1FZCA

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 29
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcA00
3GHGC 1LTJB 2FFDC 1W2EA 3E1IA 1N73A 2OYHA 3HUSA 2OYIA 1FZCA 1RE4A 1FZEA 2Z4EA 1N86A 1RF1C 2HODB 1LWUC 1RE3C 2A45G 2HPCB 1M1JC 1JY2N 1LTJA 1JY3O 1JY2P 1LT9C 3GHGB 1FZFA 2FFDB 1RF1B 2HODA 2HPCA 1LWUB 2HLOA 1RF0A 1M1JB 3GHGA 1FZCC 2FFDA 3BVHA 1RF1A 1N73C 1JY3P 3HUSC 1LT9B 1RE4C 1JY3N 2OYIC 2OYHC 1LWUA 1RE3A 3H32B 1FZAA 1M1JA 2H43A 1LTJC 1FZGA 1T3UA 3H32A 1LT9A 1N73B 2OYHB 3HUSB 2A45H 1FZBA 2OYIB 2XNXA 1JY2O 1FZCB 2A45I 2Q9IA 1RF0C
chains in the Genus database with same CATH superfamily
2Q1KA 1NTKD 3WMM0 5B66H 3H1KD 2QE7H 1KC8Q 2P2UA 4Y99B 1K8AQ 2IZ1A 2WT7B 2B87A 2N1TD 3CCVP 3MHVA 3N4XA 5AW5B 2P7JA 5APUA 2B87B 2FYNB 1KV4A 3CX5H 1OW6A 1DEEG 1NU1E 3CCQP 4H0LD 5CCHD 3VP8A 3AE8C 1EZVG 1VDFA 2POHA 1HWTC 2R3CA 1IO4A 3C9IA 3P7KA 1BSNA 1M1KQ 1KB9E 2W6BA 1T6AA 2Y9ZA 4LGDE 3T97A 1VPCA 2K9JA 1JY2N 1K04A 4OWFA 3LIEA 1R5SA 4AYCA 1P84E 2E75D 5CCGC 2ZT9C 5AW7B 1USEA 3L75D 2YXQB 2FYUG 2PGDA 3T97B 2YMYA 1FS0E 2W8ZA 4K35A 3D70A 1ZOYC 3EFFK 3BCCJ 2K9JB 4L75A 5APSA 5CJ4A 2D2CD 4W80A 3BRVB 2N1TA 3AE9C 3MZWB 3B5NC 2XNXA 1MFTA 3L72G 3L35A 1SQBE 5AVVB 1PPJG 3D6YA 2N1TB 2KXPB 1G2CA 2FYUK 3CX5I 5CCHA 1WT6A 1MKMA 2RN0A 3CXHI 3M0DC 2FXMA 1VF5C 2P58A 4AUWA 2E76D 1SQXD 1BGYG 3WU2E 2ZFCA 2KZIA 1JMBA 1X22A 1SQPD 3L74E 4U3FG 1G2CB 1ZV8A 1QVFO 4H0LB 1EDKA 1DH3A 3BCCD 5APXA 1NHLA 2SPZA 1K05A 1FZCC 1PFIA 1VQ4P 1N7SD 4JPZB 2BEZF 4MN4C 2A45H 3L72J 1VL2A 5KLVG 1QEXA 2KP8A 1YQ3C 4IL6H 2BEQD 1JOCA 1HUCA 2WSEJ 1JCDA 1RE4C 3H1JJ 3TK1A 1NTZD 4BRYA 2QIWA 1URQC 1BGYJ 1QVGO 2C9NY 3Q5PA 5GTHH 2E75B 1IZNB 1N86A 1S5LH 2I1KA 1SQVD 4U3FJ 5AW1B 2E43A 3WUTA 3IF4A 1KORA 3Q1MA 1NWQA 1VQOP 3V6IA 2BCCD 2OYIC 4BRYB 5KLVK 2Y0DA 1L0NG 1X8YA 4PJ0E 3PHLA 4GOEA 1HJ0A 3CI9A 1KILD 1LTJA 1YTZI 5KLIC 3L73E 1S3JA 3L37A 1YJ9P 1XTGB 1N73C 1FOSE 2KSEA 1EDLA 3S9OA 1VQ9P 3HD7D 1FZGA 4W7ZA 1T3UA 1SLQA 4I7ZB 1BCCE 1T2KC 2R44A 4EI2A 1LTJB 2KOGA 3N7NA 1FU1A 2M3EA 3H1JD 2H7HA 3TGUE 1N7SA 1FAVA 3Q3DA 1VQ7P 2E76B 4JF7A 1EDJA 1PGJA 2OARA 1L0NK 2XKMA 3H1ID 1L0NJ 2H88C 4EYYQ 2OYHA 1J1DB 1N7SB 1PGQA 2PRRA 4DZOA 1RF1A 4TT3H 4KJMA 1KFMA 2VRSA 3FXDA 2OYHB 3WUVA 1S72P 5B66E 1ZR2A 5TJHA 2W27A 1IFPA 4C7RA 1RF1B 1BDCA 2N9YB 2QJPC 2IYOA 3U1AA 2O01H 4IOIH 1EZVE 3BATA 4R4LA 1FJPA 1KILA 2V7QJ 2YMKA 1NH4A 4H13D 4IFMA 3A7OA 1OFCX 1HTLC 5M1BA 5E79H 4YXDC 2HODA 3HD7A 3CX5E 2JO1A 4ASWA 3W67A 2JJLA 1FZBA 4WY4C 1A02F 1EQ7A 1NU1J 2IDBA 1FE6A 3I56P 2HODB 1GTWA 2N9BA 3HD7B 5AVRB 2YIUC 2BASA 3RL0C 1QGKB 2FYUE 1YJNP 3SSUA 1LTTC 3PP5A 1JCCA 3ITKA 2UWJE 2FBWC 2QJKB 2J58A 2ZVOB 3V4WA 3EQ2A 2AXTH 3PLNA 1IFDA 2FFDA 2XDJA 2J59M 1AVOA 3A0BH 3RK3E 1QL2A 2NZ2A 1SS1A 3B71A 5BVZA 1OVRA 4TLFA 3R2PA 3SFDC 5CMZA 2AEJA 1JMMA 3V2PA 2PP6A 4DCKA 2FYNC 1AQ5A 3CD6P 2FFDB 3ZDMA 1NU1D 1LWUA 2OTKE 3CCEP 2WPRA 3GLMA 5GTIH 3EWKA 3RK2D 1UIXA 3I5CA 2GA1A 1YJWP 2L5GB 1AVYA 3SWYA 1R5LA 1LWUB 1KB9D 1UIIA 4H13B 5KLVE 1Y8AA 1G1IA 1S9KD 1U7MA 3KHUA 3VMAA 1FZEA 4D6TG 5AVUB 5KAIH 1P84D 1FBMA 2E74C 3VMYA 1EDIA 2Q3IA 2Q5UA 5B5EH 3ABVC 1FC2C 2NPSD 1DD4A 3CMEP 4IL6E 1OZHA 3GW6A 5TISH 1LP1A 1NTMG 3GHGA 4L74A 1RE3A 1HBWA 3L73G 1Q90D 2QVAA 3C1LA 3H32A 2OGUA 2RH0A 1SQBD 3L71D 5GTHE 3K5BA 1N2DC 2Z4EA 1S5LE 1LP1B 4D6TJ 1U7JA 1BCCG 3GF7A 3NMDA 3HE4A 2IPPA 2K9YA 4DOJA 2Q7CA 1VQMP 2WTYA 1S4XA 2MJZA 3MGNA 4ZKUA 1SP4A 1LJ2A 1KQSO 3H1HE 1ZMEC 1BE3G 3L74D 2GUSA 3M91A 5AW8B 3P8CE 1G1JA 3HE4B 1JY2P 1NTMK 3U1CA 3TSIA 1M8OB 1NTMJ 3L36A 1LNQA 3RK2B 3VMXA 1GL2D 2IX7C 3L73J 1ZP0C 1SFCD 2A06E 3PH0A 1X0TA 3USSA 3CMAP 1BCCJ 4N6JA 3JCUH 2RKLA 2IFNA 1KYOD 4C46A 2AXCA 2KK7A 3TGUJ 5KKZB 3MUDA 4HH2A 2E75C 2O01N 2LXCB 1HJBA 2NPSA 1SQQD 2G8YA 3CCSP 3I55P 2KLUA 2ZAEB 3V2QA 1PP9E 1Y47A 3FWLA 4XE5B 2NPSB 4H44B 3G6EP 4PV1C 1YIJP 3CWBG 3RGUA 3F5HA 1AV1A 1OW8A 3V2NA 2FXOA 3B8EB 1PZQA 