6A 5CCGD 1Q81Q 4LGDE 5APWA 5KTBA 2NPSC 1P84I 3LW5H 1BGYE 3ZDMA 1G1JA 5B66E 3CCVP 2B88A 1FU1A 5AW1B 4JQ0D 2C0XA 1KZUB 1LP1B 2JO1A 2GUSA 2R5DA 1J1EC 4N78D 3RK3E 4DOJA 1D7MA 1H0TB 1URQD 4HB1A 1MKMA 2QJYB 1NAFA 3AE8C 2Q7CA 1WT6A 1LGHB 2R5BA 3N4XA 5AW7B 1HWTC 4QMAA 3CXHD 2O1KA 2YIUC 2YKQA 2YO2A 5KJ7A 1FDIA 3R2PA 2DW3A 3CCLP 3MZWB 3CC4P 3VOPA 3RK3C 2D2CD 2HODA 1BE3G 2G3AA 2J58A 3G3ZA 4TT3H 2M3EA 3H1KD 4C46A 2YNYA 1KORA 2NZ2A 1JY3O 3MUDA 3L74J 1AFOA 2XU6A 3VTPC 2I8DA 4YXDC 5KAIH 4YXWH 5AVQB 1QL1A 1N7SB 2K1AA 1AQTA 4W7YA 2MKVA 1FOSE 2VRSA 5KKZC 1PP9G 3H32A 3B5ND 2WT7A 1BGYG 1GU5A 3GF7A 3IAOA 3CWBG 2O1JA 1EQ7A 3L70J 3MP7B 3E1IA 2KYVA 3H1HE 1LTSC 1N73C 1JY2P 1U57A 4WY4B 1SFCC 1SQBE 1NGMB 4Y28J 1DEEG 2H8PD 2HLOA 2WMMA 4DT0A 1L0LE 4N3YB 1M1JC 1IFJA 1OVVA 1USDA 1L0NK 4OVNF 2IPPA 1KB9D 1RF1C 3FXEA 1LP1A 4O9BA 1EXIA 1IK7A 5KLIB 1RE4C 1H0TA 1UIIA 1KC8Q 1EC5A 3PRJA 1S5LH 2Y9YA 4GT1A 3M0DC 1NH4A 1X8YA 2W90A 2FXPA 5CBOA 4C7NB 1T6AA 1SP4A 1FDOA 2YXQB 3Q5RA 1JOCA 1U7JA 2QRXA 1KYOH 4WBAA 2E75B 4K3AA 2J5UA 2A45I 3AE4C 1FZAA 5DJUB 3H1HG 1CI6B 4H13B 4GODA 3AEEC 1K04A 1N7SA 2IBZI 3BCCG 5AVRB 1CZQA 1LTJB 1VQ8P 4NPFX 2N1TC 1L0LG 3CXHH 4H0LC 2XKMA 4PV1D 1WRGA 2AEJA 1VQ4P 1GTWA 1NAYA 1SQQE 3AECC 4I7ZC 2WSEH 3BVHA 1L0ND 5KLVE 4WY4A 1Q82Q 1FZCC 3L72D 2W83C 5E79H 1QEXA 2XNXA 3CCUP 1S9KE 3WUTA 3L73E 4I6MC 1X79B 1KYOE 1BCCJ 2HFED 2KIKA 3AE6C 2FY8A 1BGYD 3V2QA 1EZVI 3F5HA 2WTYA 4IL6X 3NTNA 1SQBK 2JWDA 1NTME 3D6ZA 3CXHE 2B87B 1L0LK 3FWLA 3TNUA 5APXA 3RK3D 4L75A 3TK1A 2CK3H 2W6BA 2E74C 4GIFA 4C7NA 2XV5A 2BCCJ 5E79E 3H1KE 1GD2E 3RK2C 4W80A 1OVRA 2KB7P 1RF0C 4NPEA 2WSCJ 4IFDK 1S4XA 2RH0A 1NTZE 3H1LE 2XZRA 5B5EH 1W2BO 2WPVB 1SQQG 5APQA 1VF5B 4Z1MH 1FC2C 1CI6A 3O8ZA 5CHXA 1DX7A 4HKZH 1RQVA 3IF4A 3M9QA 4R4MA 1SFCD 3KXDA 3W67A 2ZXEB 3SSUA 3L73G 1MUUA 2KUBA 2QVAA 4OGQC 3TGUJ 1URQB 1SQPJ 4DJGA 1OWAA 1JM0A 2KI7B 5CCHA 4M3LA 1P84E 3Q3DA 3IN6A 3GLMA 4XA4A 1SQXJ 1RHZB 2WPRA 3SWFA 3H1HD 5AW2B 1AVOA 2FXMA 1NTMG 4I1LA 1SQBD 1H8AA 2D2CB 2FKWB 2YKOA 4AQRD 1L0LD 1YJNP 3EFFK 2Z5HA 1SQQK 1RQUA 1GK4A 4PJ0H 5KLVK 2YMKA 3RGUA 1BE3J 2FYUJ 3C8VA 1DH3A 3H1KG 2O01H 1E5WA 1M8OB 4JBZA 2QJKC 3VMZA 2B87A 5C39A 1XTGB 3H1LG 1NTZG 1JMBA 1NYHA 3H1ID 1VQMP 1T3JA 1Y9BA 2CPBA 1KILB 2M5AB 3KYQA 3MUDC 1T8ZA 1OZHA 1VDFA 1ZP0C 4U3FJ 1PP9J 3HD7B 2K37A 3G9RA 3L75D 3CWBJ 3AE5C
chains in the Genus database with same CATH topology
4LLHA 4DZOA 3KQGA 3RK3C 3V2RA 2HODA 1RE4A 1NTMK 2J58A 2CPSA 3G3ZA 2KP8A 2N1TD 3V2PA 5BVZA 1J1DC 4C46A 2YNYA 1JY3O 3MUDA 2OYIB 2W27A 1LTJA 5APSA 2WPSA 3A5TA 1AFOA 2FFDA 2XU6A 1LTTC 3RL0D 3VTPC 5AVQB 1QL1A 1NWQA 1JMMA 1N7SB 4W7YA 3OJAB 4JF7A 5AVXB 1FZGA 5BU8B 1URQA 1RE3A 4EOTA 1FOSE 1CW5A 2VRSA 3H32A 3B5ND 2WT7A 1NKNA 2PAJA 1GU5A 2W6AA 4KHXA 3A3YB 2O1JA 1EQ7A 3M91A 2YMYA 1NTZK 3E1IA 3HE5A 2KYVA 2IFNA 1FZFA 2OARA 1GW4A 3CI9A 1LTSC 1N73C 2NPSD 1JY2P 2Q5UA 1ZR2A 4WY4B 3N7NA 1SFCC 2R32A 2YO3A 1W2EA 3V5BA 3M0AA 5AW6B 2H8PD 3A7OA 2HLOA 1HGVA 1FBMA 2N1TB 4N3YB 4HH2A 2H7HA 1YTZI 1H89A 1M1JC 1IFJA 1OXZA 3VYIA 2J59M 1S9KD 