1FZCB

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRIN
total genus 93
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcB02
2Q9IA 1JY2P 2Z4EC 2H43C 1FZBC 2H43B 2FFDB 3HUSA 2JHMF 2J61B 2HLOA 2J3UA 2J61A 2OYHB 2JHLF 1N73B 1N73C 1FICA 2OYHC 1RF0C 1RF1B 2J64A 1FZGC 2Q9IB 1FZFC 2HODA 4NYTA 1Z3SA 2HODB 1FIBA 1RF0A 2J60A 2XNXB 2J3GA 2A45I 1FZFA 3HUSB 2J0HA 2OYIC 1FZAB 4R9JA 1LT9A 2J0GA 2HLOC 3H32C 3GHGB 2HPCA 2JHKF 2H43A 4ZFGA 1JY3P 3BVHA 1FZEC 1LT9C 1RE3B 1JY2N 2JHIF 1JY2O 1RE3C 1N86C 2XNXA 1LTJB 2GY7A 3FIBA 1M1JA 1FZCB 1FZCA 2FFDA 1RE4C 1T3UA 1JY3N 1M1JC 1FZAA 1LWUC 1RF1C 1RF0B 1LWUB 2JHHC 2A45G 2WNPF 1RE3A 2HPCC 2J3FD 3BVHB 2Z4EB 2J3OA 1FIDA 1RF1A 3BVHC 2HPCB 2J3FA 2OYIA 2FFDC 2J0YA 1JC9A 1LTJC 1FZCC 1FZBB 3H32A 1RE4B 1Z3UA 3GHGA 1M1JB 4M7FA 2A45H 1FZGA 1LTJA 1LT9B 3E1IC 4JZCA 2FIBA 1N86B 2J1GA 1FZEA 1LWUA 2OYHA 1FZAC 4M7HA 1N73A 2D39A 1FZBA 3H32B 2J2PA 2J5ZA 2OYIB 1FZEB 3GHGC 3HUSC 2HLOB 1FZFB 1W2EA 1RE4A 4EPUA 2Z4EA 4JYOX 4R9TA 2XNXC 3E1IA 1JY3O 1FZGB 1N86A 2Q9IC 3E1IB 2HODC 1FZDA
chains in the Genus database with same CATH superfamily
4WY4A 1J1EB 2W27A 3BASA 4N78D 1PZQA 1BCCG 3H1LD 2QSIA 3EFGA 1QL2A 1AQ5A 1GW4A 2RMZA 2ZFCA 4W7YA 1N7LA 2MJZA 3II6A 3VMYA 4NPEA 5AW2B 5KAIH 4HJGH 1HWTC 2QE7H 5AW7B 1RE3C 3G71P 4L73A 1SQBE 1HGZA 2IZ1A 5CBNA 1AQTA 2GY7A 3TNUB 4IFFA 1EXJA 1H89A 5AW9B 1JUNA 1M7LA 3RL0D 3VP9A 4PD4H 5KAIE 1RE3A 3V2QA 1NTKE 3CC2P 3GMAA 3BVHC 2CPSA 3H1JJ 3C9IA 2NPSD 3I5CA 1RE4B 1M1JB 5KKZB 3WUTA 4BRYB 2P7JA 1IO4A 5KLVK 2LXBA 1FE6A 1YQ3C 2J2PA 2Q5UA 4UB8E 3BCCD 1SQVG 3L72D 3E1IA 2IBZD 1N86A 3AE8C 1GD2E 3V4QA 1D7MA 3G6EP 1H0TA 2Z4EC 2LR2A 2JKVA 1BSNA 2JHLF 3LW5J 5CCGA 1L0ND 1K05A 3CWBG 5K5GB 2WSFJ 4WY4D 3H1IJ 2V7QJ 2FXMA 2J3GA 2GA1A 2XKMA 3EWKA 3CCRP 2CK3H 3HE4B 2BCCG 2I1KA 4ZFGA 3ZDMA 5AW0B 5AW6B 3KQGA 1JY2O 1IFJA 1N86C 1JMMA 1FBMA 1OVRA 1SQQK 2R44A 3HTKA 2Q3EA 1JY3N 1L0LJ 3H1JG 5KLVD 3CI9A 3AE2C 2BEZF 2J3FA 1DD4A 2P58A 1JC9A 3CXHH 5KJ7C 3O8ZA 3L74J 3H1KE 2ZXXA 4O9BA 1NKNA 1Y9BA 3C1LA 4DCKA 2ZVOB 4ZNCA 2K37A 4H0LD 4M7HA 2R3SA 1XTCC 3BATA 1Q86Q 3H32B 1IJDB 1GMJA 1VQ8P 3WUVA 2MKVA 4WY4C 