1FZCA

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 29
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcA00
1LTJC 1RF0A 1LWUB 3BVHA 1N73C 3H32A 3GHGA 2HLOA 1M1JB 1LWUA 1M1JA 1FZGA 3GHGC 1RF0C 2A45I 2A45H 1LWUC 3HUSB 3HUSA 1LT9B 1M1JC 2Z4EA 2OYIB 2Q9IA 1LT9A 1RE4A 1T3UA 2OYHC 3E1IA 3HUSC 1FZEA 2OYIA 1RE3A 1JY3P 1FZBA 1FZAA 1LT9C 1JY3O 1N86A 1FZFA 1FZCB 1RE4C 2OYIC 1RF1B 1JY3N 1RE3C 2A45G 2H43A 1FZCA 1RF1A 2FFDB 2HODB 1W2EA 1LTJB 1N73B 1FZCC 2OYHB 2FFDA 2OYHA 1LTJA 1JY2P 1RF1C 2HODA 1JY2O 2XNXA 2HPCB 1N73A 2HPCA 1JY2N 3GHGB 2FFDC 3H32B
chains in the Genus database with same CATH superfamily
3VN0A 1PZQA 2ITAA 1S3JA 1YTZT 2WSFH 2QVAA 5APVA 5CJ4A 1L4AB 3W67A 2K1AA 1NHLA 1FS0E 4D6TG 2B9BA 2IBZD 3ITKA 1H8AA 4H0LD 1OVRA 1AQ5A 3P7KA 1M57D 2P10A 2V4HA 5CHXA 3D6ZA 4PD4E 3CCUP 1NKNA 4HJGH 1KILE 1ZN5A 1IK7A 3HD7C 1MFTA 3H25A 4XA4A 3I5CA 3AEGC 4IFFA 1QVFO 2G8YA 4GOFA 1RY3A 3KZIE 4U3FG 2B87A 5C39A 1SQVD 1LT9C 1HTLC 1R5LA 2FYUE 2RMZA 4GIFA 1NOHA 3RK3C 1URQD 1TU3F 3MIWA 1L0LK 2YMKA 3CX5D 1EDLA 4TLFA 2AXTE 2KB7P 3TK1A 1BCCE 1ZW0A 4WY4B 3B5NA 2FY8A 1PP9E 3L74E 1CW5A 2W6JH 1YQ3C 2QJPB 3GW6A 1GD2E 3L72G 3VOPA 3KDPB 5B5EE 5H2FH 3B71A 3FWLA 5DJUB 1RQUA 2A06E 2Z4EA 1USDA 2KLVA 4DT0A 1VF5D 3RK2B 2JJLA 3L73G 1HWTC 2QJKB 1MZ9A 1KZUB 1VL2A 2FYNB 3CCVP 1M8OB 1P84E 3AE2C 1FZGA 2YKQA 3A3YB 1N8RQ 2WITA 5AVXB 1LTSC 1SQXE 4D6TE 3I55P 3IR9A 3H1JJ 1NTKG 1NTZK 1YQ4C 3SWKA 1QL1A 1OFCX 3WU2H 3RK3E 3SWYA 1KYOH 3HE5B 3D70A 1KILA 1EC5A 4N6JA 3CC2P 2ZXEB 3E1IA 3O6QB 4OGQD 1VQMP 2NPSD 1BGYJ 1RE4C 2J5UA 4HH2A 1DEBA 2E75B 3A0BH 3L70G 5KLVD 1R8EA 1GTWA 4U3FE 1OVVA 3CCJP 1DD4A 3H32B 2RH0A 2YO2A 1AFOA 1KILB 1AVOA 4XE5B 1EXIA 2BCCJ 5B66H 3D6YA 4EDFA 2I1KA 3BCCG 1KB9I 3LW5H 4L73A 1L0LJ 3BATA 1SFCD 1BE3E 5TISH 4C7NA 4U7JA 1YI2P 2IFNA 2H7HA 4NPFX 5GTIE 1RH5B 3AE6C 2Q5UA 4EI2A 5AVYB 1N2DC 1W2EA 2WPRA 4A7PA 1ZR2A 4C7NB 1J1EC 3M0AA 3L73E 2O01J 3PP5A 1K73Q 2M5AA 3HTKA 3CCEP 2D2CC 3H1KJ 2P2UA 2HYNA 1AA0A 1NAFA 3CWBJ 3H1IE 3L71J 1G2CA 1JOCA 1IZNB 1LT9A 4UB8H 3U59A 3G3ZA 1NKZB 1YJWP 2FKWB 1NTZJ 2WSSH 3HD7B 2H88C 1VQNP 3K5BA 1G2CB 3FWNA 1RF0C 4RKUJ 5BVZA 3L70E 1ZXGA 2ZVNB 4BXLA 3RK3B 2KZJA 2GA1A 2PFXA 3IN6A 3RL0g 3EWKA 3F89A 1GL2A 1YYCA 2LR2A 1DIPA 1N7SC 3BCCE 1PV3A 4Y99C 5APXA 2FYUJ 5AVWB 1Y8AA 1JY2N 2UWJE 1IFJA 2Q3IA 2KXPB 1HF9A 5H2FE 1ZOYC 1EZVG 5CCGC 4O9BA 2K9JA 1PGOA 1OW8A 1YJ9P 1SS1A 1SVFA 1PP9J 2XU6A 3L74J 5AW3B 4W7ZA 3NXSA 3G4SP 1JCCA 3L75D 4JPZB 1SQQG 3HUSC 1JNMA 1GU5A 3P32A 3E1RA 2R32A 1VQPP 3CX5I 1RHZB 3GMAA 1IO4A 2I1JA 3AE8C 3PH0A 3AE4C 2IBZG 4KJMA 3WU2E 4R4LA 1KYOE 1NTKK 4C7RA 4D6TJ 1SQBG 4EIJA 3A0BE 2OGUA 3BVHA 2E5TA 2HLOA 3KHUA 5BU5A 4EOTA 1KFMA 2E42A 4GOEA 1PIXA 2OYOA 3KYQA 2QIWA 3H1JE 2KNCB 3S1KA 2GUSA 1S5LH 1SQVG 2PGDA 1X0TA 1LTJA 1IFPA 2W6AA 1JTHA 1M1JA 4U3FJ 2V7QH 2WWWA 1JY3O 5KAIE 2W8ZA 4C46A 2H89C 1J1EB 4UB6H 1ZRTD 4H13D 1BDDA 2JKVA 2I8DA 3GLMA 2KSEA 2IDBA 2QM8A 1JCDA 4JBZA 2D2CB 1PGJA 3L72J 1PGQA 4I7ZC 1NWQA 3CLQA 3I56P 4CPGA 1PFIA 4Z1MH 1Q82Q 1QL2A 1FDMA 2N1TA 1YBKA 3VMYA 3VP8A 1L4AD 3L73J 3MZWB 1OMIA 1FZFA 2WMMA 2WT7A 1RE3C 2E43A 1KC8Q 3AEAC 4M3LA 4UB8E 1P84I 3EFFK 1H0TA 1T8ZA 1N7SA 1VF5C 2QG4A 3B8EB 3H1IJ 1IC2A 3V2RA 1U7JA 2CK3H 1SQBE 1BGYD 1X79B 1OXZA 3TF5A 1NTKJ 1W5CE 3CXHD 1H0TB 4NPEA 1SQPG 1SLQA 1N7SB 5E79H 3BASA 3L71E 5CCHD 3VYIA 5CCGA 2BCCD 3HE4A 4Y99B 5KTBA 2OTKE 3L70J 3TGUG 1VQOP 1FZAA 5CJ0A 5APSA 1NTZE 2JEEA 3U1AA 4N78D 2YNYA 2OYHC 2NPSC 4RESB 1YIJP 1FOSF 1NU1G 3WUUA 3PHLA 1WT6A 4WY4D 3AE9C 3HUSA 2E74B 3U1CA 1L0NG 3RBXA 3BCCJ 4DOJA 3CCSP 3S9OA 3NTNA 2FXMA 3A0HH 3L36A 2R5BA 4YTPC 4MN4C 4AYCA 1HH0A 4OVNF 2L5GB 2MKVA 3WMM0 4PV1C 3RK2D 4ASVA 1W2BO 3H1LG 4JQ0D 2OYIC 2OTJP 1J2JB 2KOGA 3H1KD 3RL0C 1KMIZ 1NTMG 4PJ0H 1S5LX 3CWBD 3L4FA 1DX7A 1ZR4A 1J1DC 4KT0J 1SQQK 1Z56A 2YXQB 2QJYC 3TDKA 2B87B 5AW1B 2FBWC 4BWNA 1NYHA 3SSUA 2Y0EA 2FFDA 2N9BA 