4I7ZC 1GK4A 2RMZA 4N78E 1JY3P 4XFJA 4UB8E 3H1LG 1LTJC 3GMAA 2B88A 4GDOA 4GOFA 3AE5C 1VQ6P 3TGUD 1GD2E 1NTZG 3HTKA 1SQPK 1GL2A 4CPGA 1JB0J 1M90Q 1JEKA 1LTGC 2IBZG 1L4AC 3HUSC 2XZRA 2KZJA 1SFCA 3O8ZA 1A02J 1EZVI 3RBXA 3AE3C 2W6AA 4PD4H 4M3LA 3HTKB 5AVSB 2W83C 3V2RA 2JWAA 1SFCB 3P8MC 2WSFH 4UB6H 1YITP 2FYUJ 2H8PD 2YKOA 1W2EA 1NTZK 1RF1C 3CCUP 1Y9BA 3A0HH 2WSCH 2FY8A 3L70G 2O3JA 1JY3N 5AW4B 4NPDA 3GF3A 3RK3C 3Q5RA 5K5GB 2W90A 1PV3A 1M1JC 2IBZI 2KLVA 2ZXEB 3CX5D 4B86A 1U57A 3B5ND 3CXHD 1T3JA 2R5DA 5CJ0A 2XV5A 1GZLA 5GTIE 3AECC 5CBOA 2QJYB 4D6TE 2ZYAA 3AE6C 2A45G 2KUBA 1VQLP 2FYUD 5C39A 1GDTA 1VF5D 4GT1A 1IK9A 2QJKC 2L91A 2YO3A 2Z5HA 2M0BA 2GUVA 3C8VA 1Q86Q 1VQPP 1NAFA 3LIDA 5KLVJ 1NOHA 2D2CB 4PD4I 5KTBA 1VQKP 1NTME 3A2AA 2WSSH 5KAIE 4OGQC 2CPBA 3L72D 3AEAC 4DT0A 3JC22 2E5TA 1J2JB 1PPJD 1VQ8P 5B5EE 1S2EA 1RF0C 2FFDC 2FKWB 1NKNA 2QEXP 1LTAC 3H1HG 3OA7A 1HGVA 5TISE 1GK6A 1AJYA 3M0AA 1VQ5P 2KNCA 3PTZA 1BGYD 2R3SA 4ASVA 1BE3E 4ZMDA 3L75E 4U3FD 1LT9A 2A45I 2KB7P 5KJ7C 1T8ZA 4IFFA 3R4YA 1JM0A 3KZIH 2M3BA 4ZNCA 3RBZA 1GU4A 1M57D 2IFMA 1H89A 2KNCB 2A06G 3B5NA 3CPWO 4H13C 1LT9B 2J5UA 2KS1A 4AQRD 5AVQB 3B5NB 4C7NA 4RKUJ 3H1HJ 1L0LG 1Z56A 2JP3A 2Y0EA 1NYHA 1IK7A 5DJUB 1T2KD 1FZAA 1PP9G 2FYZA 3TDKA 4DJGA 4C7NB 4XA4A 5CBNA 1K9MQ 2H89C 3E1IA 2QM8A 1SQXE 1VF5B 3IR9A 5AVTB 1KQGB 1J1EC 1SQPE 1P84H 4RO0A 1MV8A 1DIPA 1E5WA 1L0ND 1KFNA 3CWBE 5L8RJ 1KILB 4NPEA 1OX3A 3MD0A 1RE4A 1L0LK 3KXDA 1YI2P 3H1LE 1MUUA 2B89A 5APYA 1XTCC 2KSJA 1JUNA 1PP9J 3SWKA 1OXZA 4HKZH 1IFMA 3CCMP 1NTZE 1CW5A 2AEMA 1N7LA 2B9BA 2OYIA 3B4SA 2IBZE 4Y99C 2OTLP 3RL0g 2HLOA 1NAYA 1FJKA 2JR8A 2OTJP 2OYIB 2O01J 1N73A 4HJGH 5APVA 2C9LY 5KKZC 1ZRTE 3VYIA 4QMAA 5AVWB 5KLIB 4WY4D 3CC2P 1CSBA 1YBKA 1N73B 4PD4E 3RL0D 3L70E 1FDMA 3AEEC 3MUDC 2WZ7A 3UIAA 4Z1MH 3M9QA 5AW6B 4H44C 3HE5A 1IFIA 1ZLLA 1NTKG 3H1KG 2O1KA 2JWDA 2R32A 1KYOH 2C0XA 2WITA 1OWAA 1QX8A 2Q9IA 4OH8B 2IYPA 3H1IE 2P10A 3HE5B 3A0HE 3LW5H 4EIJA 1OW7A 4N78D 1QL1A 2YNYA 5BU5A 4I2LC 2AEFA 2DW3A 4RESB 2ZYDA 3QWOC 1L2PA 1NTKK 1NJIQ 2I1JA 1NTKJ 2QJPB 4L76A 4WBAA 3V4QA 2QA4P 2WQYC 5EFWB 2N1TC 2ZVNB 2Q6QA 1HH0A 3GHGB 4WY4A 2W6JH 4N3YB 1TU3F 3H32B 3M9BA 3EFGA 5KAFH 4YPCA 4O9BA 2E74D 3E7KA 3L75G 1AFOA 4H0LC 5CCHC 1SQQK 2M5AA 2OQQA 1ZXGA 2YIUB 5AVYB 3RL0B 1KMIZ 2K88A 1OVVA 3M06A 1LTSC 2PAJA 4YTPC 3M9HA 2M5AB 3BRTB 3S4RA 4BWNA 1KN7A 3CCRP 2QJYC 4KHXA 3AEDC 4D6TD 2V4HA 4NPFX 4R4MA 5AVZB 1L0LE 2WMMA 3CC7P 2GM4A 1BE3J 3KZIE 2LXBA 2O1JA 2C0WA 3Q5SA 3L75J 3H25A 2PFXA 3S1KA 3FXEA 3IAOA 4OVNF 2ZXXA 1SQXG 1SQPG 3CXHH 1USDA 1AA0A 2QM7A 2D2CC 1VQNP 1H0TA 3FGAD 1HGZA 3BCCG 2ZYGA 2QSIA 1NTMD 1PGOA 2MKVA 3L73D 1IFJA 4Y28J 1H0TB 1R8EA 2ITAA 3P32A 1BCCD 1WRGA 2XU6A 1SVFA 1S9KE 2WPSA 4I1LA 1M56D 4IFDK 5AW0B 3TNUA 2E76C 2IZ0A 1SQXK 2YKPA 5E79E 3A3YB 1SQXJ 1KZUB 1MZ9A 1X79B 1LT1A 4L73A 2HG5D 1BE3D 1SQPJ 2E74B 1SQVG 1PL5A 2CK3H 4EDFA 1RHZB 1J1DC 1N7SC 2BCCG 1WMKA 4JYBA 3AE4C 3TNUB 3CWBJ 2WSEH 3V5BA 1GL2B 1LT9C 3HRNA 2OYOA 3AEGC 4PV1D 4WVZA 2OYHC 3IFMA 3H1LJ 4BXLA 2JKVA 3L71E 2K1AA 3PRJA 2Q3EA 1NTZJ 2AXTE 5CCGD 2ZT9D 3AEBC 1SQVK 2WPVB 1LTIC 1SQVJ 3OW2O 3H1JG 2M8RA 3A0BE 1EZVD 1DEBA 2BCCJ 1FDIA 3CCJP 1QLED 2YXRB 4RJTA 1Q7YQ 1NTKE 3H1KE 1L4AD 2P67A 1FZFA 1DD3A 3SWFA 5APWA 3H1IG 1D7MA 1KILC 3CWBD 5DJTB 3JSVC 1JO5A 3PJSK 3AEFC 4IL6X 1JTHA 1LGHB 3SFEC 4KT0J 3HD7C 3NXSA 4WWIA 3H1LD 2I8DA 3L70J 5BU8B 2FXPA 1OVUA 1S5LX 3BASA 3D6ZA 1KYOE 1JTHB 1OIPA 1Q81Q 3L4FA 2JEEA 2WSFJ 1YTZT 1IJDB 1SQQE 2IBZD 5H2FH 3TYYA 3U59A 1NO4A 3OAKA 3H1IJ 3VTPC 3KQGA 3KDPB 2KIKA 3H6PA 3RK3D 2WSCJ 2QRXA 3FWNA 3KYQA 3WUUA 1CI6A 3A5TA 2XNDH 5CCGA 4PV1B 5APQA 1ZRTD 2WVRA 1W2BO 3CCLP 1URQD 1CZQA 2V7QH 1CI6B 4PD4D 2ZT9B 1OMIA 3L70D 1RQUA 1L4AA 3HUSA 1FOSF 1E79H 1LWUC 3W68A 1YQ4C 4U7JA 2YKQA 3VP9A 2WWWA 5KLVD 5KAFE 3D71A 1L4AB 3HUSB 3AE2C 4OGQD 1KD1Q 3G3ZA 3OJAB 3KPEA 3M0DA 1NGMB 3G71P 1ZN5A 4HYTB 2KS1B 