1L0NK 2I1JA 3IFMA 2FYZA 3NMDA 2IPPA 1LTBC 1L4AD 2WSFH 1KILC 1T3UA 2IX7C 5APUA 1RF1C 5KJ7C 3GHGB 1FJPA 1IFMA 2Q9IA 1IC2A 2N9BA 3RL0B 2QM7A 2Z5IA 1SFCA 3HE4A 1MFZA 1NU1K 4N78E 1HTLC 3BATA 3HD7C 4O9BA 3CLQA 5CCGC 3TYYA 1FJKA 1LTGC 3PP5A 3HUSB 1RE4C 3I5CA 3V4WA 3B5NB 1LT9C 1M1JA 1N86A 5AVVB 3RK2D 2E42A 1IFNA 1JCDA 5AW4B 1T2KD 1GZLA 3MIWA 4GT1A 1KILA 3M0DC 1RF1A 1GL2D 1NH4A 2OYIC 3P8CE 2NPSB 2FFDC 3EQ2A 1JTHA 1HH0A 1SQVK 1X8YA 2M8RA 4WY4D 2JEEA 3HD7A 5CCHD 2PP6A 5BU5A 5CCGA 2WITA 2WPQA 4C7NB 1SP4A 1N7SC 5AW3B 1HUCA 1JOCA 1URQC 1RE3C 1GU4A 2L5GB 3MD0A 2ZFCA 1LT9A 1NO4A 3V4QA 3L36A 3VP8A 1PFIA 1A02F 3LIDA 4WBAA 1L4AB 2A45I 3M0DA 2OYIA 3NXSA 1LTAC 1FZAA 2WSCH 1NTKK 1FOSF 2WWWA 2C9LY 1CI6B 1JY2O 1LWUB 4IFFA 3KDPB 1N7SA 3UIAA 3MTUE 1KQLA 1MV8A 3OAKA 5APVA 5AVRB 1CZQA 1LTJB 1IO4A 2N1TC 3U1AA 3RK2B 1DEBA 2QM8A 2KSJA 2XKMA 3LIEA 1RF0A 3P7KA 1WRGA 2A45H 1AQ5A 1GL2B 2POHA 1GTWA 3U59A 2HG5D 1GK6A 2HPCB 1GDTA 3GHGC 2WSEH 3BVHA 1GW3A 4I2LC 3RL0C 1SVFA 1IJDB 4WY4A 1FZCC 1J1DB 1JUNA 2P67A 5CJ0A 3NFQA 4Y99C 5APYA 1ZLLA 5AVUB 3HUSC 4IFMA 2XNXA 2N1TA 3II6A 5AVYB 1G2CB 3B5NC 4AYCA 1NOHA 3MGNA 4AUWA 1S9KE 2OYHB 1A02J 1KFMA 5AVTB 3L4FA 4I6MC 1X79B 3HTKB 2HFED 3GHGA 3BRVB 3A2AA 2A45G 3BASA 4EIJA 1HGZA 1FZCA 3V2QA 3P8MC 3EFGA 1N7LA 2WTYA 1FZBA 3HUSA 1MZ9A 2C9NY 3NTNA 1SQBK 3B5NA 3SWYA 1N73B 3VP9A 2BASA 1L0LK 2E43A 1L4AC 3TNUA 1M7LA 3TSIA 3KPEA 5APXA 3RK3D 2NPSA 4B86A 3TK1A 1IFDA 2W6BA 3IR9A 3L35A 1QL2A 2KLVA 4JYCA 4GIFA 1SLQA 5AW0B 1JCCA 1JY3N 4OH8B 4ZKUA 4RESB 4C7NA 2XV5A 5AVSB 5CMZA 3L37A 3BRTB 1GD2E 3VN0A 3OA7A 3RK2C 3P8CD 1X9VA 1H88A 4HYTB 4W80A 2KB7P 4W7ZA 1J1EB 1RF0C 1T2KC 3VMYA 1HJBA 1L4AA 4IFDK 1JNMA 2HODB 1Z56A 5AW8B 2XZRA 2P2UA 3CL3D 1VPCA 1LT9B 5APQA 4WY4C 5CCHC 3H6PA 2MJZA 1FDMA 1CI6A 1LWUA 3O8ZA 3M9HA 2H43A 5CHXA 1DX7A 1J2JB 1LTIC 2Z4EA 1ZR4A 5AVWB 3M9QA 2FFDB 1CSBA 5CJ4A 1KFNA 1FAVA 2LKMA 1SFCD 2OYHC 2ZXEB 3HRNA 2R3CA 1SQPK 1MUUA 1YYCA 1GL2A 3RK3B 4ZKPA 1RY3A 1URQB 2HPCA 2GUVA 3H32B 2WT7B 1OWAA 5CCHA 4M3LA 1SQXK 3M9BA 1ZN5A 3C9IA 1G1IA 1YTZT 1JY3P 2JJLA 4XA4A 5APTA 3V2NA 4C7RA 3HE5B 3WMM0 1KILD 2HYNA 5KJ7D 2WPRA 1G2CA 4WB4A 1NHLA 3SWFA 5AW2B 5AVZB 2C0WA 2FXMA 1HBWA 2OYHA 3HD7D 4I1LA 5CCGD 1H8AA 4LGDE 5APWA 5KTBA 3HTKA 2NPSC 2GM4A 1FZEA 2FKWB 2YKOA 3LW5H 4AQRD 1IK9A 5AW5B 1G1JA 3M06A 1ZV8A 2Z5HA 2P7JA 2P1JA 2FYUK 4JYBA 1SQQK 3U1CA 2YKPA 1GK4A 5KLVK 1FU1A 5AW1B 2M3BA 2C0XA 1N73A 1KZUB 1DH3A 1NKZB 2XDJA 1SFCB 4GKGA 2O01H 3HE4B 1JO5A 1E5WA 1N2DC 2KOGA 1FZCB 3VMZA 2GUSA 2R5DA 1J1EC 4N78D 4LC1A 4DOJA 4Y99B 1N7SD 1URQD 4N6JA 1XTGB 1HVVA 1M1JB 1NAFA 2IFMA 3VMXA 3B8EB 5AW9B 1LWUC 3P32A 2Q7CA 1WT6A 1LGHB 2R5BA 1T3JA 3N4XA 4XE5B 5AW7B 1HWTC 1XTCC 2CPBA 1KILB 1RF1B 2O1KA 3KYQA 3TNUB 1IFIA 1LTJC 2YKQA 1T8ZA 2YO2A 5KJ7A 2I1KA 1VDFA 1JY2N 2Q3IA 3R2PA 1JTHB 3HD7B 3T97A 2WZ7A 1GL2C 3VOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS A;  1FZF A;  1LWU C;  1LT9 C;  1JY3 N;  2OYH B;  1M1J A;  2HOD A;  2HPC B;  1RE4 A;  1LWU B;  1JY2 O;  1LT9 B;  1N73 C;  1N86 A;  1RE3 C;  1N73 B;  3GHG