2O01N 1OX3A 1WMKA 1GL2C 2YXRB 3PTZA 2E75D 1SQPE 4H44C 1CI6A 3B5NB 4GT1A 2ZAEB 4PD4D 1SQBK 1KQGB 1KILD 3SFDC 1S5LE 2ZYDA 3TGUE 2JWDA 2RKLA 1K04A 1FU1A 1URQA 2E76C 2JWAA 4TT3H 3SWFA 2KP8A 2Z5IA 2GM4A 1U57A 3V2NA 1SQVK 2H43A 1NU1E 2FYUD 1HGVA 1KB9H 1E79H 2KZIA 1L0NE 3V4QA 2R44A 1M7LA 3LW5J 4UB6E 2C0XA 2GUVA 3T97A 2K3RA 5GTHH 3KPEA 1RE3A 1AV1A 1BCCD 3P8CE 4I7ZB 4HYTB 1S9KE 1PP9D 3E7KA 5AW0B 3H1HG 3L74D 1DD3A 3Q1MA 3H1LE 3T97B 3FXDA 2A06D 1NTME 4DCKA 1JUNA 2WTYA 2KS1A 2PRRA 3L75G 1SQQJ 1XTCC 1EQ7A 1FAVA 1D7MA 1P84D 5AVUB 3VTPC 1SQXD 3L72E 3HD7D 3C1LA 3ZDMA 2OYHA 2NPSA 3N4XA 1LTJC 3VP9A 4NPDA 5AW9B 1Y9BA 5E79E 3M9QA 3RK3D 2JR8A 1KD1Q 1JMBA 1M1JC 1XTGB 4ASWA 1HUCA 2ZT9C 1SQBJ 1SQPK 2KUBA 3AE3C 5KKZC 4LLHA 1RF1C 1K05A 1BSNA 2K88A 4U3FD 4OH8B 3EQ2A 1GW3A 4WWIA 2LXCB 3LIEA 3MUDC 1NTKE 2OYIA 1E5WA 1QLED 1SQVJ 1M56D 1IFDA 2M5AB 3HTKB 4N3YB 2R3SA 1NJIQ 1AVYA 1IFNA 2RN0A 1NU1K 4PV1B 3PLNA 1BE3D 1L0NK 3CXHI 1LT9B 5AW8B 2OYIB 3H1HE 4IOIH 2N1TC 3RL0B 3FGAD 3M9HA 1LJ2A 2Q6QA 3TYYA 2C0WA 1M1KQ 1J1DB 1YHQP 2PP6A 3S4RA 1K9MQ 3AEDC 5M1BA 2QJYB 1LTTC 1PL5A 4PJ0E 3V2PA 3RBZA 1FDOA 3CD6P 4EYYQ 1VQ7P 3BRVB 2W83C 3L73D 2L91A 2LXBA 4H13C 1JY3P 3GG2A 2Y9YA 4WB4A 1NTMK 3CX5H 2QRXA 1GL2B 1JY2O 3C8VA 1SP4A 3LIDA 3H1ID 1Q2NA 2IFMA 2POHA 4H44B 5APTA 5DJTB 1PPJG 2IZ0A 2O1KA 1X8YA 1NAYA 2J58A 1BGYG 5APQA 5K5GB 5KJ7D 4R4MA 3GF7A 2E76B 1FC2C 2K9JB 3L70D 5EFWB 2KI7B 1FZBA 2M0BA 1SQPJ 1MV8A 2XDJA 2VRSA 1LP1A 1KB9E 5KAFH 1HGZA 1VQ9P 2YKOA 1K8AQ 3TGUJ 3AE5C 3ABVC 1GZLA 3BCCD 1LTGC 1LNQA 1M90Q 1NO4A 3M0DC 5GTHE 2V7QJ 1FJPA 2KIKA 1NU1J 4BRYA 1DH3A 1L0NJ 2HFED 4PD4I 2D2CD 2M8RA 2CPSA 1T3UA 2Q3EA 4QMAA 5AVSB 2G3AA 5AVRB 1BSHA 4H0LC 4WY4C 5B66E 1X9VA 2FFDC 1DEEG 2BEZF 2QJPC 1FBMA 3M9BA 1QVGO 2ZVOB 3H1LJ 5TISE 3OJAB 1IK9A 1NTMJ 1NGMB 4XFJA 1RF1A 1LTJB 1P84H 1EZVE 3A7OA 3VMZA 1PPJE 2QJKC 1JTHB 4RJTA 1MUUA 1M1JB 4AUWA 2O1JA 2ZT9B 3MUDA 1URQC 4IL6X 1CZQA 5KKZB 1LT1A 1N7SD 1RF1B 1R5SA 1KYOD 2KYVA 1SQQE 1LTBC 1EDJA 1FE6A 2YIUC 1OW6A 2SPZA 1ZLLA 2A45I 1RQVA 2WSEH 1UIIA 4HKZH 3EFGA 4GODA 1S2EA 3MHVA 3H1JD 2E75C 3G6EP 2HODA 2IBZE 5AVTB 2J59M 2FYUG 2E74D 2N1TB 3OA7A 1OZHA 4GKGA 2WQYC 2W6BA 3USSA 2WT7B 1VDFA 3WUVA 2XV5A 2HODB 4I2LC 1JB0J 3CC7P 1BCCG 2Y0DA 2HPCA 1PP9G 5KLVG 3L74G 2NRGA 4ZNCA 2B89A 1VQ8P 2Q9IA 1SQVE 4K35A 3VMXA 3H1HJ 1MFZA 3CL3D 1WRGA 1L4AA 1L0LD 1Y47A 4WVZA 2AEJA 3CX5E 4OGQC 2YKPA 2FXOA 3SFEC 2K9YA 2N9YB 3HE4B 3L75J 2P7JA 3V6IA 4HB1A 3OAKA 1VQKP 2QE7H 3V5BA 1KQLA 1OIPA 1VQ5P 1SQXG 3GF3A 2B88A 1SQQD 3CCLP 1JEKA 3B5ND 5AVVB 4IFDK 1LWUC 3HUSB 1OW7A 3M0DA 1SFCC 1SQBD 1GU4A 1KTMA 5CCHA 1OVUA 4B86A 3JC22 2R5DA 3TNUA 2XKMA 2MJZA 3AE7C 1USEA 4JF7A 3L71D 5KAFE 3AEBC 2M3EA 3PJSK 4WY4A 1BDCA 1NTZD 3TNUB 2ZXXA 1N73C 3FXEA 3MP7B 4RO0A 4W80A 2IYOA 1QX8A 1AJYA 5APWA 5AVZB 5TJHA 1BE3G 4H0LB 4KHXA 2WPVB 2JO1A 2WSCJ 5KLVE 2FFDB 3IAOA 3G9RA 1T3JA 3WUTA 2OTLP 2QM7A 4OWFA 3HRNA 1CI6B 2Y0CA 1GDTA 4I1LA 3KXDA 2XNDH 1Q90D 2XZRA 1T2KD 1Q7YQ 2M3BA 3UIAA 2WPQA 1H89A 2YO3A 5APUA 1VQLP 1URQB 1VPCA 4AQRD 2PAJA 2WSCH 3W68A 3HE5A 3H1IG 3IF4A 1ZP0C 5AW6B 3O6QA 4ZKPA 1A02J 2YIUB 2Q7CA 3IFMA 3V4WA 3V2QA 5KLIC 4LC1A 3H32A 1VQ6P 5AW2B 5CBOA 1SQPD 2JP3A 1KV4A 5AVQB 1JY2P 2XNXA 1EDIA 1VF5B 2QSIA 4YXWH 2H8PD 3TGUD 4ZKUA 3CMEP 4ZMDA 2WPSA 3CPWO 5KJ7C 2KS1B 4I6MC 2BASA 3II6A 4D6TD 4PV1D 1NU1D 1KQSO 2FYUK 4JYBA 1JMMA 1L0ND 3RL0D 1KYOI 2OQQA 3N7NA 3CXHH 5KAIH 1LTAC 1MKMA 3M06A 1GK4A 3P8CD 4OGQB 2OYHB 2NPSB 1S9KD 5KLVK 3MD0A 3H1LD 1LWUA 3AE1C 3Q5RA 3AECC 1SFCA 1UIXA 5CBNA 1S4XA 1IFMA 1NTMD 4GDOA 1GL2D 3JCUH 1HBWA 4DJGA 3QH9A 2P58A 4H44D 1T6AA 3HD7A 1EXJA 3A0HE 1LWUB 4W7YA 1HJBA 1GMJA 3GHGC 3R4YA 1SFCB 1IJDB 4IL6H 2P1JA 4L75A 1EZVI 1N86A 4DZOA 3L72D 1SQXK 2E76D 2BEQD 2O01H 1KQFB 3CC4P 1N73A 3MTUE 1KFNA 3L75E 1GW4A 2WVRA 1ZV8A 3Q2YA 2LKMA 4K3AA 3B4SA 1N73B 1FZCC 1G1IA 3F5HA 3H1JG 4IFMA 2DW3A 3AEEC 1QGKB 3CCRP 