4HB1A 1KB9H 1X9VA 1ZR4A 1JY2O 3NTNA 1NU1G 1FZCA 1PIXA 3JCUE 2Z5IA 3BCCE 4UB8H 3FX0A 5KJ7D 1M1JA 4JBZA 1FZCB 1YHQP 3GHGC 2KYVA 1GW4A 3VMZA 1N8RQ 2LR2A 3RK3B 1RE3C 1L0LJ 1M1JB 1URQA 1EC5A 3CXHE 2H43A 1JNMA 3H1HD 1NU1K 1W5CE 4A7PA 1GW3A 5AW2B 3P8CD 3AE1C 2KI7B 4ZKPA 1URQB 3RK2C 1H88A 2NRGA 1SQVE 1MFZA 2HPCA 1BSHA 3VOPA 5AVXB 2E42A 2BCCE 1IC2A 1FDOA 2A06D 3WU2H 2HPCB 3AE7C 1JY3O 1Q82Q 1SQBG 1KILE 2G3AA 2Y0CA 3L71G 1RF0A 4GIFA 4OGQB 3BVHA 3L72E 4I6MC 3VN0A 1KB9I 1L0LD 1PPJE 2R5BA 1M7LA 2HYNA 1KQLA 1KTMA 1PP9D 3H1JE 1NVOA 4GKGA 2NPSC 5KJ7A 1P84I 4JQ0D 3L74G 3QH9A 4UB6E 1BGYE 1NKZB 5AW9B 1LTBC 2QG4A 4U3FE 3G9RA 1RQVA 3IN6A 1PGPA 4YXWH 1SQBK 2Y9YA 3CLQA 1SQBJ 4LLHA 3L71J 2WPQA 4EOTA 1S1CX 3NFQA 3O6QA 3E1RA 2JDIH 1IFNA 3MIWA 1YYCA 4PJ0H 1K73Q 2K3RA 2HFED 4GODA 2HR3A 1SQQG 3L74J 3O6QB 4WB4A 3CL3D 3TF5A 3H1KJ 2CPSA 1HF9A 1GL2C 3MP7B 1KQFB 4H44D 1RH5B 1SFCC 5AW3B 1BDDA 1AQTA 2ZJSE 3II6A 5CHXA 1J1EB 1HVVA 1L0NE 3G4SP 4JYCA 3MTUE 1EXJA 3GG2A 2LKMA 1GU5A 1ZW0A 1RY3A 5APTA 5H2FE 3Q2YA 1H8AA 2P1JA 2E5YA 2YO2A 4WY4B 4LC1A 1SQQJ 2K37A 3CC4P 1DX7A 3TGUG 4K3AA 3LW5J 3F89A 1GMJA 1KYOI 1Q2NA 2WT7A 4W7YA 1EXIA
chains in the Genus database with same CATH topology
1JMMA 4IFFA 3V2PA 3WMM0 2M3BA 2PP6A 1GU4A 2IFMA 1H89A 1AQ5A 2FFDB 3B5NA 5CCGD 2P2UA 1SQVK 4Y99B 1LTIC 1LT9B 2WT7B 1LWUA 2M8RA 2WPRA 4AQRD 2N1TD 1DEBA 3RK2D 3N4XA 5AVQB 3I5CA 3B5NB 4C7NA 5AW5B 2P7JA 2L5GB 5APUA 1L4AD 2P67A 1Z56A 1FZFA 3SWFA 3SWYA 5APWA 1LWUB 1KILC 1T2KD 1JO5A 1FZAA 2FYZA 1G1IA 1S9KD 5CCHD 3VP8A 4C7NB 4XA4A 1JTHA 1LGHB 3HD7C 3E1IA 2QM8A 3NXSA 1FZEA 3IR9A 1VDFA 2POHA 5AVTB 1J1EC 1HWTC 5AVUB 2R3CA 1IO4A 1FBMA 3C9IA 1MV8A 3P7KA 5BU8B 1E5WA 3VMYA 3BASA 1KFNA 1JTHB 2Q3IA 2W6BA 1KILB 3L4FA 2JEEA 2Q5UA 4LGDE 3T97A 1YTZT 1IJDB 1VPCA 3MD0A 1RE4A 2NPSD 3TYYA 1L0LK 1NO4A 3U59A 1JY2N 3OAKA 3LIEA 4AYCA 3VTPC 3KQGA 3GHGA 3KDPB 1MUUA 3H6PA 5APYA 1XTCC 5CCGC 3RK3D 2KSJA 1JUNA 1RE3A 5AW7B 1HBWA 1OXZA 3KYQA 1IFMA 2YMYA 3H32A 1CW5A 1N7LA 1CI6A 3A5TA 2OYIA 1N2DC 2Z4EA 5CCGA 5APQA 5APSA 4Y99C 5CJ4A 3NMDA 2HLOA 3HE4A 2IPPA 4W80A 4DOJA 2Q7CA 3BRVB 2N1TA 2WTYA 1FJKA 2MJZA 1URQD 3MGNA 1CZQA 4ZKUA 1CI6B 1SP4A 2OYIB 3B5NC 2XNXA 3L35A 5AVVB 1N73A 1L4AA 3HUSA 1FOSF 2GUSA 3M91A 1LWUC 3P8CE 5AW8B 1G1JA 3HE4B 1JY2P 5APVA 1NTMK 2C9LY 3U1CA 2N1TB 2YKQA 3TSIA 3L36A 3VYIA 5AVWB 1G2CA 3RK2B 3VMXA 2FYUK 3VP9A 2WWWA 4WY4D 1GL2D 5CCHA 1WT6A 2IX7C 3M0DC 1CSBA 2FXMA 1N73B 1L4AB 3HUSB 4AUWA 1SFCD 2ZFCA 3G3ZA 3RL0D 3OJAB 1FDMA 2WZ7A 3UIAA 3KPEA 3M0DA 3M9QA 1G2CB 4N6JA 5AW6B 1ZV8A 3HE5A 1IFIA 1ZN5A 4HYTB 1DH3A 1ZLLA 2IFNA 5APXA 1NHLA 1PFIA 1FZCC 2O1KA 1N7SD 4C46A 2R32A 3MUDA 4HH2A 2C0XA 1X9VA 1ZR4A 2A45H 2WITA 1HJBA 1JY2O 1OWAA 2NPSA 2Q9IA 3NTNA 4OH8B 2KP8A 1FZCA 3HE5B 3V2QA 1JOCA 3LW5H 4EIJA 1HUCA 4N78D 2Z5IA 1JCDA 1QL1A 1RE4C 2YNYA 5KJ7D 5BU5A 4XE5B 2NPSB 4I2LC 1M1JA 3TK1A 1FZCB 1URQC 3GHGC 2C9NY 2KYVA 1N86A 1GW4A 3VMZA 4RESB 5CMZA 3RK3B 1RE3C 2I1KA 5AW1B 2E43A 1NTKK 2I1JA 1NWQA 3V2NA 3B8EB 1M1JB 1URQA 1GK4A 4N78E 1JY3P 2OYIC 2H43A 1LTJC 4WBAA 1JNMA 3V4QA 5KLVK 1NU1K 1GW3A 5AW2B 2N1TC 1X8YA 3P8CD 1GD2E 3CI9A 1HH0A 4ZKPA 1KILD 1LTJA 1URQB 1YTZI 3RK2C 1H88A 3GHGB 1MFZA 3HTKA 1SQPK 4WY4A 2HPCA 1GL2A 3L37A 5AVXB 3VOPA 2E42A 1LTGC 1XTGB 4N3YB 1N73C 1FOSE 1L4AC 3HUSC 1IC2A 2XZRA 3H32B 3M9BA 3EFGA 1SFCA 3HD7D 1FZGA 3O8ZA 1T3UA 4W7ZA 1A02J 1SLQA 1T2KC 4O9BA 1LTJB 2W6AA 2KOGA 3N7NA 4M3LA 1FU1A 3HTKB 2HPCB 1AFOA 5AVSB 5CCHC 1SQQK 1JY3O 2H7HA 1N7SA 1FAVA 3V2RA 1RF0A 4GIFA 1SFCB 4JF7A 3BVHA 3P8MC 2WSFH 5AVYB 3RL0B 4I6MC 3VN0A 2H8PD 2OARA 1L0NK 2XKMA 3M06A 2YKOA 1LTSC 2PAJA 3M9HA 1W2EA 1NTZK 2R5BA 2OYHA 1RF1C 1M7LA 2HYNA 1KQLA 1J1DB 1N7SB 3BRTB 2WSCH 4GKGA 2NPSC 5KJ7A 4DZOA 1RF1A 1JY3N 4KHXA 1KFMA 1NKZB 5AW9B 5AW4B 1LTBC 2VRSA 2OYHB 3RK3C 5AVZB 2GM4A 2O1JA 1ZR2A 2C0WA 1SQBK 2W27A 1M1JC 3CLQA 4C7RA 2KLVA 2ZXEB 4LLHA 1RF1B 2WPQA 