C;  2HOD B;  1JY2 P;  2HPC A;  3BVH A;  2OYH A;  1LWU A;  1T3U A;  1RF1 C;  1FZG A;  1LT9 A;  3GHG B;  1N73 A;  2Q9I A;  1W2E A;  2H43 A;  1RE3 A;  1RF1 B;  3H32 B;  1FZC C;  1LTJ C;  3GHG A;  2Z4E A;  1RF1 A;  1LTJ B;  3H32 A;  2OYI C;  1FZC B;  2A45 H;  1JY2 N;  1FZE A;  2A45 G;  2FFD C;  1JY3 O;  2HLO A;  2OYI B;  1RF0 C;  1FZC A;  1LTJ A;  2FFD B;  1JY3 P;  3HUS C;  2A45 I;  2OYI A;  2XNX A;  2FFD A;  3E1I A;  1M1J C;  3HUS B;  1RF0 A;  1FZA A;  1RE4 C;  1FZB A;  1M1J B;  2OYH C; 
#chains in the Genus database with same CATH topology
 4D6T J;  1NTM K;  1S72 P;  5B66 H;  2N1T D;  2FYN C;  4H0L D;  2ZT9 C;  1J1D C;  3CMA P;  3ITK A;  2QA4 P;  2WPS A;  3A5T A;  4PJ0 E;  3CCR P;  2A06 E;  1NWQ A;  4JF7 A;  1L0N E;  3L71 E;  1FZG A;  5BU8 B;  1URQ A;  3FWN A;  4KHX A;  3USS A;  2KNC B;  2YMY A;  1NTZ K;  2AXC A;  1SQQ D;  4PV1 C;  1KQF B;  2Q5U A;  3D71 A;  3E7K A;  3V5B A;  5KLV D;  1NJI Q;  5AW6 B;  3A7O A;  2K9Y A;  2WSS H;  4OWF A;  4HJG H;  3KZI E;  3VYI A;  1S9K D;  3L73 D;  4R4L A;  5APU A;  2K3R A;  2IX7 C;  1KYO D;  1FJP A;  2N9B A;  3RL0 B;  1PIX A;  1Q86 Q;  4MN4 C;  1MFZ A;  2E74 D;  2NRG A;  1HTL C;  3TYY A;  1K8A Q;  2FBW C;  1NU1 J;  2V7Q H;  3V4W A;  2KS1 B;  5AVV B;  3RK2 D;  1NTM D;  3CC2 P;  1JCD A;  2B9B A;  1E79 H;  1KIL A;  2M5A A;  1GL2 D;  3BCC J;  2NPS B;  2FFD C;  1HH0 A;  1SQV K;  3HD7 A;  2PP6 A;  2ZYD A;  2WIT A;  1KN7 A;  2WPQ A;  1QGK B;  2A06 G;  1KD1 Q;  1N7S C;  5AW3 B;  1ZME C;  1RE3 C;  1L0N G;  2IBZ E;  2O01 N;  2ZFC A;  1LT9 A;  2ITA A;  1NO4 A;  3L36 A;  3L72 G;  3VP8 A;  1A02 F;  2QJP C;  1L4A B;  3RL0 g;  4OGQ D;  1NTK K;  1FOS F;  2R3S A;  2WWW A;  1NTZ D;  3H1L D;  4GDO A;  1PGO A;  1JY2 O;  4IFF A;  3MTU E;  2G8Y A;  1KQL A;  1MV8 A;  1K73 Q;  3OAK A;  2QIW A;  1VQ9 P;  1DEB A;  2QM8 A;  1AVY A;  2KNC A;  2YXR B;  3O6Q B;  1GW3 A;  3F89 A;  1SVF A;  3S9O A;  4CPG A;  1JUN A;  1P84 D;  2P67 A;  5CJ0 A;  3NFQ A;  4Y99 C;  1VQ6 P;  1EZV E;  2Y0E A;  5KLI C;  4IFM A;  2Y0D A;  1DD4 A;  4AYC A;  1NOH A;  4AUW A;  4PD4 E;  4RKU J;  2OYH B;  4WWI A;  2KSE A;  1WMK A;  3BRV B;  2A45 G;  3BAS A;  4EIJ A;  3P8M C;  3PLN A;  3OW2 O;  1SQV D;  4ZMD A;  3H1I E;  1N73 B;  2IBZ G;  3VP9 A;  2KS1 A;  3L74 E;  1EDL A;  1SS1 A;  2NPS A;  1IFD A;  1R5L A;  1QL2 A;  3JSV C;  5M1B A;  3L75 E;  2ZT9 D;  4H13 C;  2BEQ D;  3SFE C;  1JY3 N;  4ZKU A;  4IL6 H;  1NTK D;  3BRT B;  1VQO P;  4K35 A;  4EDF A;  3G4S P;  1PPJ E;  3P8C D;  4HYT B;  3L70 E;  4W7Z A;  1T2K C;  3H1J D;  1L4A A;  1HJ0 A;  2P2U A;  3CL3 D;  5CBN A;  3ABV C;  5CCH C;  2KZI A;  1SQB G;  1BSN A;  4BXL A;  4GOE A;  2E76 C;  1EZV G;  2QEX P;  1CSB A;  4YPC A;  5CJ4 A;  1QX8 A;  2LKM A;  4H44 C;  1YJ9 P;  1M1K Q;  2R3C A;  1YYC A;  2WSE J;  2A06 D;  2FXO A;  1RY3 A;  2K88 A;  3O6Q A;  2KLU A;  3L71 D;  3H1K J;  3C9I A;  1YTZ T;  3V2N A;  4IL6 E;  1M57 D;  1AV1 A;  1PL5 A;  3GMA A;  3H1I G;  2PFX A;  2WSF J;  1HBW A;  1KMI Z;  4IOI H;  2OYH A;  1YIT P;  2QSI A;  3B4S A;  1N8R