2C9NY 2IBZI 1NTKD 1CSBA 3OW2O 1L4AC 1IFIA 3G71P 3H6PA 2R3CA 1AQTA 1HVVA 5BU8B 4PD4H 3H1HD 2E74C 2O3JA 2BCCG 4YXDC 1BCCJ 2AEFA 2Z5HA 3O8ZA 5KLVJ 3A2AA 3NMDA 2AXCA 1L0LG 3CMAP 5L8RJ 3KZIH 3L35A 1U7MA 1RE4A 3Q5PA 3QWOC 2W90A 2Y9ZA 1FDIA 5KLIB 5CCHC 3NFQA 1ZRTE 1LP1B 2ZT9D 2AXTH 1FJKA 1S72P 5KJ7A 1NVOA 3BRTB 1KORA 1L2PA 2E5YA 1SQXJ 3M91A 2IX7C 2CPBA 2P67A 2OARA 5B5EH 2KNCA 3TSIA 4BRYB 1JO5A 5AW7B 3JSVC 3H1KG 3PRJA 2KLUA 3CCQP 4L74A 5AW5B 2A45H 3Q5SA 3CWBG 3D71A 3CI9A 4L76A 1G1JA 3L71G 5AW4B 3B5NC 2YMYA 1OWAA 3CCMP 2WSEJ 4YPCA 2N1TD 3RK2C 2C9LY 1NTZG 1X22A 2ZYGA 4JYCA 1KB9D 3VMAA 1YJNP 2FYNC 2QEXP 1BGYE 3CXHE 2ZJSE 1JY3N 3Q3DA 1GK6A 2KSJA 3P8MC 1Q86Q 1LGHB 1HJ0A 3GHGA 2BCCE 1NH4A 1BE3J 2JDIH 2IPPA 3A5TA 3R2PA 1S1CX 5APYA 1L0LE 5CMZA 1EDKA 4N78E 2IZ1A 1N7LA 3JCUE 5CCGD 1QEXA 3GHGB 2AEMA 1RF0A 1KN7A 2WZ7A 4WBAA 1ZMEC 2ZYAA 1LTIC 2FXPA 1FOSE 2ZFCA 1JM0A 1A02F 1FZEA 1KILC 2QA4P 1PGPA 4IL6E 4Y28J 4LGDE 1FZCA 2IYPA 2Q1KA 2WSFJ 1H88A 3RGUA 3AEFC 1EZVD 1PPJD 2K37A 2NZ2A 5GTIH 1VQ4P 4H13B 1T2KC 1Q81Q 3MGNA 3FX0A 2FYZA 1YITP 2HG5D 1FZCB 3L37A 3H1KE 1YTZI 3C9IA 2A06G 2W27A 3CWBE 2HR3A 2HPCB 2A45G 3KQGA 2KK7A
chains in the Genus database with same CATH topology
3BVHA 3VN0A 2HLOA 1H89A 2YO3A 5APUA 5BU5A 1URQB 1VPCA 4EOTA 1KFMA 4AQRD 2PAJA 2WSCH 1L0NK 2E42A 1LT9B 5AW8B 2OYIB 3HE5A 2N1TC 1YTZT 2WSFH 3KYQA 5AW6B 3RL0B 3M9HA 5APVA 4ZKPA 5CJ4A 1L4AB 3TYYA 1A02J 2GUSA 2C0WA 1J1DB 2Q7CA 1NHLA 1LTJA 2PP6A 3IFMA 3V4WA 3V2QA 2W6AA 1JTHA 4LC1A 3H32A 1H8AA 1LTTC 3V2PA 1M1JA 1AQ5A 3P7KA 5CHXA 5AW2B 3BRVB 2WWWA 1JY3P 1JY3O 4WB4A 1NTMK 5AVQB 4C46A 1NKNA 1J1EB 1JY2P 2XNXA 1GL2B 1JY2O 1ZN5A 1SP4A 2H8PD 3LIDA 3HD7C 2IFMA 2POHA 4XA4A 5APTA 3I5CA 4ZKUA 4IFFA 2QM8A 1RY3A 1JCDA 2WPSA 5KJ7C 2O1KA 1X8YA 1LT9C 1HTLC 4I6MC 2BASA 3II6A 2J58A 4GIFA 1NOHA 5APQA 3RK3C 1URQD 1NWQA 2FYUK 3MIWA 1L0LK 5KJ7D 3CLQA 4JYBA 1PFIA 1JMMA 1QL2A 3RL0D 1FDMA 2N1TA 3VMYA 3VP8A 3N7NA 1L4AD 2KB7P 1LTAC 3M06A 3TK1A 1FZBA 4WY4B 1FZFA 2WT7A 3B5NA 1RE3C 1GK4A 2E43A 1MV8A 2XDJA 2VRSA 4M3LA 3P8CD 2OYHB 1CW5A 2NPSB 1S9KD 1GD2E 3VOPA 3KDPB 1T8ZA 5KLVK 3MD0A 1N7SA 1HGZA 1LWUA 2YKOA 3B8EB 1IC2A 3V2RA 1SFCA 2Z4EA 1GZLA 2KLVA 1LTGC 1IFMA 1X79B 1NO4A 3M0DC 1GL2D 1OXZA 1HBWA 3RK2B 2JJLA 1HWTC 1MZ9A 1FJPA 1KZUB 1SLQA 1N7SB 3HD7A 1DH3A 1LWUB 3BASA 4W7YA 1HJBA 1FZGA 2HFED 3GHGC 3VYIA 5CCGA 1SFCB 1IJDB 2YKQA 5CCHD 3A3YB 2M8RA 2WITA 5AVXB 2CPSA 3HE4A 1LTSC 1T3UA 4Y99B 5KTBA 2P1JA 5AVSB 1FZAA 1N86A 5CJ0A 4DZOA 5AVRB 5APSA 1SQXK 2JEEA 4WY4C 3IR9A 2O01H 3U1AA 4N78D 1NTZK 1N73A 1X9VA 2YNYA 2OYHC 3MTUE 2FFDC 1QL1A 2NPSC 4RESB 1FBMA 1KFNA 3M9BA 1FOSF 1GW4A 1WT6A 4WY4D 3SWYA 3HUSA 1ZV8A 3HE5B 2LKMA 3U1CA 1KILA 4N6JA 2ZXEB 3E1IA 2NPSD 3OJAB 4DOJA 1IK9A 1RE4C 4HH2A 1DEBA 3NTNA 1RF1A 2FXMA 1IFNA 3L36A 1LTJB 1N73B 1FZCC 2R5BA 1G1IA 3A7OA 3VMZA 4AYCA 1GTWA 1JTHB 1HH0A 3H32B 1MUUA 2YO2A 4IFMA 1AFOA 1M1JB 4AUWA 2L5GB 3WMM0 1KILB 3RK2D 2O1JA 3MUDA 4XE5B 2C9NY 1URQC 1CZQA 2OYIC 1N7SD 1RF1B 1J2JB 2I1KA 2KOGA 3LW5H 3RL0C 1CSBA 2KYVA 3BATA 1SFCD 1L4AC 1IFIA 1LTBC 3L4FA 1DX7A 3H6PA 1J1DC 1ZR4A 1SQQK 4C7NA 1ZLLA 1Z56A 2A45I 2R3CA 2IFNA 1HVVA 5BU8B 2WSEH 2H7HA 5AW1B 2Q5UA 2Z5HA 3EFGA 5AVYB 1N2DC 3O8ZA 1W2EA 2FFDA 2N9BA 2HODA 5AVTB 2WPRA 2J59M 1ZR2A 3A2AA 3NMDA 4C7NB 1J1EC 1GL2C 2N1TB 3M0AA 3OA7A 3L35A 1RE4A 3PP5A 4GKGA 2W6BA 2WT7B 1CI6A 3B5NB 4GT1A 1VDFA 1SQBK 2XV5A 5CCHC 2HODB 3NFQA 4I2LC 3HTKA 2P2UA 2HPCA 1KILD 2HYNA 1NAFA 1FU1A 1FJKA 1URQA 5KJ7A 1G2CA 1JOCA 3BRTB 2Q9IA 1LT9A 3SWFA 2KP8A 2Z5IA 2GM4A 3U59A 3VMXA 3G3ZA 3M91A 1NKZB 1MFZA 1SQVK 2FKWB 2CPBA 2IX7C 3CL3D 2P67A 3V2NA 2OARA 1WRGA 2H43A 1L4AA 1HGVA 3TSIA 3HD7B 1JO5A 3V4QA 1M7LA 5AW7B 1G2CB 2YKPA 1RF0C 5AW5B 5BVZA 2A45H 2C0XA 2GUVA 3T97A 3HE4B 3CI9A 2P7JA 3KPEA 1G1JA 1RE3A 3OAKA 3RK3B 5AW4B 3P8CE 3V5BA 4HYTB 1KQLA 3B5NC 2YMYA 1OWAA 1S9KE 5AW0B 2N1TD 3RK2C 1GL2A 2C9LY 1YYCA 