5APVA 1CI6A 1SLQA 2WITA 2XNXC 4BWNA 3H1IG 1KC8Q 1VF5C 5H2FH 1OZHA 4YPCA 3Q5RA 2AEJA 2GUVA 1IFIA 1N73B 1K8AQ 2K9JA 5CBOA 3B5NB 5B66H 4LGDE 4NYTA 1VQPP 2FBWC 1JEKA 1SQQD 2WSEJ 2YO2A 3H1KD 3GF7A 4YXDC 2ITAA 2ZT9D 3TYYA 3BVHA 1FZEC 1RE3B 3Q1MA 1HTLC 2B87B 4PD4I 2D2CC 1QGKB 2WMMA 3AE1C 1SFCB 1SQBK 2ZXEB 3QH9A 2HFED 5AW5B 4DZOA 1SQBJ 1RF1C 3QWOC 1RF0B 1U7MA 1YYCA 2M3BA 1R8EA 1IZNB 3T97B 1LP1A 2IDBA 2R32A 2BCCE 4GOFA 4Z1MH 1HUCA 2BEQD 2WSCH 5KLVE 4JF7A 1SP4A 3Q5SA 3AE3C 1N8RQ 2D39A 1IC2A 4AYCA 3IFMA 3MGNA 1X0TA 2YXQB 3MD0A 3M9HA 1W2EA 1H8AA 1DH3A 2Q9IC 3TDKA 2E76D 2N1TD 2E74B 3PP5A 2I8DA 1FZBC 2H43B 5TISH 1ZMEC 4I1LA 2HLOA 1OW8A 3HD7D 1L4AC 1PGJA 1G2CB 1S72P 4C7RA 1VF5B 3CX5E 3TGUD 3K5BA 1DIPA 2YIUB 3LIDA 3HE5A 4L75A 3V2NA 5APSA 2JHKF 4AQRD 3H1IE 5KKZC 3UIAA 1QX8A 3CCEP 3CX5H 4WVZA 2Q1KA 3VMZA 4ASWA 3MUDC 3JSVC 3PJSK 1FU1A 5AVYB 1W2BO 1JTHA 1S4XA 2Z4EB 2QJYC 1RF1A 3H1KJ 4H44B 3V2PA 1T2KC 1EZVE 1SFCD 1ZRTE 3CMEP 4JBZA 2Y0DA 1CW5A 2O01J 4EDFA 3L73E 3I55P 1N86B 1IK7A 2KOGA 3PRJA 2M5AA 1NTZE 2WZ7A 3V4WA 1WRGA 2LKMA 2SPZA 1GZLA 3WU2H 3T97A 1LTTC 1YJWP 1URQA 3KZIE 2PFXA 2OTLP 2FYUJ 2KB7P 1Q2NA 3SFEC 2H43C 2NZ2A 3L72G 5GTHH 1JMBA 3A7OA 3Q5PA 4N3YB 1RF0C 1VQMP 1SQPK 1X9VA 3AE6C 2WPVB 1NU1G 3L35A 1FIBA 1SQPG 3CWBD 1LT9A 3H32C 3HE5B 2JDIH 3A0BH 2J5UA 2W90A 4H13B 1KB9H 1ZRTD 3H25A 2Q3IA 1VL2A 2Y9YA 5M1BA 3HD7C 3CCQP 1LTAC 3L74G 1KILB 2AXTH 2C0XA 2KYVA 3A0BE 4OGQD 1EZVD 1KILA 1QVFO 3H32A 3H1LG 3GHGA 5E79H 3M0DC 1S5LH 1LTJA 1LT9B 2QVAA 2IBZI 5CMZA 2YO3A 2FIBA 1M90Q 1OW6A 2KNCB 1SQVK 1N7SD 2C9NY 5APTA 1BGYD 2E43A 4WWIA 4XFJA 3D6ZA 3CWBE 2GUSA 2A06G 3AEBC 2WSCJ 3RBXA 3FXEA 3CLQA 4U7JA 1NTZD 1NU1J 2NRGA 3HUSA 4PJ0E 5AVZB 2JEEA 1LJ2A 1NOHA 1ZN5A 1NTMK 3VYIA 2OTJP 3TGUJ 1VQLP 1KILC 1HJBA 3RK3B 3JCUE 1L0LE 1NTMG 1AVOA 3BCCE 2QG4A 3N7NA 3AE7C 4PJ0H 2JJLA 2YXRB 1LT9C 4K35A 3D70A 1SQQG 2WSSH 2KIKA 1PP9G 1FAVA 3P8CE 1QL1A 4RESB 1LTIC 5CCGD 3L4FA 4PD4E 3ABVC 1EXIA 1FZCA 1T3UA 4BXLA 4OGQB 2OYOA 3P7KA 2WSEH 3L72J 1YJNP 3H1HG 1ZXGA 1AV1A 3H1HJ 4JQ0D 2IBZG 1UIXA 2E76C 2N1TC 2M3EA 4KHXA 1NYHA 1EQ7A 3CCSP 3CCLP 3JC22 3O6QB 3F89A 2AEMA 