Q;  2OTJ P;  3L74 G;  2GM4 A;  1FZE A;  4ASV A;  1QLE D;  5AW5 B;  4H0L B;  3L75 G;  2P7J A;  2P1J A;  3U1C A;  1KTM A;  1JB0 J;  1EDI A;  1S5L X;  3CCE P;  2AEM A;  4PD4 I;  2M3B A;  4U7J A;  1N73 A;  1JO5 A;  1N2D C;  1PPJ G;  2KOG A;  1FZC B;  2P58 A;  3L70 G;  5KAF E;  1N7S D;  2IZ0 A;  3CCM P;  1OIP A;  1P84 H;  2IYO A;  1VF5 C;  3B8E B;  5AW9 B;  1LWU C;  3CD6 P;  3G71 P;  4XE5 B;  2Q1K A;  4RO0 A;  5TIS H;  2IZ1 A;  4YTP C;  1EDK A;  1UIX A;  2I1K A;  3A0H H;  2Q3I A;  3H25 A;  1GL2 C;  4LLH A;  3AE9 C;  1RE4 A;  2CPS A;  2KP8 A;  2IBZ D;  3V2P A;  1Y47 A;  5KLV G;  3QWO C;  1X22 A;  2ZYG A;  2OYI B;  2W27 A;  1LTJ A;  5APS A;  2BEZ F;  1HF9 A;  2H88 C;  1VQ5 P;  2LXC B;  1BCC E;  3OJA B;  1M56 D;  4NPD A;  3JCU H;  2RKL A;  3AE7 C;  1S1C X;  1CW5 A;  4EI2 A;  3PTZ A;  1NKN A;  2W8Z A;  1X0T A;  2W6A A;  3A3Y B;  4BRY B;  1KIL E;  5TIS E;  2JP3 A;  3S4R A;  2YO3 A;  3A0H E;  4L74 A;  1W2E A;  4TLF A;  1YQ3 C;  1HGV A;  1FBM A;  1FE6 A;  1EZV D;  5EFW B;  5L8R J;  1YTZ I;  1OXZ A;  2J59 M;  1SQV E;  2I1J A;  3IFM A;  1W5C E;  2BCC E;  1LNQ A;  4PD4 D;  3NMD A;  4OGQ B;  1LTB C;  1KIL C;  2O01 J;  5KJ7 C;  3GHG B;  2Q9I A;  1L0N J;  2ZJS E;  2Z5I A;  3Q1M A;  3WUV A;  3HD7 C;  3L72 J;  4H13 D;  1FJK A;  3PP5 A;  3HUS B;  3JC2 2;  3I5C A;  3B5N B;  1IFP A;  1OW8 A;  5H2F H;  3JCU E;  1LT9 C;  2XND H;  1NTK E;  1T2K D;  1GZL A;  3MIW A;  3P8C E;  3L74 D;  1ZRT D;  3H1J E;  1BGY J;  5CCH D;  5BU5 A;  1S3J A;  5CCG A;  3TGU E;  1HUC A;  2WVR A;  1BCC G;  1GU4 A;  1SQP E;  2UWJ E;  3KZI H;  2E76 D;  2ZYA A;  2L91 A;  2ZVO B;  3V6I A;  2QJK B;  1PPJ D;  4H44 D;  5DJT B;  1SQX E;  3L70 D;  3CX5 E;  1LJ2 A;  2OYI A;  3NXS A;  1LTA C;  2JWA A;  3FGA D;  2IDB A;  2C9L Y;  3KDP B;  2KZJ A;  3U1A A;  5H2F E;  1Q2N A;  1RF0 A;  4BRY A;  3P7K A;  1SQV G;  2A45 H;  2POH A;  2BCC G;  2RN0 A;  2HG5 D;  1K9M Q;  1GK6 A;  1BE3 E;  2FYU E;  1GDT A;  2N9Y B;  4I2L C;  3RL0 C;  2FYN B;  3CC7 P;  1IJD B;  2H89 C;  3AEA C;  3QH9 A;  1QVG O;  1J1D B;  3LW5 J;  2LXB A;  2PRR A;  1GMJ A;  2QJY C;  2M0B A;  3E1R A;  3MGN A;  3G6E P;  1OW7 A;  1NTK G;  1A02 J;  1KFM A;  3L4F A;  3R4Y A;  3HTK B;  2ZVN B;  3GHG A;  3AE1 C;  3GG2 A;  4U3F E;  3A2A A;  1PP9 E;  3CME P;  1VF5 D;  3H1J G;  3CWB E;  3EFG A;  2V7Q J;  3PH0 A;  3TDK A;  4D6T E;  3TGU G;  1FZB A;  1QVF O;  1OVU A;  3HUS A;  1MZ9 A;  1DIP A;  3B5N A;  1SQP G;  3SWY A;  3H1H J;  2BAS A;  4PV1 B;  1KB9 I;  1SQB J;  1DD3 A;  2E43 A;  1L4A C;  1SQX G;  3TSI A;  3KPE A;  3IR9 A;  1L0L J;  1USE A;  2KLV A;  3WUU A;  3FX0 A;  5AW0 B;  1JCC A;  4RES B;  5CMZ A;  3L71 G;  1ZW0 A;  4PD4 H;  3GW6 A;  1PV3 A;  1H88 A;  3T97 B;  1J1E B;  1RH5 B;  2V4H A;  1HJB A;  1JNM A;  1Z56 A;  5AW8 B;  2K9J B;  2FYU G;  1NVO A;  4WY4 C;  3H1I J;  2MJZ A;  3PHL A;  1FDM A;  3M9H A;  1J2J B;  1OMI A;  2YIU B;  2OTK E;  2FFD B;  2WQY C;  1FAV A;  1ZXG A;  3CX5 I;  1Q90 D;  2OYH C;  3L75 J;  1SQP K;  3RK3 B;  4ZKP A;  1BCC D;  1OFC X;  2GA1 A;  3A0B H;  