4B86A 3B5ND 1T3JA 3U1AA 2O01H 2R5DA 5CJ0A 4EOTA 2XV5A 3NFQA 1GZLA 2QM7A 3BATA 1HGZA 1FJPA 1IFNA 3MIWA 1KILA 1YYCA 1NH4A 4IFMA 3A7OA 2A45G 1HTLC 1IFJA 1GDTA 2HODA 2HFED 3HD7A 4WB4A 4GT1A 3CL3D 1IK9A 4W7YA 2Z5HA 2YO3A 3P32A 2GUVA 2JJLA 2CPSA 1WRGA 1FZBA 2XU6A 1SVFA 1NAFA 4WY4C 1S9KE 1GL2C 2WPSA 3LIDA 4I1LA 1A02F 1NOHA 4IFDK 1EQ7A 5AW0B 5KTBA 2HODB 3A2AA 2YKPA 1SFCC 5AW3B 1SQXK 3TNUA 2N9BA 3HD7B 1GTWA 5AVRB 2BASA 3A3YB 3RL0C 1KZUB 3II6A 1MZ9A 1X79B 5CHXA 2HG5D 2CPBA 1J1EB 1HVVA 4JYCA 3MTUE 1J2JB 1LTTC 1JCCA 3PP5A 1J1DC 1N7SC 2LKMA 1GU5A 4JYBA 1RY3A 1RF0C 5APTA 3TNUB 2FFDC 2J58A 2FKWB 1NKNA 1H8AA 2P1JA 2WSEH 2YO2A 3V5BA 1LTAC 3OA7A 4WY4B 3V4WA 1GL2B 1HGVA 3EQ2A 4LC1A 1LT9C 1GK6A 3M0AA 3HRNA 1IFDA 2FFDA 1DX7A 2XDJA 2J59M 2OYHC 3IFMA 1QL2A 5BVZA 1LT9A 2WT7A 3R2PA 2A45I 2KB7P 5KJ7C 1T8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GHG C;  1LTJ B;  2FFD C;  1W2E A;  3E1I A;  1N73 A;  2OYH A;  3HUS A;  2OYI A;  1FZC A;  1RE4 A;  1FZE A;  2Z4E A;  1N86 A;  1RF1 C;  2HOD B;  1LWU C;  1RE3 C;  2A45 G;  2HPC B;  1M1J C;  1JY2 N;  1LTJ A;  1JY3 O;  1JY2 P;  1LT9 C;  3GHG B;  1FZF A;  2FFD B;  1RF1 B;  2HOD A;  2HPC A;  1LWU B;  2HLO A;  1RF0 A;  1M1J B;  3GHG A;  1FZC C;  2FFD A;  3BVH A;  1RF1 A;  1N73 C;  1JY3 P;  3HUS C;  1LT9 B;  1RE4 C;  1JY3 N;  2OYI C;  2OYH C;  1LWU A;  1RE3 A;  3H32 B;  1FZA A;  1M1J A;  2H43 A;  1LTJ C;  1FZG A;  1T3U A;  3H32 A;  1LT9 A;  1N73 B;  2OYH B;  3HUS B;  2A45 H;  1FZB A;  2OYI B;  2XNX A;  1JY2 O;  1FZC B;  2A45 I;  2Q9I A;  1RF0 C; 
#chains in the Genus database with same CATH topology
 2Q1K A;  1NTK D;  3WMM 0;  5B66 H;  3H1K D;  2QE7 H;  1KC8 Q;  2P2U A;  4Y99 B;  1K8A Q;  2IZ1 A;  2WT7 B;  2B87 A;  2N1T D;  3CCV P;  3MHV A;  3N4X A;  5AW5 B;  2P7J A;  5APU A;  2B87 B;  2FYN B;  1KV4 A;  3CX5 H;  1OW6 A;  1DEE G;  1NU1 E;  3CCQ P;  4H0L D;  5CCH D;  3VP8 A;  3AE8 C;  1EZV G;  1VDF A;  2POH A;  1HWT C;  2R3C A;  1IO4 A;  3C9I A;  3P7K A;  1BSN A;  1M1K Q;  1KB9 E;  2W6B A;  1T6A A;  2Y9Z A;  4LGD E;  3T97 A;  1VPC A;  2K9J A;  1JY2 N;  1K04 A;  4OWF A;  3LIE A;  1R5S A;  4AYC A;  1P84 E;  2E75 D;  5CCG C;  2ZT9 C;  5AW7 B;  1USE A;  3L75 D;  2YXQ B;  2FYU G;  2PGD A;  3T97 B;  2YMY A;  1FS0 E;  2W8Z A;  4K35 A;  3D70 A;  1ZOY C;  3EFF K;  3BCC J;  2K9J B;  4L75 A;  5APS A;  5CJ4 A;  2D2C D;  4W80 A;  3BRV B;  2N1T A;  3AE9 C;  3MZW B;  3B5N C;  2XNX A;  1MFT A;  3L72 G;  3L35 A;  1SQB E;  5AVV B;  1PPJ G;  3D6Y A;  2N1T B;  2KXP B;  1G2C A;  2FYU K;  3CX5 I;  5CCH A;  1WT6 A;  1MKM A;  2RN0 A;  3CXH I;  3M0D C;  2FXM A;  1VF5 C;  2P58 A;  4AUW A;  2E76 D;  1SQX D;  1BGY G;  3WU2 E;  2ZFC A;  2KZI A;  1JMB A;  1X22 A;  1SQP D;  3L74 E;  4U3F G;  1G2C B;  1ZV8 A;  1QVF O;  4H0L B;  1EDK A;  1DH3 A;  3BCC D;  5APX A;  1NHL A;  2SPZ A;  1K05 A;  1FZC C;  1PFI A;  1VQ4 P;  1N7S D;  4JPZ B;  2BEZ F;  4MN4 C;  2A45 H;  3L72 J;  1VL2 A;  5KLV G;  1QEX A;  2KP8 A;  1YQ3 C;  4IL6 H;  2BEQ D;  1JOC A;  1HUC A;  2WSE J;  1JCD A;  1RE4 C;  3H1J J;  3TK1 A;  1NTZ D;  4BRY A;  2QIW A;  1URQ C;  1BGY J;  1QVG O;  2C9N Y;  3Q5P A;  5GTH H;  2E75 B;  1IZN B;  1N86 A;  1S5L H;  2I1K A;  1SQV D;  4U3F J;  5AW1 B;  2E43 A;  3WUT A;  3IF4 A;  1KOR A;  3Q1M A;  1NWQ A;  1VQO P;  3V6I A;  2BCC D;  2OYI C;  4BRY B;  5KLV K;  2Y0D A;  1L0N G;  1X8Y A;  4PJ0 E;  3PHL A;  4GOE A;  1HJ0 A;  3CI9 A;  1KIL D;  1LTJ A;  1YTZ I;  5KLI C;  3L73 E;  1S3J A;  3L37 A;  1YJ9 P;  1XTG B;  1N73 C;  1FOS E;  2KSE A;  1EDL A;  3S9O A;  1VQ9 P;  3HD7 D;  1FZG A;  4W7Z A;  1T3U A;  1SLQ A;  4I7Z B;  1BCC E;  1T2K C;  2R44 A;  4EI2 A;  1LTJ B;  2KOG A;  3N7N A;  1FU1 A;  2M3E A;  3H1J D;  2H7H A;  3TGU E;  1N7S A;  1FAV A;  3Q3D A;  1VQ7 P;  2E76 B;  4JF7 A;  1EDJ A;  1PGJ A;  2OAR A;  1L0N K;  2XKM A;  3H1I D;  1L0N J;  2H88 C;  4EYY