4JYCA 1N7SC 3B5ND 5AVVB 4IFDK 1LWUC 3HUSB 3M0DA 1JUNA 1SFCC 2WTYA 1GU4A 5CCHA 1JY3N 4Y99C 4B86A 1GK6A 2KSJA 3P8MC 2R5DA 5APXA 5AVWB 1LGHB 1JY2N 3TNUA 2XKMA 2MJZA 1IFJA 2Q3IA 3GHGA 1XTCC 4JF7A 1EQ7A 1FAVA 1NH4A 5AVUB 3VTPC 5CCGC 4O9BA 2IPPA 3A5TA 3R2PA 5APYA 3HD7D 4WY4A 5CMZA 1SVFA 4N78E 1N7LA 5CCGD 2OYHA 2NPSA 3TNUB 2XU6A 3GHGB 5AW3B 4W7ZA 3N4XA 1LTJC 1RF0A 3NXSA 1N73C 2WZ7A 4WBAA 3VP9A 4W80A 5AW9B 3M9QA 1LTIC 1FOSE 1JCCA 3RK3D 2ZFCA 5APWA 5AVZB 1M1JC 1A02F 3HUSC 1FZEA 4KHXA 1JNMA 1GU5A 3P32A 1KILC 1XTGB 1HUCA 4LGDE 1FZCA 2R32A 1SQPK 2FFDB 4LLHA 1RF1C 1IO4A 1H88A 2I1JA 1T3JA 2QM7A 4OH8B 3EQ2A 1GW3A 1T2KC 3LIEA 3MGNA 3HRNA 1CI6B 2OYIA 2FYZA 1E5WA 2HG5D 1FZCB 3L37A 1GDTA 1YTZI 4I1LA 3C9IA 2W27A 1NTKK 4C7RA 1IFDA 3HTKB 4N3YB 2XZRA 1T2KD 2HPCB 2M3BA 4EIJA 3UIAA 2A45G 2WPQA 3KQGA 1NU1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ C;  1RF0 A;  1LWU B;  3BVH A;  1N73 C;  3H32 A;  3GHG A;  2HLO A;  1M1J B;  1LWU A;  1M1J A;  1FZG A;  3GHG C;  1RF0 C;  2A45 I;  2A45 H;  1LWU C;  3HUS B;  3HUS A;  1LT9 B;  1M1J C;  2Z4E A;  2OYI B;  2Q9I A;  1LT9 A;  1RE4 A;  1T3U A;  2OYH C;  3E1I A;  3HUS C;  1FZE A;  2OYI A;  1RE3 A;  1JY3 P;  1FZB A;  1FZA A;  1LT9 C;  1JY3 O;  1N86 A;  1FZF A;  1FZC B;  1RE4 C;  2OYI C;  1RF1 B;  1JY3 N;  1RE3 C;  2A45 G;  2H43 A;  1FZC A;  1RF1 A;  2FFD B;  2HOD B;  1W2E A;  1LTJ B;  1N73 B;  1FZC C;  2OYH B;  2FFD A;  2OYH A;  1LTJ A;  1JY2 P;  1RF1 C;  2HOD A;  1JY2 O;  2XNX A;  2HPC B;  1N73 A;  2HPC A;  1JY2 N;  3GHG B;  2FFD C;  3H32 B; 
#chains in the Genus database with same CATH topology
 3VN0 A;  1PZQ A;  2ITA A;  1S3J A;  1YTZ T;  2WSF H;  2QVA A;  5APV A;  5CJ4 A;  1L4A B;  3W67 A;  2K1A A;  1NHL A;  1FS0 E;  4D6T G;  2B9B A;  2IBZ D;  3ITK A;  1H8A A;  4H0L D;  1OVR A;  1AQ5 A;  3P7K A;  1M57 D;  2P10 A;  2V4H A;  5CHX A;  3D6Z A;  4PD4 E;  3CCU P;  1NKN A;  4HJG H;  1KIL E;  1ZN5 A;  1IK7 A;  3HD7 C;  1MFT A;  3H25 A;  4XA4 A;  3I5C A;  3AEG C;  4IFF A;  1QVF O;  2G8Y A;  4GOF A;  1RY3 A;  3KZI E;  4U3F G;  2B87 A;  5C39 A;  1SQV D;  1LT9 C;  1HTL C;  1R5L A;  2FYU E;  2RMZ A;  4GIF A;  1NOH A;  3RK3 C;  1URQ D;  1TU3 F;  3MIW A;  1L0L K;  2YMK A;  3CX5 D;  1EDL A;  4TLF A;  2AXT E;  2KB7 P;  3TK1 A;  1BCC E;  1ZW0 A;  4WY4 B;  3B5N A;  2FY8 A;  1PP9 E;  3L74 E;  1CW5 A;  2W6J H;  1YQ3 C;  2QJP B;  3GW6 A;  1GD2 E;  3L72 G;  3VOP A;  3KDP B;  5B5E E;  5H2F H;  3B71 A;  3FWL A;  5DJU B;  1RQU A;  2A06 E;  2Z4E A;  1USD A;  2KLV A;  4DT0 A;  1VF5 D;  3RK2 B;  2JJL A;  3L73 G;  1HWT C;  2QJK B;  1MZ9 A;  1KZU B;  1VL2 A;  2FYN B;  3CCV P;  1M8O B;  1P84 E;  3AE2 C;  1FZG A;  2YKQ A;  3A3Y B;  1N8R Q;  2WIT A;  5AVX B;  1LTS C;  1SQX E;  4D6T E;  3I55 P;  3IR9 A;  3H1J J;  1NTK G;  1NTZ K;  1YQ4 C;  3SWK A;  1QL1 A;  1OFC X;  3WU2 H;  3RK3 E;  3SWY A;  1KYO H;  3HE5 B;  3D70 A;  1KIL A;  1EC5 A;  4N6J A;  3CC2 P;  2ZXE B;  3E1I A;  3O6Q B;  4OGQ D;  1VQM P;  2NPS D;  1BGY J;  1RE4 C;  2J5U A;  4HH2 A;  1DEB A;  2E75 B;  3A0B H;  3L70 G;  5KLV D;  1R8E A;  1GTW A;  4U3F E;  1OVV A;  3CCJ P;  1DD4 A;  3H32 B;  2RH0 A;  2YO2 A;  1AFO A;  1KIL B;  1AVO A;  4XE5 B;  1EXI A;  2BCC J;  5B66 H;  3D6Y A;  4EDF A;  2I1K A;  3BCC G;  1KB9 I;  3LW5 H;  4L73 A;  1L0L J;  3BAT A;  1SFC D;  1BE3 E;  5TIS H;  4C7N A;  4U7J A;  1YI2 P;  2IFN A;  2H7H A;  4NPF X;  5GTI E;  1RH5 B;  3AE6 C;  2Q5U A;  4EI2 A;  5AVY B;  1N2D C;  1W2E A;  2WPR A;  4A7P A;  1ZR2 A;  4C7N B;  1J1E C;  3M0A A;  3L73 E;  2O01 J;  3PP5 A;  1K73 Q;  2M5A A;  3HTK A;  3CCE P;  2D2C C;  3H1K J;  2P2U A;  2HYN A;  1AA0 A;  1NAF A;  3CWB J;  3H1I E;  3L71 J;  1G2C A;  1JOC A;  1IZN B;  1LT9 A;  4UB8 H;  3U59 A;  3G3Z A;  1NKZ B;  1YJW P;  2FKW B;  1NTZ J;  2WSS H;  3HD7 B;  2H88 C;  1VQN P;  3K5B A;  1G2C B;  3FWN A;  1RF0 C;  4RKU J;  5BVZ A;  3L70 E;  1ZXG A;  2ZVN B;  4BXL A;  3RK3 B;  2KZJ A;  2GA1 A;  2PFX A;  3IN6 A;  3RL0 g;  3EWK A;  3F89 A;  1GL2 A;  1YYC A;  2LR2 A;  1DIP A;  1N7S C;  3BCC E;  1PV3 A;  4Y99 C;  5APX A;  2FYU J;  5AVW B;  1Y8A A;  1JY2 N;  2UWJ E;  1IFJ A;  2Q3I A;  2KXP B;  1HF9 A;  5H2F E;  1ZOY C;  1EZV G;  5CCG C;  4O9B A;  2K9J A;  1PGO A;  1OW8 A;  1YJ9 P;  1SS1 A;  1SVF A;  1PP9 J;  2XU6 A;  3L74 J;  5AW3 B;  4W7Z A;  3NXS A;  3G4S P;  1JCC A;  3L75 D;  4JPZ B;  1SQQ G;  3HUS C;  1JNM A;  1GU5 A;  3P32 A;  3E1R A;  2R32 A;  1VQP P;  3CX5 I;  1RHZ B;  3GMA A;  1IO4 A;  2I1J A;  3AE8 C;  3PH0 A;  3AE4 C;  2IBZ G;  4KJM A;  3WU2 E;  4R4L A;  1KYO E;  1NTK K;  4C7R A;  4D6T J;  1SQB G;  4EIJ A;  3A0B E;  2OGU A;  3BVH A;  2E5T A;  2HLO A;  3KHU A;  5BU5 A;  4EOT A;  1KFM A;  2E42 A;  4GOE A;  1PIX A;  2OYO A;  3KYQ A;  2QIW A;  3H1J E;  2KNC B;  3S1K A;  2GUS A;  1S5L H;  1SQV G;  2PGD A;  1X0T A;  1LTJ A;  1IFP A;  2W6A A;  1JTH A;  1M1J A;  4U3F J;  2V7Q H;  2WWW A;  1JY3 O;  5KAI E;  2W8Z A;  4C46 A;  2H89 C;  1J1E B;  4UB6 H;  1ZRT D;  4H13 D;  1BDD A;  2JKV A;  2I8D A;  3GLM A;  2KSE A;  2IDB A;  2QM8 A;  1JCD A;  4JBZ A;  2D2C B;  1PGJ A;  3L72 J;  1PGQ A;  4I7Z C;  1NWQ A;  3CLQ A;  3I56 P;  4CPG A;  1PFI A;  4Z1M H;  1Q82 Q;  1QL2 A;  1FDM A;  2N1T A;  1YBK A;  3VMY A;  3VP8 A;  1L4A D;  3L73 J;  3MZW B;  1OMI A;  1FZF A;  2WMM A;  2WT7 A;  1RE3 C;  2E43 A;  1KC8 Q;  3AEA C;  4M3L A;  4UB8 E;  1P84 I;  3EFF K;  1H0T A;  1T8Z A;  1N7S A;  1VF5 C;  2QG4 A;  3B8E B;  3H1I J;  1IC2 A;  3V2R A;  1U7J A;  2CK3 H;  1SQB E;  1BGY D;  1X79 B;  1OXZ A;  3TF5 A;  1NTK J;  1W5C E;  3CXH D;  1H0T B;  4NPE A;  1SQP G;  1SLQ A;  1N7S B;  5E79 H;  3BAS A;  3L71 E;  5CCH D;  3VYI A;  5CCG A;  2BCC D;  3HE4 A;  4Y99 B;  5KTB A;  2OTK E;  3L70 J;  3TGU G;  1VQO P;  1FZA A;  5CJ0 A;  5APS A;  1NTZ E;  2JEE A;  3U1A A;  4N78 D;  2YNY A;  2OYH C;  2NPS C;  4RES B;  1YIJ P;  1FOS F;  1NU1 G;  3WUU A;  3PHL A;  1WT6 A;  4WY4 D;  3AE9 C;  3HUS A;  2E74 B;  3U1C A;  1L0N G;  3RBX A;  3BCC J;  4DOJ A;  3CCS P;  3S9O A;  3NTN A;  2FXM A;  3A0H H;  3L36 A;  2R5B A;  4YTP C;  4MN4 C;  4AYC A;  1HH0 A;  4OVN F;  2L5G B;  2MKV A;  3WMM 0;  4PV1 C;  3RK2 D;  4ASV A;  1W2B O;  3H1L G;  4JQ0 D;  2OYI C;  2OTJ P;  1J2J B;  2KOG A;  3H1K D;  3RL0 C;  1KMI Z;  1NTM G;  4PJ0 H;  1S5L X;  3CWB D;  3L4F A;  1DX7 A;  1ZR4 A;  1J1D C;  4KT0 J;  1SQQ K;  1Z56 A;  2YXQ B;  2QJY C;  3TDK A;  2B87 B;  5AW1 B;  2FBW C;  4BWN A;  1NYH A;  3SSU A;  2Y0E A;  2FFD A;  2N9B A;  2O01 N;  1OX3 A;  1WMK A;  1GL2 C;  2YXR B;  3PTZ A;  2E75 D;  1SQP E;  4H44 C;  1CI6 A;  3B5N B;  4GT1 A;  2ZAE B;  4PD4 D;  1SQB K;  1KQG B;  1KIL D;  3SFD C;  1S5L E;  2ZYD A;  3TGU E;  2JWD A;  2RKL A;  1K04 A;  1FU1 A;  1URQ A;  2E76 C;  2JWA A;  4TT3 H;  3SWF A;  2KP8 A;  2Z5I A;  2GM4 A;  1U57 A;  3V2N A;  1SQV K;  2H43 A;  1NU1 E;  2FYU D;  1HGV A;  1KB9 H;  1E79 H;  2KZI A;  1L0N E;  3V4Q A;  2R44 A;  1M7L A;  3LW5 J;  4UB6 E;  2C0X A;  2GUV A;  3T97 A;  2K3R A;  5GTH H;  3KPE A;  1RE3 A;  1AV1 A;  1BCC D;  3P8C E;  4I7Z B;  4HYT B;  1S9K E;  1PP9 D;  3E7K A;  5AW0 B;  3H1H G;  3L74 D;  1DD3 A;  3Q1M A;  3H1L E;  3T97 B;  3FXD A;  2A06 D;  1NTM E;  4DCK A;  1JUN A;  2WTY A;  2KS1 A;  2PRR A;  3L75 G;  1SQQ J;  1XTC C;  1EQ7 A;  1FAV A;  1D7M A;  1P84 D;  5AVU B;  3VTP C;  1SQX D;  3L72 E;  3HD7 D;  3C1L A;  3ZDM A;  2OYH A;  2NPS A;  3N4X A;  1LTJ C;  3VP9 A;  4NPD A;  5AW9 B;  1Y9B A;  5E79 E;  3M9Q A;  3RK3 D;  2JR8 A;  1KD1 Q;  1JMB A;  1M1J C;  1XTG B;  4ASW A;  1HUC A;  2ZT9 C;  1SQB J;  1SQP K;  2KUB A;  3AE3 C;  5KKZ C;  4LLH A;  1RF1 C;  1K05 A;  1BSN A;  2K88 A;  4U3F D;  4OH8 B;  3EQ2 A;  1GW3 A;  4WWI A;  2LXC B;  3LIE A;  3MUD C;  1NTK E;  2OYI A;  1E5W A;  1QLE D;  1SQV J;  1M56 