4U3F G;  3VMA A;  2KXP B;  1SQX K;  2JDI H;  3W68 A;  1ZN5 A;  2QE7 H;  2JR8 A;  2QJP B;  1JY3 P;  1NU1 E;  4C7R A;  3HE5 B;  4D6T G;  1KIL D;  2HYN A;  5KJ7 D;  2E5T A;  2AEF A;  4WB4 A;  1NHL A;  2W6J H;  5TJH A;  5AVZ B;  2C0W A;  3HD7 D;  1YI2 P;  3BCC E;  3HTK A;  3AE2 C;  5KKZ B;  3CCJ P;  3B71 A;  1IK9 A;  1YHQ P;  1Q7Y Q;  3M06 A;  1ZV8 A;  4JYB A;  2FYU K;  2YKP A;  3MHV A;  2BCC D;  2P10 A;  1LT1 A;  1SQQ J;  3C1L A;  1NKZ B;  2XDJ A;  1SFC B;  4GKG A;  3HE4 B;  5KLV J;  2E75 C;  1VQP P;  5KAI E;  4LC1 A;  4Y99 B;  1ZRT E;  4N6J A;  3KHU A;  1HVV A;  1M1J B;  2IFM A;  3VMX A;  3Q5S A;  3P32 A;  3A0B E;  3L73 J;  4KT0 J;  1XTC C;  1RF1 B;  3TNU B;  1IFI A;  1LTJ C;  3FXD A;  1VQL P;  1JY2 N;  4L73 A;  1JTH B;  3T97 A;  2WZ7 A;  2Q6Q A;  3CCS P;  4DZO A;  3KQG A;  3V2R A;  3TGU D;  1PGQ A;  2K9J A;  1BDC A;  2ZXX A;  1SQP D;  2E5Y A;  5BVZ A;  1NTM J;  1R5S A;  1M90 Q;  1NU1 G;  1SQX D;  3CX5 D;  2FFD A;  5KAF H;  1LTT C;  2OYO A;  3RL0 D;  1U7M A;  1JMM A;  3EWK A;  5AVX B;  2QG4 A;  1BDD A;  1RE3 A;  3AED C;  4EOT A;  3S1K A;  2PAJ A;  1KQG B;  3M91 A;  2AXT H;  2JKV A;  3Q2Y A;  3HE5 A;  1EDJ A;  2IFN A;  1FZF A;  2OAR A;  1GW4 A;  3CI9 A;  1S5L E;  1BE3 D;  1NTZ J;  2NPS D;  2FYU D;  3H1L J;  3I56 P;  1ZR2 A;  3N7N A;  2R32 A;  3M0A A;  2B89 A;  1JEK A;  1YBK A;  4KJM A;  2E76 B;  2N1T B;  4HH2 A;  2H7H A;  1H89 A;  1PZQ A;  4H44 B;  3AE3 C;  1YJW P;  2FYZ A;  1L4A D;  2WSF H;  2ZAE B;  1T3U A;  4I7Z B;  1IFM A;  1IC2 A;  2QM7 A;  1SFC A;  4U3F D;  3HE4 A;  1PP9 D;  1NU1 K;  4N78 E;  3BAT A;  1YIJ P;  3SFD C;  1BSH A;  3CLQ A;  5CCG C;  1KV4 A;  1VQ7 P;  1LTG C;  3CWB D;  5GTH H;  4D6T D;  1Y8A A;  1MFT A;  1M1J A;  1R8E A;  1N86 A;  4UB6 H;  2E42 A;  1IFN A;  5AW4 B;  4WVZ A;  1PGJ A;  1RF1 A;  2OYI C;  2AXT E;  5GTI H;  3EQ2 A;  1JTH A;  2M8R A;  4WY4 D;  2JEE A;  1PGP A;  2HR3 A;  4A7P A;  1SQV J;  1URQ C;  2L5G B;  3MD0 A;  2O3J A;  3V4Q A;  1KB9 H;  1PFI A;  3LID A;  3M0D A;  1K05 A;  2R44 A;  5K5G B;  2WSC H;  1AA0 A;  2E74 B;  1AJY A;  1LWU B;  1VQN P;  3I55 P;  1NTK J;  3UIA A;  2D2C C;  5APV A;  1IO4 A;  1FS0 E;  4GOF A;  2RMZ A;  5GTH E;  3RK2 B;  4EYY Q;  3TF5 A;  2KSJ A;  3LIE A;  4XFJ A;  2IYP A;  3H1J J;  2LR2 A;  1OX3 A;  1AQ5 A;  1GL2 B;  4UB6 E;  3U59 A;  3Q5P A;  2HPC B;  2OQQ A;  3GHG C;  3AEB C;  1YQ4 C;  5GTI E;  5APY A;  2Q3E A;  3WU2 H;  1ZLL A;  5AVU B;  3HUS C;  1NU1 D;  2N1T A;  3II6 A;  5AVY B;  1G2C B;  3B5N C;  3CX5 H;  5AVT B;  3K5B A;  1KB9 E;  2E75 D;  3RBX A;  3BCC D;  3L71 J;  2KK7 A;  4ASW A;  1HGZ A;  5B5E E;  1FZC A;  1N7L A;  1TU3 F;  1EXJ A;  1VL2 A;  3PJS K;  2C9N Y;  1VQK P;  3D70 A;  2SPZ A;  1KYO I;  2Y0C A;  4BWN A;  2PGD A;  1M7L A;  3CCQ P;  2OGU A;  4UB8 H;  4B86 A;  1ZOY C;  3L35 A;  1KQS O;  4JYC A;  2OTL P;  1SLQ A;  4OH8 B;  5AVS B;  3L37 A;  3WU2 E;  3AEG C;  3CXH I;  3VN0 A;  3OA7 A;  1X9V A;  2Y9Z A;  4RJT A;  4L76 A;  3VMY A;  3D6Y A;  2HOD B;  4JPZ B;  1VPC A;  1LT9 B;  3SWK A;  3H6P A;  