Q;  2OYH A;  1J1D B;  1N7S B;  1PGQ A;  2PRR A;  4DZO A;  1RF1 A;  4TT3 H;  4KJM A;  1KFM A;  2VRS A;  3FXD A;  2OYH B;  3WUV A;  1S72 P;  5B66 E;  1ZR2 A;  5TJH A;  2W27 A;  1IFP A;  4C7R A;  1RF1 B;  1BDC A;  2N9Y B;  2QJP C;  2IYO A;  3U1A A;  2O01 H;  4IOI H;  1EZV E;  3BAT A;  4R4L A;  1FJP A;  1KIL A;  2V7Q J;  2YMK A;  1NH4 A;  4H13 D;  4IFM A;  3A7O A;  1OFC X;  1HTL C;  5M1B A;  5E79 H;  4YXD C;  2HOD A;  3HD7 A;  3CX5 E;  2JO1 A;  4ASW A;  3W67 A;  2JJL A;  1FZB A;  4WY4 C;  1A02 F;  1EQ7 A;  1NU1 J;  2IDB A;  1FE6 A;  3I56 P;  2HOD B;  1GTW A;  2N9B A;  3HD7 B;  5AVR B;  2YIU C;  2BAS A;  3RL0 C;  1QGK B;  2FYU E;  1YJN P;  3SSU A;  1LTT C;  3PP5 A;  1JCC A;  3ITK A;  2UWJ E;  2FBW C;  2QJK B;  2J58 A;  2ZVO B;  3V4W A;  3EQ2 A;  2AXT H;  3PLN A;  1IFD A;  2FFD A;  2XDJ A;  2J59 M;  1AVO A;  3A0B H;  3RK3 E;  1QL2 A;  2NZ2 A;  1SS1 A;  3B71 A;  5BVZ A;  1OVR A;  4TLF A;  3R2P A;  3SFD C;  5CMZ A;  2AEJ A;  1JMM A;  3V2P A;  2PP6 A;  4DCK A;  2FYN C;  1AQ5 A;  3CD6 P;  2FFD B;  3ZDM A;  1NU1 D;  1LWU A;  2OTK E;  3CCE P;  2WPR A;  3GLM A;  5GTI H;  3EWK A;  3RK2 D;  1UIX A;  3I5C A;  2GA1 A;  1YJW P;  2L5G B;  1AVY A;  3SWY A;  1R5L A;  1LWU B;  1KB9 D;  1UII A;  4H13 B;  5KLV E;  1Y8A A;  1G1I A;  1S9K D;  1U7M A;  3KHU A;  3VMA A;  1FZE A;  4D6T G;  5AVU B;  5KAI H;  1P84 D;  1FBM A;  2E74 C;  3VMY A;  1EDI A;  2Q3I A;  2Q5U A;  5B5E H;  3ABV C;  1FC2 C;  2NPS D;  1DD4 A;  3CME P;  4IL6 E;  1OZH A;  3GW6 A;  5TIS H;  1LP1 A;  1NTM G;  3GHG A;  4L74 A;  1RE3 A;  1HBW A;  3L73 G;  1Q90 D;  2QVA A;  3C1L A;  3H32 A;  2OGU A;  2RH0 A;  1SQB D;  3L71 D;  5GTH E;  3K5B A;  1N2D C;  2Z4E A;  1S5L E;  1LP1 B;  4D6T J;  1U7J A;  1BCC G;  3GF7 A;  3NMD A;  3HE4 A;  2IPP A;  2K9Y A;  4DOJ A;  2Q7C A;  1VQM P;  2WTY A;  1S4X A;  2MJZ A;  3MGN A;  4ZKU A;  1SP4 A;  1LJ2 A;  1KQS O;  3H1H E;  1ZME C;  1BE3 G;  3L74 D;  2GUS A;  3M91 A;  5AW8 B;  3P8C E;  1G1J A;  3HE4 B;  1JY2 P;  1NTM K;  3U1C A;  3TSI A;  1M8O B;  1NTM J;  3L36 A;  1LNQ A;  3RK2 B;  3VMX A;  1GL2 D;  2IX7 C;  3L73 J;  1ZP0 C;  1SFC D;  2A06 E;  3PH0 A;  1X0T A;  3USS A;  3CMA P;  1BCC J;  4N6J A;  3JCU H;  2RKL A;  2IFN A;  1KYO D;  4C46 A;  2AXC A;  2KK7 A;  3TGU J;  5KKZ B;  3MUD A;  4HH2 A;  2E75 C;  2O01 N;  2LXC B;  1HJB A;  2NPS A;  1SQQ D;  2G8Y A;  3CCS P;  3I55 P;  2KLU A;  2ZAE B;  3V2Q A;  1PP9 E;  1Y47 A;  3FWL A;  4XE5 B;  2NPS B;  4H44 B;  3G6E P;  4PV1 C;  1YIJ P;  3CWB G;  3RGU A;  3F5H A;  1AV1 A;  1OW8 A;  3V2N A;  2FXO A;  3B8E B;  1PZQ A;  4I7Z C;  1GK4 A;  2RMZ A;  4N78 E;  1JY3 P;  4XFJ A;  4UB8 E;  3H1L G;  1LTJ C;  3GMA A;  2B88 A;  4GDO A;  4GOF A;  3AE5 C;  1VQ6 P;  3TGU D;  1GD2 E;  1NTZ G;  3HTK A;  1SQP K;  1GL2 A;  4CPG A;  1JB0 J;  1M90 Q;  1JEK A;  1LTG C;  2IBZ G;  1L4A C;  3HUS C;  2XZR A;  2KZJ A;  1SFC A;  3O8Z A;  1A02 J;  1EZV I;  3RBX A;  3AE3 C;  2W6A A;  4PD4 H;  4M3L A;  3HTK B;  5AVS B;  2W83 C;  3V2R A;  2JWA A;  1SFC B;  3P8M C;  2WSF H;  4UB6 H;  1YIT P;  2FYU J;  2H8P D;  2YKO A;  1W2E A;  1NTZ K;  1RF1 C;  3CCU P;  1Y9B A;  3A0H H;  2WSC H;  2FY8 A;  3L70 G;  2O3J A;  1JY3 N;  5AW4 B;  4NPD A;  3GF3 A;  3RK3 C;  3Q5R A;  5K5G B;  2W90 A;  1PV3 A;  1M1J C;  2IBZ I;  2KLV A;  2ZXE B;  3CX5 D;  4B86 A;  1U57 A;  3B5N D;  3CXH D;  1T3J A;  2R5D A;  5CJ0 A;  2XV5 A;  1GZL A;  5GTI E;  3AEC C;  5CBO A;  2QJY B;  4D6T E;  2ZYA A;  3AE6 C;  2A45 G;  2KUB A;  1VQL P;  2FYU D;  5C39 A;  1GDT A;  1VF5 D;  4GT1 A;  1IK9 A;  2QJK C;  2L91 A;  2YO3 A;  2Z5H A;  2M0B A;  2GUV A;  3C8V A;  1Q86 Q;  1VQP P;  1NAF A;  3LID A;  5KLV J;  1NOH A;  2D2C B;  4PD4 I;  5KTB A;  1VQK P;  1NTM E;  3A2A A;  2WSS H;  5KAI E;  4OGQ C;  2CPB A;  3L72 D;  3AEA C;  4DT0 A;  3JC2 2;  2E5T A;  1J2J B;  1PPJ D;  1VQ8 P;  5B5E E;  1S2E A;  1RF0 C;  2FFD C;  2FKW B;  1NKN A;  2QEX P;  1LTA C;  3H1H G;  3OA7 A;  1HGV A;  5TIS E;  1GK6 A;  1AJY A;  3M0A A;  1VQ5 P;  2KNC A;  3PTZ A;  1BGY D;  2R3S A;  4ASV A;  1BE3 E;  4ZMD A;  3L75 E;  4U3F D;  1LT9 A;  2A45 I;  2KB7 P;  5KJ7 C;  1T8Z A;  4IFF A;  3R4Y A;  1JM0 A;  3KZI H;  2M3B A;  4ZNC A;  3RBZ A;  1GU4 A;  1M57 D;  2IFM A;  1H89 A;  2KNC B;  2A06 G;  3B5N A;  3CPW O;  4H13 C;  1LT9 B;  2J5U A;  2KS1 A;  4AQR D;  5AVQ B;  3B5N B;  4C7N A;  4RKU J;  3H1H J;  1L0L G;  1Z56 A;  2JP3 A;  2Y0E A;  1NYH A;  1IK7 A;  5DJU B;  1T2K D;  1FZA A;  1PP9 G;  2FYZ A;  3TDK A;  4DJG A;  4C7N B;  4XA4 A;  5CBN A;  1K9M Q;  2H89 C;  3E1I A;  2QM8 A;  1SQX E;  1VF5 B;  3IR9 A;  5AVT B;  1KQG B;  1J1E C;  1SQP E;  1P84 H;  4RO0 A;  1MV8 A;  1DIP A;  1E5W A;  1L0N D;  1KFN A;  3CWB E;  5L8R J;  1KIL B;  4NPE A;  1OX3 A;  3MD0 A;  1RE4 A;  1L0L K;  3KXD A;  1YI2 P;  3H1L E;  1MUU A;  2B89 A;  5APY A;  1XTC C;  2KSJ A;  1JUN A;  1PP9 J;  3SWK A;  1OXZ A;  4HKZ H;  1IFM A;  3CCM P;  1NTZ E;  1CW5 A;  2AEM A;  1N7L A;  2B9B A;  2OYI A;  3B4S A;  2IBZ E;  4Y99 C;  2OTL P;  3RL0 g;  2HLO A;  1NAY A;  1FJK A;  2JR8 A;  2OTJ P;  2OYI B;  2O01 J;  1N73 A;  4HJG H;  5APV A;  2C9L Y;  5KKZ C;  1ZRT E;  3VYI A;  4QMA A;  5AVW B;  5KLI B;  4WY4 D;  3CC2 P;  1CSB A;  1YBK A;  1N73 B;  4PD4 E;  3RL0 D;  3L70 E;  1FDM A;  3AEE C;  3MUD C;  2WZ7 A;  3UIA A;  4Z1M H;  3M9Q A;  5AW6 B;  4H44 C;  3HE5 A;  1IFI A;  1ZLL A;  1NTK G;  3H1K G;  2O1K A;  2JWD A;  2R32 A;  1KYO H;  2C0X A;  2WIT A;  1OWA A;  1QX8 A;  2Q9I A;  4OH8 B;  2IYP A;  3H1I E;  2P10 A;  3HE5 B;  3A0H E;  3LW5 H;  4EIJ A;  1OW7 A;  4N78 D;  1QL1 A;  2YNY A;  5BU5 A;  4I2L C;  2AEF A;  2DW3 A;  4RES B;  2ZYD A;  3QWO C;  1L2P A;  1NTK K;  1NJI Q;  2I1J A;  1NTK J;  2QJP B;  4L76 A;  4WBA A;  3V4Q A;  2QA4 P;  2WQY C;  5EFW B;  2N1T C;  2ZVN B;  2Q6Q A;  1HH0 A;  3GHG B;  4WY4 A;  2W6J H;  4N3Y B;  1TU3 F;  3H32 B;  3M9B A;  3EFG A;  5KAF H;  4YPC A;  4O9B A;  2E74 D;  3E7K A;  3L75 G;  1AFO A;  4H0L C;  5CCH C;  1SQQ K;  2M5A A;  2OQQ A;  1ZXG A;  2YIU B;  5AVY B;  3RL0 B;  1KMI Z;  2K88 A;  1OVV A;  3M06 A;  1LTS C;  2PAJ A;  4YTP C;  3M9H A;  2M5A B;  3BRT B;  3S4R A;  4BWN A;  1KN7 A;  3CCR P;  2QJY C;  4KHX A;  3AED C;  4D6T D;  2V4H A;  4NPF X;  4R4M A;  5AVZ B;  1L0L E;  2WMM A;  3CC7 P;  2GM4 A;  1BE3 J;  3KZI E;  2LXB A;  2O1J A;  2C0W A;  3Q5S A;  3L75 J;  3H25 A;  2PFX A;  3S1K A;  3FXE A;  3IAO A;  4OVN F;  2ZXX A;  1SQX G;  1SQP G;  3CXH H;  1USD A;  1AA0 A;  2QM7 A;  2D2C C;  1VQN P;  1H0T A;  3FGA D;  1HGZ A;  3BCC G;  2ZYG A;  2QSI A;  1NTM D;  1PGO A;  2MKV A;  3L73 D;  1IFJ A;  4Y28 J;  1H0T B;  1R8E A;  2ITA A;  3P32 A;  1BCC D;  1WRG A;  2XU6 A;  1SVF A;  1S9K E;  2WPS A;  4I1L A;  1M56 D;  4IFD K;  5AW0 B;  3TNU A;  2E76 C;  2IZ0 A;  1SQX K;  2YKP A;  5E79 E;  3A3Y B;  1SQX J;  1KZU B;  1MZ9 A;  1X79 B;  1LT1 A;  4L73 A;  2HG5 D;  1BE3 D;  1SQP J;  2E74 B;  1SQV G;  1PL5 A;  2CK3 H;  4EDF A;  1RHZ B;  1J1D C;  1N7S C;  2BCC G;  1WMK A;  4JYB A;  3AE4 C;  3TNU B;  3CWB J;  2WSE H;  3V5B A;  1GL2 B;  1LT9 C;  3HRN A;  2OYO A;  3AEG C;  4PV1 D;  4WVZ A;  2OYH C;  3IFM A;  3H1L J;  4BXL A;  2JKV A;  3L71 E;  2K1A A;  3PRJ A;  2Q3E A;  1NTZ J;  2AXT E;  5CCG D;  2ZT9 D;  3AEB C;  1SQV K;  2WPV B;  1LTI C;  1SQV J;  3OW2 O;  3H1J G;  2M8R A;  3A0B E;  1EZV D;  1DEB A;  2BCC J;  1FDI A;  3CCJ P;  1QLE D;  2YXR B;  4RJT A;  1Q7Y Q;  1NTK E;  3H1K E;  1L4A D;  2P67 A;  1FZF A;  1DD3 A;  3SWF A;  5APW A;  3H1I G;  1D7M A;  1KIL C;  3CWB D;  5DJT B;  3JSV C;  1JO5 A;  3PJS K;  3AEF C;  4IL6 X;  1JTH A;  1LGH B;  3SFE C;  4KT0 J;  3HD7 C;  3NXS A;  4WWI A;  3H1L D;  2I8D A;  3L70 J;  5BU8 B;  2FXP A;  1OVU A;  1S5L X;  3BAS A;  3D6Z A;  1KYO E;  1JTH B;  1OIP A;  1Q81 Q;  3L4F