D;  1IFD A;  2M5A B;  3HTK B;  4N3Y B;  2R3S A;  1NJI Q;  1AVY A;  1IFN A;  2RN0 A;  1NU1 K;  4PV1 B;  3PLN A;  1BE3 D;  1L0N K;  3CXH I;  1LT9 B;  5AW8 B;  2OYI B;  3H1H E;  4IOI H;  2N1T C;  3RL0 B;  3FGA D;  3M9H A;  1LJ2 A;  2Q6Q A;  3TYY A;  2C0W A;  1M1K Q;  1J1D B;  1YHQ P;  2PP6 A;  3S4R A;  1K9M Q;  3AED C;  5M1B A;  2QJY B;  1LTT C;  1PL5 A;  4PJ0 E;  3V2P A;  3RBZ A;  1FDO A;  3CD6 P;  4EYY Q;  1VQ7 P;  3BRV B;  2W83 C;  3L73 D;  2L91 A;  2LXB A;  4H13 C;  1JY3 P;  3GG2 A;  2Y9Y A;  4WB4 A;  1NTM K;  3CX5 H;  2QRX A;  1GL2 B;  1JY2 O;  3C8V A;  1SP4 A;  3LID A;  3H1I D;  1Q2N A;  2IFM A;  2POH A;  4H44 B;  5APT A;  5DJT B;  1PPJ G;  2IZ0 A;  2O1K A;  1X8Y A;  1NAY A;  2J58 A;  1BGY G;  5APQ A;  5K5G B;  5KJ7 D;  4R4M A;  3GF7 A;  2E76 B;  1FC2 C;  2K9J B;  3L70 D;  5EFW B;  2KI7 B;  1FZB A;  2M0B A;  1SQP J;  1MV8 A;  2XDJ A;  2VRS A;  1LP1 A;  1KB9 E;  5KAF H;  1HGZ A;  1VQ9 P;  2YKO A;  1K8A Q;  3TGU J;  3AE5 C;  3ABV C;  1GZL A;  3BCC D;  1LTG C;  1LNQ A;  1M90 Q;  1NO4 A;  3M0D C;  5GTH E;  2V7Q J;  1FJP A;  2KIK A;  1NU1 J;  4BRY A;  1DH3 A;  1L0N J;  2HFE D;  4PD4 I;  2D2C D;  2M8R A;  2CPS A;  1T3U A;  2Q3E A;  4QMA A;  5AVS B;  2G3A A;  5AVR B;  1BSH A;  4H0L C;  4WY4 C;  5B66 E;  1X9V A;  2FFD C;  1DEE G;  2BEZ F;  2QJP C;  1FBM A;  3M9B A;  1QVG O;  2ZVO B;  3H1L J;  5TIS E;  3OJA B;  1IK9 A;  1NTM J;  1NGM B;  4XFJ A;  1RF1 A;  1LTJ B;  1P84 H;  1EZV E;  3A7O A;  3VMZ A;  1PPJ E;  2QJK C;  1JTH B;  4RJT A;  1MUU A;  1M1J B;  4AUW A;  2O1J A;  2ZT9 B;  3MUD A;  1URQ C;  4IL6 X;  1CZQ A;  5KKZ B;  1LT1 A;  1N7S D;  1RF1 B;  1R5S A;  1KYO D;  2KYV A;  1SQQ E;  1LTB C;  1EDJ A;  1FE6 A;  2YIU C;  1OW6 A;  2SPZ A;  1ZLL A;  2A45 I;  1RQV A;  2WSE H;  1UII A;  4HKZ H;  3EFG A;  4GOD A;  1S2E A;  3MHV A;  3H1J D;  2E75 C;  3G6E P;  2HOD A;  2IBZ E;  5AVT B;  2J59 M;  2FYU G;  2E74 D;  2N1T B;  3OA7 A;  1OZH A;  4GKG A;  2WQY C;  2W6B A;  3USS A;  2WT7 B;  1VDF A;  3WUV A;  2XV5 A;  2HOD B;  4I2L C;  1JB0 J;  3CC7 P;  1BCC G;  2Y0D A;  2HPC A;  1PP9 G;  5KLV G;  3L74 G;  2NRG A;  4ZNC A;  2B89 A;  1VQ8 P;  2Q9I A;  1SQV E;  4K35 A;  3VMX A;  3H1H J;  1MFZ A;  3CL3 D;  1WRG A;  1L4A A;  1L0L D;  1Y47 A;  4WVZ A;  2AEJ A;  3CX5 E;  4OGQ C;  2YKP A;  2FXO A;  3SFE C;  2K9Y A;  2N9Y B;  3HE4 B;  3L75 J;  2P7J A;  3V6I A;  4HB1 A;  3OAK A;  1VQK P;  2QE7 H;  3V5B A;  1KQL A;  1OIP A;  1VQ5 P;  1SQX G;  3GF3 A;  2B88 A;  1SQQ D;  3CCL P;  1JEK A;  3B5N D;  5AVV B;  4IFD K;  1LWU C;  3HUS B;  1OW7 A;  3M0D A;  1SFC C;  1SQB D;  1GU4 A;  1KTM A;  5CCH A;  1OVU A;  4B86 A;  3JC2 2;  2R5D A;  3TNU A;  2XKM A;  2MJZ A;  3AE7 C;  1USE A;  4JF7 A;  3L71 D;  5KAF E;  3AEB C;  2M3E A;  3PJS K;  4WY4 A;  1BDC A;  1NTZ D;  3TNU B;  2ZXX A;  1N73 C;  3FXE A;  3MP7 B;  4RO0 A;  4W80 A;  2IYO A;  1QX8 A;  1AJY A;  5APW A;  5AVZ B;  5TJH A;  1BE3 G;  4H0L B;  4KHX A;  2WPV B;  2JO1 A;  2WSC J;  5KLV E;  2FFD B;  3IAO A;  3G9R A;  1T3J A;  3WUT A;  2OTL P;  2QM7 A;  4OWF A;  3HRN A;  1CI6 B;  2Y0C A;  1GDT A;  4I1L A;  3KXD A;  2XND H;  1Q90 D;  2XZR A;  1T2K D;  1Q7Y Q;  2M3B A;  3UIA A;  2WPQ A;  1H89 A;  2YO3 A;  5APU A;  1VQL P;  1URQ B;  1VPC A;  4AQR D;  2PAJ A;  2WSC H;  3W68 A;  3HE5 A;  3H1I G;  3IF4 A;  1ZP0 C;  5AW6 B;  3O6Q A;  4ZKP A;  1A02 J;  2YIU B;  2Q7C A;  3IFM A;  3V4W A;  3V2Q A;  5KLI C;  4LC1 A;  3H32 A;  1VQ6 P;  5AW2 B;  5CBO A;  1SQP D;  2JP3 A;  1KV4 A;  5AVQ B;  1JY2 P;  2XNX A;  1EDI A;  1VF5 B;  2QSI A;  4YXW H;  2H8P D;  3TGU D;  4ZKU A;  3CME P;  4ZMD A;  2WPS A;  3CPW O;  5KJ7 C;  2KS1 B;  4I6M C;  2BAS A;  3II6 A;  4D6T D;  4PV1 D;  1NU1 D;  1KQS O;  2FYU K;  4JYB A;  1JMM A;  1L0N D;  3RL0 D;  1KYO I;  2OQQ A;  3N7N A;  3CXH H;  5KAI H;  1LTA C;  1MKM A;  3M06 A;  1GK4 A;  3P8C D;  4OGQ B;  2OYH