1LWU A;  2H43 A;  3GF3 A;  1LTI C;  2Z4E A;  4ZNC A;  1ZR4 A;  5AVW B;  1KFN A;  1IZN B;  3HRN A;  1GL2 A;  2HPC A;  2GUV A;  3H32 B;  2WT7 B;  2ZT9 B;  3L72 E;  4UB8 E;  3M9B A;  1G1I A;  1S2E A;  2JJL A;  5APT A;  1L2P A;  3CPW O;  3WMM 0;  1G2C A;  4DCK A;  3RBZ A;  3AEF C;  1OW6 A;  5CCG D;  1Q81 Q;  4LGD E;  5APW A;  5KTB A;  2NPS C;  1P84 I;  3LW5 H;  1BGY E;  3ZDM A;  1G1J A;  5B66 E;  3CCV P;  2B88 A;  1FU1 A;  5AW1 B;  4JQ0 D;  2C0X A;  1KZU B;  1LP1 B;  2JO1 A;  2GUS A;  2R5D A;  1J1E C;  4N78 D;  3RK3 E;  4DOJ A;  1D7M A;  1H0T B;  1URQ D;  4HB1 A;  1MKM A;  2QJY B;  1NAF A;  3AE8 C;  2Q7C A;  1WT6 A;  1LGH B;  2R5B A;  3N4X A;  5AW7 B;  1HWT C;  4QMA A;  3CXH D;  2O1K A;  2YIU C;  2YKQ A;  2YO2 A;  5KJ7 A;  1FDI A;  3R2P A;  2DW3 A;  3CCL P;  3MZW B;  3CC4 P;  3VOP A;  3RK3 C;  2D2C D;  2HOD A;  1BE3 G;  2G3A A;  2J58 A;  3G3Z A;  4TT3 H;  2M3E A;  3H1K D;  4C46 A;  2YNY A;  1KOR A;  2NZ2 A;  1JY3 O;  3MUD A;  3L74 J;  1AFO A;  2XU6 A;  3VTP C;  2I8D A;  4YXD C;  5KAI H;  4YXW H;  5AVQ B;  1QL1 A;  1N7S B;  2K1A A;  1AQT A;  4W7Y A;  2MKV A;  1FOS E;  2VRS A;  5KKZ C;  1PP9 G;  3H32 A;  3B5N D;  2WT7 A;  1BGY G;  1GU5 A;  3GF7 A;  3IAO A;  3CWB G;  2O1J A;  1EQ7 A;  3L70 J;  3MP7 B;  3E1I A;  2KYV A;  3H1H E;  1LTS C;  1N73 C;  1JY2 P;  1U57 A;  4WY4 B;  1SFC C;  1SQB E;  1NGM B;  4Y28 J;  1DEE G;  2H8P D;  2HLO A;  2WMM A;  4DT0 A;  1L0L E;  4N3Y B;  1M1J C;  1IFJ A;  1OVV A;  1USD A;  1L0N K;  4OVN F;  2IPP A;  1KB9 D;  1RF1 C;  3FXE A;  1LP1 A;  4O9B A;  1EXI A;  1IK7 A;  5KLI B;  1RE4 C;  1H0T A;  1UII A;  1KC8 Q;  1EC5 A;  3PRJ A;  1S5L H;  2Y9Y A;  4GT1 A;  3M0D C;  1NH4 A;  1X8Y A;  2W90 A;  2FXP A;  5CBO A;  4C7N B;  1T6A A;  1SP4 A;  1FDO A;  2YXQ B;  3Q5R A;  1JOC A;  1U7J A;  2QRX A;  1KYO H;  4WBA A;  2E75 B;  4K3A A;  2J5U A;  2A45 I;  3AE4 C;  1FZA A;  5DJU B;  3H1H G;  1CI6 B;  4H13 B;  4GOD A;  3AEE C;  1K04 A;  1N7S A;  2IBZ I;  3BCC G;  5AVR B;  1CZQ A;  1LTJ B;  1VQ8 P;  4NPF X;  2N1T C;  1L0L G;  3CXH H;  4H0L C;  2XKM A;  4PV1 D;  1WRG A;  2AEJ A;  1VQ4 P;  1GTW A;  1NAY A;  1SQQ E;  3AEC C;  4I7Z C;  2WSE H;  3BVH A;  1L0N D;  5KLV E;  4WY4 A;  1Q82 Q;  1FZC C;  3L72 D;  2W83 C;  5E79 H;  1QEX A;  2XNX A;  3CCU P;  1S9K E;  3WUT A;  3L73 E;  4I6M C;  1X79 B;  1KYO E;  1BCC J;  2HFE D;  2KIK A;  3AE6 C;  2FY8 A;  1BGY D;  3V2Q A;  1EZV I;  3F5H A;  2WTY A;  4IL6 X;  3NTN A;  1SQB K;  2JWD A;  1NTM E;  3D6Z A;  3CXH E;  2B87 B;  1L0L K;  3FWL A;  3TNU A;  5APX A;  3RK3 D;  4L75 A;  3TK1 A;  2CK3 H;  2W6B A;  2E74 C;  4GIF A;  4C7N A;  2XV5 A;  2BCC J;  5E79 E;  3H1K E;  1GD2 E;  3RK2 C;  4W80 A;  1OVR A;  2KB7 P;  1RF0 C;  4NPE A;  2WSC J;  4IFD K;  1S4X A;  2RH0 A;  1NTZ E;  3H1L E;  2XZR A;  5B5E H;  1W2B O;  2WPV B;  1SQQ G;  5APQ A;  1VF5 B;  4Z1M H;  1FC2 C;  1CI6 A;  3O8Z A;  5CHX A;  1DX7 A;  4HKZ H;  1RQV A;  3IF4 A;  3M9Q A;  4R4M A;  1SFC D;  3KXD A;  3W67 A;  2ZXE B;  3SSU A;  3L73 G;  1MUU A;  2KUB A;  2QVA A;  