A;  2JEE A;  2WSF J;  1YTZ T;  1IJD B;  1SQQ E;  2IBZ D;  5H2F H;  3TYY A;  3U59 A;  1NO4 A;  3OAK A;  3H1I J;  3VTP C;  3KQG A;  3KDP B;  2KIK A;  3H6P A;  3RK3 D;  2WSC J;  2QRX A;  3FWN A;  3KYQ A;  3WUU A;  1CI6 A;  3A5T A;  2XND H;  5CCG A;  4PV1 B;  5APQ A;  1ZRT D;  2WVR A;  1W2B O;  3CCL P;  1URQ D;  1CZQ A;  2V7Q H;  1CI6 B;  4PD4 D;  2ZT9 B;  1OMI A;  3L70 D;  1RQU A;  1L4A A;  3HUS A;  1FOS F;  1E79 H;  1LWU C;  3W68 A;  1YQ4 C;  4U7J A;  2YKQ A;  3VP9 A;  2WWW A;  5KLV D;  5KAF E;  3D71 A;  1L4A B;  3HUS B;  3AE2 C;  4OGQ D;  1KD1 Q;  3G3Z A;  3OJA B;  3KPE A;  3M0D A;  1NGM B;  3G71 P;  1ZN5 A;  4HYT B;  2KS1 B;  4HB1 A;  1KB9 H;  1X9V A;  1ZR4 A;  1JY2 O;  3NTN A;  1NU1 G;  1FZC A;  1PIX A;  3JCU E;  2Z5I A;  3BCC E;  4UB8 H;  3FX0 A;  5KJ7 D;  1M1J A;  4JBZ A;  1FZC B;  1YHQ P;  3GHG C;  2KYV A;  1GW4 A;  3VMZ A;  1N8R Q;  2LR2 A;  3RK3 B;  1RE3 C;  1L0L J;  1M1J B;  1URQ A;  1EC5 A;  3CXH E;  2H43 A;  1JNM A;  3H1H D;  1NU1 K;  1W5C E;  4A7P A;  1GW3 A;  5AW2 B;  3P8C D;  3AE1 C;  2KI7 B;  4ZKP A;  1URQ B;  3RK2 C;  1H88 A;  2NRG A;  1SQV E;  1MFZ A;  2HPC A;  1BSH A;  3VOP A;  5AVX B;  2E42 A;  2BCC E;  1IC2 A;  1FDO A;  2A06 D;  3WU2 H;  2HPC B;  3AE7 C;  1JY3 O;  1Q82 Q;  1SQB G;  1KIL E;  2G3A A;  2Y0C A;  3L71 G;  1RF0 A;  4GIF A;  4OGQ B;  3BVH A;  3L72 E;  4I6M C;  3VN0 A;  1KB9 I;  1L0L D;  1PPJ E;  2R5B A;  1M7L A;  2HYN A;  1KQL A;  1KTM A;  1PP9 D;  3H1J E;  1NVO A;  4GKG A;  2NPS C;  5KJ7 A;  1P84 I;  4JQ0 D;  3L74 G;  3QH9 A;  4UB6 E;  1BGY E;  1NKZ B;  5AW9 B;  1LTB C;  2QG4 A;  4U3F E;  3G9R A;  1RQV A;  3IN6 A;  1PGP A;  4YXW H;  1SQB K;  2Y9Y A;  3CLQ A;  1SQB J;  4LLH A;  3L71 J;  2WPQ A;  4EOT A;  1S1C X;  3NFQ A;  3O6Q A;  3E1R A;  2JDI H;  1IFN A;  3MIW A;  1YYC A;  4PJ0 H;  1K73 Q;  2K3R A;  2HFE D;  4GOD A;  2HR3 A;  1SQQ G;  3L74 J;  3O6Q B;  4WB4 A;  3CL3 D;  3TF5 A;  3H1K J;  2CPS A;  1HF9 A;  1GL2 C;  3MP7 B;  1KQF B;  4H44 D;  1RH5 B;  1SFC C;  5AW3 B;  1BDD A;  1AQT A;  2ZJS E;  3II6 A;  5CHX A;  1J1E B;  1HVV A;  1L0N E;  3G4S P;  4JYC A;  3MTU E;  1EXJ A;  3GG2 A;  2LKM A;  1GU5 A;  1ZW0 A;  1RY3 A;  5APT A;  5H2F E;  3Q2Y A;  1H8A A;  2P1J A;  2E5Y A;  2YO2 A;  4WY4 B;  4LC1 A;  1SQQ J;  2K37 A;  3CC4 P;  1DX7 A;  3TGU G;  4K3A A;  3LW5 J;  3F89 A;  1GMJ A;  1KYO I;  1Q2N A;  2WT7 A;  4W7Y A;  1EXI A; 
#chains in the Genus database with same CATH homology
 1JMM A;  4IFF A;  3V2P A;  3WMM 0;  2M3B A;  2PP6 A;  1GU4 A;  2IFM A;  1H89 A;  1AQ5 A;  2FFD B;  3B5N A;  5CCG D;  2P2U A;  1SQV K;  4Y99 B;  1LTI C;  1LT9 B;  2WT7 B;  1LWU A;  2M8R A;  2WPR A;  4AQR D;  2N1T D;  1DEB A;  3RK2 D;  3N4X A;  5AVQ B;  3I5C A;  3B5N B;  4C7N A;  5AW5 B;  2P7J A;  2L5G B;  5APU A;  1L4A D;  2P67 A;  1Z56 A;  1FZF A;  3SWF A;  3SWY A;  5APW A;  1LWU B;  1KIL C;  1T2K D;  1JO5 A;  1FZA A;  2FYZ A;  1G1I A;  1S9K D;  5CCH D;  3VP8 A;  4C7N B;  4XA4 A;  1JTH A;  1LGH B;  3HD7 C;  3E1I A;  2QM8 A;  3NXS A;  1FZE A;  3IR9 A;  1VDF A;  2POH A;  5AVT B;  1J1E C;  1HWT C;  5AVU B;  2R3C A;  1IO4 A;  1FBM A;  3C9I A;  1MV8 A;  3P7K A;  5BU8 B;  1E5W A;  3VMY A;  3BAS A;  1KFN A;  1JTH B;  2Q3I A;  2W6B A;  1KIL B;  3L4F A;  2JEE A;  2Q5U A;  4LGD E;  3T97 A;  1YTZ T;  1IJD B;  1VPC A;  3MD0 A;  1RE4 A;  2NPS D;  3TYY A;  1L0L K;  1NO4 A;  3U59 A;  1JY2 N;  3OAK A;  3LIE A;  4AYC A;  3VTP C;  3KQG A;  3GHG A;  3KDP B;  1MUU A;  3H6P A;  5APY A;  1XTC C;  5CCG C;  3RK3 D;  2KSJ A;  1JUN A;  1RE3 A;  5AW7 B;  1HBW A;  1OXZ A;  3KYQ A;  1IFM A;  2YMY A;  3H32 A;  1CW5 A;  1N7L A;  1CI6 A;  3A5T A;  2OYI A;  1N2D C;  2Z4E A;  5CCG A;  5APQ A;  5APS A;  4Y99 C;  5CJ4 A;  3NMD A;  2HLO A;  3HE4 A;  2IPP A;  4W80 A;  4DOJ A;  2Q7C A;  3BRV B;  2N1T A;  2WTY A;  1FJK A;  2MJZ A;  1URQ D;  3MGN A;  1CZQ A;  4ZKU