B;  2NPS B;  1S9K D;  5KLV K;  3MD0 A;  3H1L D;  1LWU A;  3AE1 C;  3Q5R A;  3AEC C;  1SFC A;  1UIX A;  5CBN A;  1S4X A;  1IFM A;  1NTM D;  4GDO A;  1GL2 D;  3JCU H;  1HBW A;  4DJG A;  3QH9 A;  2P58 A;  4H44 D;  1T6A A;  3HD7 A;  1EXJ A;  3A0H E;  1LWU B;  4W7Y A;  1HJB A;  1GMJ A;  3GHG C;  3R4Y A;  1SFC B;  1IJD B;  4IL6 H;  2P1J A;  4L75 A;  1EZV I;  1N86 A;  4DZO A;  3L72 D;  1SQX K;  2E76 D;  2BEQ D;  2O01 H;  1KQF B;  3CC4 P;  1N73 A;  3MTU E;  1KFN A;  3L75 E;  1GW4 A;  2WVR A;  1ZV8 A;  3Q2Y A;  2LKM A;  4K3A A;  3B4S A;  1N73 B;  1FZC C;  1G1I A;  3F5H A;  3H1J G;  4IFM A;  2DW3 A;  3AEE C;  1QGK B;  3CCR P;  2C9N Y;  2IBZ I;  1NTK D;  1CSB A;  3OW2 O;  1L4A C;  1IFI A;  3G71 P;  3H6P A;  2R3C A;  1AQT A;  1HVV A;  5BU8 B;  4PD4 H;  3H1H D;  2E74 C;  2O3J A;  2BCC G;  4YXD C;  1BCC J;  2AEF A;  2Z5H A;  3O8Z A;  5KLV J;  3A2A A;  3NMD A;  2AXC A;  1L0L G;  3CMA P;  5L8R J;  3KZI H;  3L35 A;  1U7M A;  1RE4 A;  3Q5P A;  3QWO C;  2W90 A;  2Y9Z A;  1FDI A;  5KLI B;  5CCH C;  3NFQ A;  1ZRT E;  1LP1 B;  2ZT9 D;  2AXT H;  1FJK A;  1S72 P;  5KJ7 A;  1NVO A;  3BRT B;  1KOR A;  1L2P A;  2E5Y A;  1SQX J;  3M91 A;  2IX7 C;  2CPB A;  2P67 A;  2OAR A;  5B5E H;  2KNC A;  3TSI A;  4BRY B;  1JO5 A;  5AW7 B;  3JSV C;  3H1K G;  3PRJ A;  2KLU A;  3CCQ P;  4L74 A;  5AW5 B;  2A45 H;  3Q5S A;  3CWB G;  3D71 A;  3CI9 A;  4L76 A;  1G1J A;  3L71 G;  5AW4 B;  3B5N C;  2YMY A;  1OWA A;  3CCM P;  2WSE J;  4YPC A;  2N1T D;  3RK2 C;  2C9L Y;  1NTZ G;  1X22 A;  2ZYG A;  4JYC A;  1KB9 D;  3VMA A;  1YJN P;  2FYN C;  2QEX P;  1BGY E;  3CXH E;  2ZJS E;  1JY3 N;  3Q3D A;  1GK6 A;  2KSJ A;  3P8M C;  1Q86 Q;  1LGH B;  1HJ0 A;  3GHG A;  2BCC E;  1NH4 A;  1BE3 J;  2JDI H;  2IPP A;  3A5T A;  3R2P A;  1S1C X;  5APY A;  1L0L E;  5CMZ A;  1EDK A;  4N78 E;  2IZ1 A;  1N7L A;  3JCU E;  5CCG D;  1QEX A;  3GHG B;  2AEM A;  1RF0 A;  1KN7 A;  2WZ7 A;  4WBA A;  1ZME C;  2ZYA A;  1LTI C;  2FXP A;  1FOS E;  2ZFC A;  1JM0 A;  1A02 F;  1FZE A;  1KIL C;  2QA4 P;  1PGP A;  4IL6 E;  4Y28 J;  4LGD E;  1FZC A;  2IYP A;  2Q1K A;  2WSF J;  1H88 A;  3RGU A;  3AEF C;  1EZV D;  1PPJ D;  2K37 A;  2NZ2 A;  5GTI H;  1VQ4 P;  4H13 B;  1T2K C;  1Q81 Q;  3MGN A;  3FX0 A;  2FYZ A;  1YIT P;  2HG5 D;  1FZC B;  3L37 A;  3H1K E;  1YTZ I;  3C9I A;  2A06 G;  2W27 A;  3CWB E;  2HR3 A;  2HPC B;  2A45 G;  3KQG A;  2KK7 A; 
#chains in the Genus database with same CATH homology
 3BVH A;  3VN0 A;  2HLO A;  1H89 A;  2YO3 A;  5APU A;  5BU5 A;  1URQ B;  1VPC A;  4EOT A;  1KFM A;  4AQR D;  2PAJ A;  2WSC H;  1L0N K;  2E42 A;  1LT9 B;  5AW8 B;  2OYI B;  3HE5 A;  2N1T C;  1YTZ T;  2WSF H;  3KYQ A;  5AW6 B;  3RL0 B;  3M9H A;  5APV A;  4ZKP A;  5CJ4 A;  1L4A B;  3TYY A;  1A02 J;  2GUS A;  2C0W A;  1J1D B;  2Q7C A;  1NHL A;  1LTJ A;  2PP6 A;  3IFM A;  3V4W A;  3V2Q A;  2W6A A;  1JTH A;  4LC1 A;  3H32 A;  1H8A A;  1LTT C;  3V2P A;  1M1J A;  1AQ5 A;  3P7K A;  5CHX A;  5AW2 B;  3BRV B;  2WWW A;  1JY3 P;  1JY3 O;  4WB4 A;  1NTM K;  5AVQ B;  4C46 A;  1NKN A;  1J1E B;  1JY2 P;  2XNX A;  1GL2 B;  1JY2 O;  1ZN5 A;  1SP4 A;  2H8P D;  3LID A;  3HD7 C;  2IFM A;  2POH A;  4XA4 A;  5APT A;  3I5C A;  4ZKU A;  4IFF A;  2QM8 A;  1RY3 A;  1JCD A;  2WPS A;  5KJ7 C;  2O1K A;  1X8Y A;  1LT9 C;  1HTL C;  4I6M C;  2BAS A;  3II6 A;  2J58 A;  4GIF A;  1NOH A;  5APQ A;  3RK3 C;  1URQ D;  1NWQ A;  2FYU K;  3MIW A;  1L0L K;  5KJ7 D;  3CLQ A;  4JYB A;  1PFI A;  1JMM A;  1QL2 A;  3RL0 D;  1FDM A;  2N1T A;  3VMY A;  3VP8 A;  3N7N A;  1L4A D;  2KB7 P;  1LTA C;  3M06 A;  3TK1 A;  1FZB A;  4WY4 B;  1FZF A;  2WT7 A;  3B5N A;  1RE3 C;  1GK4 A;  2E43 A;  1MV8 A;  2XDJ A;  2VRS A;  4M3L A;  3P8C D;  2OYH B;  1CW5 A;  2NPS B;  1S9K D;  1GD2 E;  3VOP A;  3KDP B;  1T8Z A;  5KLV K;  3MD0 A;  1N7S A;  1HGZ A;  1LWU A;  2YKO A;  3B8E B;  1IC2 A;  3V2R