4OGQ C;  3TGU J;  1URQ B;  1SQP J;  4DJG A;  1OWA A;  1JM0 A;  2KI7 B;  5CCH A;  4M3L A;  1P84 E;  3Q3D A;  3IN6 A;  3GLM A;  4XA4 A;  1SQX J;  1RHZ B;  2WPR A;  3SWF A;  3H1H D;  5AW2 B;  1AVO A;  2FXM A;  1NTM G;  4I1L A;  1SQB D;  1H8A A;  2D2C B;  2FKW B;  2YKO A;  4AQR D;  1L0L D;  1YJN P;  3EFF K;  2Z5H A;  1SQQ K;  1RQU A;  1GK4 A;  4PJ0 H;  5KLV K;  2YMK A;  3RGU A;  1BE3 J;  2FYU J;  3C8V A;  1DH3 A;  3H1K G;  2O01 H;  1E5W A;  1M8O B;  4JBZ A;  2QJK C;  3VMZ A;  2B87 A;  5C39 A;  1XTG B;  3H1L G;  1NTZ G;  1JMB A;  1NYH A;  3H1I D;  1VQM P;  1T3J A;  1Y9B A;  2CPB A;  1KIL B;  2M5A B;  3KYQ A;  3MUD C;  1T8Z A;  1OZH A;  1VDF A;  1ZP0 C;  4U3F J;  1PP9 J;  3HD7 B;  2K37 A;  3G9R A;  3L75 D;  3CWB J;  3AE5 C; 
#chains in the Genus database with same CATH homology
 4LLH A;  4DZO A;  3KQG A;  3RK3 C;  3V2R A;  2HOD A;  1RE4 A;  1NTM K;  2J58 A;  2CPS A;  3G3Z A;  2KP8 A;  2N1T D;  3V2P A;  5BVZ A;  1J1D C;  4C46 A;  2YNY A;  1JY3 O;  3MUD A;  2OYI B;  2W27 A;  1LTJ A;  5APS A;  2WPS A;  3A5T A;  1AFO A;  2FFD A;  2XU6 A;  1LTT C;  3RL0 D;  3VTP C;  5AVQ B;  1QL1 A;  1NWQ A;  1JMM A;  1N7S B;  4W7Y A;  3OJA B;  4JF7 A;  5AVX B;  1FZG A;  5BU8 B;  1URQ A;  1RE3 A;  4EOT A;  1FOS E;  1CW5 A;  2VRS A;  3H32 A;  3B5N D;  2WT7 A;  1NKN A;  2PAJ A;  1GU5 A;  2W6A A;  4KHX A;  3A3Y B;  2O1J A;  1EQ7 A;  3M91 A;  2YMY A;  1NTZ K;  3E1I A;  3HE5 A;  2KYV A;  2IFN A;  1FZF A;  2OAR A;  1GW4 A;  3CI9 A;  1LTS C;  1N73 C;  2NPS D;  1JY2 P;  2Q5U A;  1ZR2 A;  4WY4 B;  3N7N A;  1SFC C;  2R32 A;  2YO3 A;  1W2E A;  3V5B A;  3M0A A;  5AW6 B;  2H8P D;  3A7O A;  2HLO A;  1HGV A;  1FBM A;  2N1T B;  4N3Y B;  4HH2 A;  2H7H A;  1YTZ I;  1H89 A;  1M1J C;  1IFJ A;  1OXZ A;  3VYI A;  2J59 M;  1S9K D;  1L0N K;  2I1J A;  3IFM A;  2FYZ A;  3NMD A;  2IPP A;  1LTB C;  1L4A D;  2WSF H;  1KIL C;  1T3U A;  2IX7 C;  5APU A;  1RF1 C;  5KJ7 C;  3GHG B;  1FJP A;  1IFM A;  2Q9I A;  1IC2 A;  2N9B A;  3RL0 B;  2QM7 A;  2Z5I A;  1SFC A;  3HE4 A;  1MFZ A;  1NU1 K;  4N78 E;  1HTL C;  3BAT A;  3HD7 C;  4O9B A;  3CLQ A;  5CCG C;  3TYY A;  1FJK A;  1LTG C;  3PP5 A;  3HUS B;  1RE4 C;  3I5C A;  3V4W A;  3B5N B;  1LT9 C;  1M1J A;  1N86 A;  5AVV B;  3RK2 D;  2E42 A;  1IFN A;  1JCD A;  5AW4 B;  1T2K D;  1GZL A;  3MIW A;  4GT1 A;  1KIL A;  3M0D C;  1RF1 A;  1GL2 D;  1NH4 A;  2OYI C;  3P8C E;  2NPS B;  2FFD C;  3EQ2 A;  1JTH A;  1HH0 A;  1SQV K;  1X8Y A;  2M8R A;  4WY4 D;  2JEE A;  3HD7 A;  5CCH D;  2PP6 A;  5BU5 A;  5CCG A;  2WIT A;  2WPQ A;  4C7N B;  1SP4 A;  1N7S C;  5AW3 B;  1HUC A;  1JOC A;  1URQ C;  1RE3 C;  1GU4 A;  2L5G B;  3MD0 A;  2ZFC A;  1LT9 A;  1NO4 A;  3V4Q A;  3L36 A;  3VP8 A;  1PFI A;  1A02 F;  3LID A;  4WBA A;  1L4A B;  2A45 I;  3M0D A;  2OYI A;  3NXS A;  1LTA C;  1FZA A;  2WSC H;  1NTK K;  1FOS F;  2WWW A;  2C9L Y;  1CI6 B;  1JY2 O;  1LWU B;  4IFF A;  3KDP B;  1N7S A;  3UIA A;  3MTU E;  1KQL A;  1MV8 A;  3OAK A;  5APV A;  5AVR B;  1CZQ A;  1LTJ B;  1IO4 A;  2N1T C;  3U1A A;  3RK2 B;  1DEB