A;  1CI6 B;  1SP4 A;  2OYI B;  3B5N C;  2XNX A;  3L35 A;  5AVV B;  1N73 A;  1L4A A;  3HUS A;  1FOS F;  2GUS A;  3M91 A;  1LWU C;  3P8C E;  5AW8 B;  1G1J A;  3HE4 B;  1JY2 P;  5APV A;  1NTM K;  2C9L Y;  3U1C A;  2N1T B;  2YKQ A;  3TSI A;  3L36 A;  3VYI A;  5AVW B;  1G2C A;  3RK2 B;  3VMX A;  2FYU K;  3VP9 A;  2WWW A;  4WY4 D;  1GL2 D;  5CCH A;  1WT6 A;  2IX7 C;  3M0D C;  1CSB A;  2FXM A;  1N73 B;  1L4A B;  3HUS B;  4AUW A;  1SFC D;  2ZFC A;  3G3Z A;  3RL0 D;  3OJA B;  1FDM A;  2WZ7 A;  3UIA A;  3KPE A;  3M0D A;  3M9Q A;  1G2C B;  4N6J A;  5AW6 B;  1ZV8 A;  3HE5 A;  1IFI A;  1ZN5 A;  4HYT B;  1DH3 A;  1ZLL A;  2IFN A;  5APX A;  1NHL A;  1PFI A;  1FZC C;  2O1K A;  1N7S D;  4C46 A;  2R32 A;  3MUD A;  4HH2 A;  2C0X A;  1X9V A;  1ZR4 A;  2A45 H;  2WIT A;  1HJB A;  1JY2 O;  1OWA A;  2NPS A;  2Q9I A;  3NTN A;  4OH8 B;  2KP8 A;  1FZC A;  3HE5 B;  3V2Q A;  1JOC A;  3LW5 H;  4EIJ A;  1HUC A;  4N78 D;  2Z5I A;  1JCD A;  1QL1 A;  1RE4 C;  2YNY A;  5KJ7 D;  5BU5 A;  4XE5 B;  2NPS B;  4I2L C;  1M1J A;  3TK1 A;  1FZC B;  1URQ C;  3GHG C;  2C9N Y;  2KYV A;  1N86 A;  1GW4 A;  3VMZ A;  4RES B;  5CMZ A;  3RK3 B;  1RE3 C;  2I1K A;  5AW1 B;  2E43 A;  1NTK K;  2I1J A;  1NWQ A;  3V2N A;  3B8E B;  1M1J B;  1URQ A;  1GK4 A;  4N78 E;  1JY3 P;  2OYI C;  2H43 A;  1LTJ C;  4WBA A;  1JNM A;  3V4Q A;  5KLV K;  1NU1 K;  1GW3 A;  5AW2 B;  2N1T C;  1X8Y A;  3P8C D;  1GD2 E;  3CI9 A;  1HH0 A;  4ZKP A;  1KIL D;  1LTJ A;  1URQ B;  1YTZ I;  3RK2 C;  1H88 A;  3GHG B;  1MFZ A;  3HTK A;  1SQP K;  4WY4 A;  2HPC A;  1GL2 A;  3L37 A;  5AVX B;  3VOP A;  2E42 A;  1LTG C;  1XTG B;  4N3Y B;  1N73 C;  1FOS E;  1L4A C;  3HUS C;  1IC2 A;  2XZR A;  3H32 B;  3M9B A;  3EFG A;  1SFC A;  3HD7 D;  1FZG A;  3O8Z A;  1T3U A;  4W7Z A;  1A02 J;  1SLQ A;  1T2K C;  4O9B A;  1LTJ B;  2W6A A;  2KOG A;  3N7N A;  4M3L A;  1FU1 A;  3HTK B;  2HPC B;  1AFO A;  5AVS B;  5CCH C;  1SQQ K;  1JY3 O;  2H7H A;  1N7S A;  1FAV A;  3V2R A;  1RF0 A;  4GIF A;  1SFC B;  4JF7 A;  3BVH A;  3P8M C;  2WSF H;  5AVY B;  3RL0 B;  4I6M C;  3VN0 A;  2H8P D;  2OAR A;  1L0N K;  2XKM A;  3M06 A;  2YKO A;  1LTS C;  2PAJ A;  3M9H A;  1W2E A;  1NTZ K;  2R5B A;  2OYH A;  1RF1 C;  1M7L A;  2HYN A;  1KQL A;  1J1D B;  1N7S B;  3BRT B;  2WSC H;  4GKG A;  2NPS C;  5KJ7 A;  4DZO A;  1RF1 A;  1JY3 N;  4KHX A;  1KFM A;  1NKZ B;  5AW9 B;  5AW4 B;  1LTB C;  2VRS A;  2OYH B;  3RK3 C;  5AVZ B;  2GM4 A;  2O1J A;  1ZR2 A;  2C0W A;  1SQB K;  2W27 A;  1M1J C;  3CLQ A;  4C7R A;  2KLV A;  2ZXE B;  4LLH A;  1RF1 B;  2WPQ A;  4B86 A;  3B5N D;  1T3J A;  3U1A A;  2O01 H;  2R5D A;  5CJ0 A;  4EOT A;  2XV5 A;  3NFQ A;  1GZL A;  2QM7 A;  3BAT A;  1HGZ A;  1FJP A;  1IFN A;  3MIW A;  1KIL A;  1YYC A;  1NH4 A;  4IFM A;  3A7O A;  2A45 G;  1HTL C;  1IFJ A;  1GDT A;  2HOD A;  2HFE D;  3HD7 A;  4WB4 A;  4GT1 A;  3CL3 D;  1IK9 A;  4W7Y A;  2Z5H A;  2YO3 A;  3P32 A;  2GUV A;  2JJL A;  2CPS A;  1WRG A;  1FZB A;  2XU6 A;  1SVF A;  1NAF A;  4WY4 C;  1S9K E;  1GL2 C;  2WPS A;  3LID A;  4I1L A;  1A02 F;  1NOH A;  4IFD K;  1EQ7 A;  5AW0 B;  5KTB A;  2HOD B;  3A2A A;  2YKP A;  1SFC C;  5AW3 B;  1SQX K;  3TNU A;  2N9B A;  3HD7 B;  1GTW A;  5AVR B;  2BAS A;  3A3Y B;  3RL0 C;  1KZU B;  3II6 A;  1MZ9 A;  1X79 B;  5CHX A;  2HG5 D;  2CPB A;  1J1E B;  1HVV A;  4JYC A;  3MTU E;  1J2J B;  1LTT C;  1JCC A;  3PP5 A;  1J1D C;  1N7S C;  2LKM A;  1GU5 A;  4JYB A;  1RY3 A;  1RF0 C;  5APT A;  3TNU B;  2FFD C;  2J58 A;  2FKW B;  1NKN A;  1H8A A;  2P1J A;  2WSE H;  2YO2 A;  3V5B A;  1LTA C;  3OA7 A;  4WY4 B;  3V4W A;  1GL2 B;  1HGV A;  3EQ2 A;  4LC1 A;  1LT9 C;  1GK6 A;  3M0A A;  3HRN A;  1IFD A;  2FFD A;  1DX7 A;  2XDJ A;  2J59 M;  2OYH C;  3IFM A;  1QL2 A;  5BVZ A;  1LT9 A;  2WT7 A;  3R2P A;  2A45 I;  2KB7 P;  5KJ7 C;  1T8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...