A;  1SFC A;  2Z4E A;  1GZL A;  2KLV A;  1LTG C;  1IFM A;  1X79 B;  1NO4 A;  3M0D C;  1GL2 D;  1OXZ A;  1HBW A;  3RK2 B;  2JJL A;  1HWT C;  1MZ9 A;  1FJP A;  1KZU B;  1SLQ A;  1N7S B;  3HD7 A;  1DH3 A;  1LWU B;  3BAS A;  4W7Y A;  1HJB A;  1FZG A;  2HFE D;  3GHG C;  3VYI A;  5CCG A;  1SFC B;  1IJD B;  2YKQ A;  5CCH D;  3A3Y B;  2M8R A;  2WIT A;  5AVX B;  2CPS A;  3HE4 A;  1LTS C;  1T3U A;  4Y99 B;  5KTB A;  2P1J A;  5AVS B;  1FZA A;  1N86 A;  5CJ0 A;  4DZO A;  5AVR B;  5APS A;  1SQX K;  2JEE A;  4WY4 C;  3IR9 A;  2O01 H;  3U1A A;  4N78 D;  1NTZ K;  1N73 A;  1X9V A;  2YNY A;  2OYH C;  3MTU E;  2FFD C;  1QL1 A;  2NPS C;  4RES B;  1FBM A;  1KFN A;  3M9B A;  1FOS F;  1GW4 A;  1WT6 A;  4WY4 D;  3SWY A;  3HUS A;  1ZV8 A;  3HE5 B;  2LKM A;  3U1C A;  1KIL A;  4N6J A;  2ZXE B;  3E1I A;  2NPS D;  3OJA B;  4DOJ A;  1IK9 A;  1RE4 C;  4HH2 A;  1DEB A;  3NTN A;  1RF1 A;  2FXM A;  1IFN A;  3L36 A;  1LTJ B;  1N73 B;  1FZC C;  2R5B A;  1G1I A;  3A7O A;  3VMZ A;  4AYC A;  1GTW A;  1JTH B;  1HH0 A;  3H32 B;  1MUU A;  2YO2 A;  4IFM A;  1AFO A;  1M1J B;  4AUW A;  2L5G B;  3WMM 0;  1KIL B;  3RK2 D;  2O1J A;  3MUD A;  4XE5 B;  2C9N Y;  1URQ C;  1CZQ A;  2OYI C;  1N7S D;  1RF1 B;  1J2J B;  2I1K A;  2KOG A;  3LW5 H;  3RL0 C;  1CSB A;  2KYV A;  3BAT A;  1SFC D;  1L4A C;  1IFI A;  1LTB C;  3L4F A;  1DX7 A;  3H6P A;  1J1D C;  1ZR4 A;  1SQQ K;  4C7N A;  1ZLL A;  1Z56 A;  2A45 I;  2R3C A;  2IFN A;  1HVV A;  5BU8 B;  2WSE H;  2H7H A;  5AW1 B;  2Q5U A;  2Z5H A;  3EFG A;  5AVY B;  1N2D C;  3O8Z A;  1W2E A;  2FFD A;  2N9B A;  2HOD A;  5AVT B;  2WPR A;  2J59 M;  1ZR2 A;  3A2A A;  3NMD A;  4C7N B;  1J1E C;  1GL2 C;  2N1T B;  3M0A A;  3OA7 A;  3L35 A;  1RE4 A;  3PP5 A;  4GKG A;  2W6B A;  2WT7 B;  1CI6 A;  3B5N B;  4GT1 A;  1VDF A;  1SQB K;  2XV5 A;  5CCH C;  2HOD B;  3NFQ A;  4I2L C;  3HTK A;  2P2U A;  2HPC A;  1KIL D;  2HYN A;  1NAF A;  1FU1 A;  1FJK A;  1URQ A;  5KJ7 A;  1G2C A;  1JOC A;  3BRT B;  2Q9I A;  1LT9 A;  3SWF A;  2KP8 A;  2Z5I A;  2GM4 A;  3U59 A;  3VMX A;  3G3Z A;  3M91 A;  1NKZ B;  1MFZ A;  1SQV K;  2FKW B;  2CPB A;  2IX7 C;  3CL3 D;  2P67 A;  3V2N A;  2OAR A;  1WRG A;  2H43 A;  1L4A A;  1HGV A;  3TSI A;  3HD7 B;  1JO5 A;  3V4Q A;  1M7L A;  5AW7 B;  1G2C B;  2YKP A;  1RF0 C;  5AW5 B;  5BVZ A;  2A45 H;  2C0X A;  2GUV A;  3T97 A;  3HE4 B;  3CI9 A;  2P7J A;  3KPE A;  1G1J A;  1RE3 A;  3OAK A;  3RK3 B;  5AW4 B;  3P8C E;  3V5B A;  4HYT B;  1KQL A;  3B5N C;  2YMY A;  1OWA A;  1S9K E;  5AW0 B;  2N1T D;  3RK2 C;  1GL2 A;  2C9L Y;  1YYC A;  4JYC A;  1N7S C;  3B5N D;  5AVV B;  4IFD K;  1LWU C;  3HUS B;  3M0D A;  1JUN A;  1SFC C;  2WTY A;  1GU4 A;  5CCH A;  1JY3 N;  4Y99 C;  4B86 A;  1GK6 A;  2KSJ A;  3P8M C;  2R5D A;  5APX A;  5AVW B;  1LGH B;  1JY2 N;  3TNU A;  2XKM A;  2MJZ A;  1IFJ A;  2Q3I A;  3GHG A;  1XTC C;  4JF7 A;  1EQ7 A;  1FAV A;  1NH4 A;  5AVU B;  3VTP C;  5CCG C;  4O9B A;  2IPP A;  3A5T A;  3R2P A;  5APY A;  3HD7 D;  4WY4 A;  5CMZ A;  1SVF A;  4N78 E;  1N7L A;  5CCG D;  2OYH A;  2NPS A;  3TNU B;  2XU6 A;  3GHG B;  5AW3 B;  4W7Z A;  3N4X A;  1LTJ C;  1RF0 A;  3NXS A;  1N73 C;  2WZ7 A;  4WBA A;  3VP9 A;  4W80 A;  5AW9 B;  3M9Q A;  1LTI C;  1FOS E;  1JCC A;  3RK3 D;  2ZFC A;  5APW A;  5AVZ B;  1M1J C;  1A02 F;  3HUS C;  1FZE A;  4KHX A;  1JNM A;  1GU5 A;  3P32 A;  1KIL C;  1XTG B;  1HUC A;  4LGD E;  1FZC A;  2R32 A;  1SQP K;  2FFD B;  4LLH A;  1RF1 C;  1IO4 A;  1H88 A;  2I1J A;  1T3J A;  2QM7 A;  4OH8 B;  3EQ2 A;  1GW3 A;  1T2K C;  3LIE A;  3MGN A;  3HRN A;  1CI6 B;  2OYI A;  2FYZ A;  1E5W A;  2HG5 D;  1FZC B;  3L37 A;  1GDT A;  1YTZ I;  4I1L A;  3C9I A;  2W27 A;  1NTK K;  4C7R A;  1IFD A;  3HTK B;  4N3Y B;  2XZR A;  1T2K D;  2HPC B;  2M3B A;  4EIJ A;  3UIA A;  2A45 G;  2WPQ A;  3KQG A;  1NU1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...