A;  2QM8 A;  2KSJ A;  2XKM A;  3LIE A;  1RF0 A;  3P7K A;  1WRG A;  2A45 H;  1AQ5 A;  1GL2 B;  2POH A;  1GTW A;  3U59 A;  2HG5 D;  1GK6 A;  2HPC B;  1GDT A;  3GHG C;  2WSE H;  3BVH A;  1GW3 A;  4I2L C;  3RL0 C;  1SVF A;  1IJD B;  4WY4 A;  1FZC C;  1J1D B;  1JUN A;  2P67 A;  5CJ0 A;  3NFQ A;  4Y99 C;  5APY A;  1ZLL A;  5AVU B;  3HUS C;  4IFM A;  2XNX A;  2N1T A;  3II6 A;  5AVY B;  1G2C B;  3B5N C;  4AYC A;  1NOH A;  3MGN A;  4AUW A;  1S9K E;  2OYH B;  1A02 J;  1KFM A;  5AVT B;  3L4F A;  4I6M C;  1X79 B;  3HTK B;  2HFE D;  3GHG A;  3BRV B;  3A2A A;  2A45 G;  3BAS A;  4EIJ A;  1HGZ A;  1FZC A;  3V2Q A;  3P8M C;  3EFG A;  1N7L A;  2WTY A;  1FZB A;  3HUS A;  1MZ9 A;  2C9N Y;  3NTN A;  1SQB K;  3B5N A;  3SWY A;  1N73 B;  3VP9 A;  2BAS A;  1L0L K;  2E43 A;  1L4A C;  3TNU A;  1M7L A;  3TSI A;  3KPE A;  5APX A;  3RK3 D;  2NPS A;  4B86 A;  3TK1 A;  1IFD A;  2W6B A;  3IR9 A;  3L35 A;  1QL2 A;  2KLV A;  4JYC A;  4GIF A;  1SLQ A;  5AW0 B;  1JCC A;  1JY3 N;  4OH8 B;  4ZKU A;  4RES B;  4C7N A;  2XV5 A;  5AVS B;  5CMZ A;  3L37 A;  3BRT B;  1GD2 E;  3VN0 A;  3OA7 A;  3RK2 C;  3P8C D;  1X9V A;  1H88 A;  4HYT B;  4W80 A;  2KB7 P;  4W7Z A;  1J1E B;  1RF0 C;  1T2K C;  3VMY A;  1HJB A;  1L4A A;  4IFD K;  1JNM A;  2HOD B;  1Z56 A;  5AW8 B;  2XZR A;  2P2U A;  3CL3 D;  1VPC A;  1LT9 B;  5APQ A;  4WY4 C;  5CCH C;  3H6P A;  2MJZ A;  1FDM A;  1CI6 A;  1LWU A;  3O8Z A;  3M9H A;  2H43 A;  5CHX A;  1DX7 A;  1J2J B;  1LTI C;  2Z4E A;  1ZR4 A;  5AVW B;  3M9Q A;  2FFD B;  1CSB A;  5CJ4 A;  1KFN A;  1FAV A;  2LKM A;  1SFC D;  2OYH C;  2ZXE B;  3HRN A;  2R3C A;  1SQP K;  1MUU A;  1YYC A;  1GL2 A;  3RK3 B;  4ZKP A;  1RY3 A;  1URQ B;  2HPC A;  2GUV A;  3H32 B;  2WT7 B;  1OWA A;  5CCH A;  4M3L A;  1SQX K;  3M9B A;  1ZN5 A;  3C9I A;  1G1I A;  1YTZ T;  1JY3 P;  2JJL A;  4XA4 A;  5APT A;  3V2N A;  4C7R A;  3HE5 B;  3WMM 0;  1KIL D;  2HYN A;  5KJ7 D;  2WPR A;  1G2C A;  4WB4 A;  1NHL A;  3SWF A;  5AW2 B;  5AVZ B;  2C0W A;  2FXM A;  1HBW A;  2OYH A;  3HD7 D;  4I1L A;  5CCG D;  1H8A A;  4LGD E;  5APW A;  5KTB A;  3HTK A;  2NPS C;  2GM4 A;  1FZE A;  2FKW B;  2YKO A;  3LW5 H;  4AQR D;  1IK9 A;  5AW5 B;  1G1J A;  3M06 A;  1ZV8 A;  2Z5H A;  2P7J A;  2P1J A;  2FYU K;  4JYB A;  1SQQ K;  3U1C A;  2YKP A;  1GK4 A;  5KLV K;  1FU1 A;  5AW1 B;  2M3B A;  2C0X A;  1N73 A;  1KZU B;  1DH3 A;  1NKZ B;  2XDJ A;  1SFC B;  4GKG A;  2O01 H;  3HE4 B;  1JO5 A;  1E5W A;  1N2D C;  2KOG A;  1FZC B;  3VMZ A;  2GUS A;  2R5D A;  1J1E C;  4N78 D;  4LC1 A;  4DOJ A;  4Y99 B;  1N7S D;  1URQ D;  4N6J A;  1XTG B;  1HVV A;  1M1J B;  1NAF A;  2IFM A;  3VMX A;  3B8E B;  5AW9 B;  1LWU C;  3P32 A;  2Q7C A;  1WT6 A;  1LGH B;  2R5B A;  1T3J A;  3N4X A;  4XE5 B;  5AW7 B;  1HWT C;  1XTC C;  2CPB A;  1KIL B;  1RF1 B;  2O1K A;  3KYQ A;  3TNU B;  1IFI A;  1LTJ C;  2YKQ A;  1T8Z A;  2YO2 A;  5KJ7 A;  2I1K A;  1VDF A;  1JY2 N;  2Q3I A;  3R2P A;  1JTH B;  3HD7 B;  3T97 A;  2WZ7 A;  1GL2 C;  3VOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...