4JZCA 1N7SB 4U3FG 5AVWB 1NTZK 3V5BA 2OARA 3W67A 3A0HH 1QVGO 1M56D 1HBWA 3RK3C 1KMIZ 1LTGC 2J61B 3A2AA 3H1LE 1GL2A 3H1JE 3A5TA 3AEFC 2JR8A 4A7PA 1Z3SA 3MUDA 3SWKA 2WT7A 2RN0A 4EOTA 4CPGA 3FX0A 2H43A 3CCUP 1PPJG 2JWDA 2R5DA 3HE4A 3L73D 1VQ7P 1NAFA 1Z56A 2I1JA 1Q90D 2FFDA 1H0TB 2K9YA 2QJKB 3KDPB 3CXHE 1RY3A 2KS1A 2FXPA 1K04A 2A45G 4Y28J 2ZVNB 2WSFH 3RBZA 4IOIH 1BCCE 2JWAA 3LW5H 1FZBB 3CXHD 2E75C 4EIJA 1IFDA 4DOJA 2IZ0A 2H8PD 3OA7A 3CMAP 3L75D 2J5ZA 1X8YA 3OJAB 3V6IA 1RE4A 4NPFX 1SQXK 1FC2C 1S9KE 2HODC 3L37A 1KN7A 1LP1B 1SQXJ 2YKOA 3MHVA 1KTMA 1YHQP 2OTKE 3RL0g 1ZR2A 2OYHB 1PGOA 4IFMA 1LGHB 4N78E 5H2FE 2ZT9B 3CCVP 1FZGC 4Y99B 3CD6P 1FDMA 1NJIQ 1L0LK 1U7JA 3CC4P 2J60A 1G1JA 2OYIC 3MP7B 2O1KA 1R5SA 2HLOC 3IAOA 1N2DC 3RK2B 5B66E 4K3AA 1RHZB 1VPCA 1JY2N 3VOPA 1HGVA 1BE3G 1OMIA 3M0DA 1ZW0A 2JO1A 1FZCB 1AA0A 1AJYA 2R3CA 2L5GB 2E75B 2M5AB 3R4YA 1KD1Q 2O01N 3AEAC 4C7NB 1NU1E 5KTBA 1A02F 2KSJA 1FIDA 4WBAA 2HPCB 1J1EC 4JYCA 5CCHA 1GU4A 5APWA 3VMAA 1RH5B 2FYUE 2KZJA 3H1HE 4B86A 2J58A 2LXCB 2YKQA 4PV1B 1BE3J 1S3JA 1EZVG 4GODA 2FYZA 1L2PA 4PD4D 1NTZJ 4H44D 3C8VA 1L0NG 1VQOP 3L74E 5CHXA 1KFMA 3L36A 3H1LJ 1SQBD 5BU5A 2C9LY 2Z4EA 2OQQA 1NO4A 3G4SP 2WVRA 3PTZA 3TK1A 1L0NK 5AW3B 1L0LD 1FZDA 2Q9IA 2W83C 3L71D 2NPSA 5CCGC 1H88A 2KSEA 3NXSA 4OVNF 1S5LX 2QJKC 4HYTB 2B9BA 1FJPA 4OGQC 1FZFC 2E75D 4XE5B 5B5EE 4KT0J 4YTPC 1ZOYC 2M8RA 1HH0A 1FZAB 4RKUJ 1YTZT 2KZIA 2J0GA 3VP8A 2P1JA 3GHGB 3GLMA 1TU3F 4W80A 2KUBA 1SS1A 1KORA 1T6AA 1MZ9A 3VN0A 2JHIF 4EYYQ 3CPWO 1K9MQ 1SQXD 4D6TE 3L70D 1M1JA 2P2UA 2G3AA 1OVUA 2NPSB 2Y0EA 3KXDA 3USSA 1ZP0C 5AVVB 2QRXA 1GL2D 2G8YA 3GF3A 1DEEG 2KLUA 1EC5A 2J3OA 2OYIA 1P84D 1NTME 5KAFE 3RK3E 1KILD 3H1ID 5AVTB 1PP9J 1PP9E 2HYNA 1AVYA 3S9OA 4HB1A 1NTKK 4OWFA 2N9YB 1R5LA 1FZEB 3SWYA 1SQXE 1HJ0A 5APXA 1FZFB 1KB9I 1FZGB 2ZT9C 1PGPA 1JY2P 1OXZA 2R5BA 3BRTB 2RKLA 2B88A 2W8ZA 1KQFB 3L74D 2NPSC 5AVUB 1N73C 1FICA 4IL6H 3OW2O 1VQKP 3BCCG 2KNCA 1LTBC 2FY8A 2E74C 2A45I 3SSUA 5KJ7A 3CXHI 3H1JD 2RH0A 2WPQA 5EFWB 3FWNA 1BCCD 1JY3P 3U59A 2H7HA 5AW4B 1T3JA 1OIPA 1JOCA 3O6QA 1KILE 3B5NC 1VQ5P 3IR9A 1KYOI 1EDKA 3RK3D 3KPEA 2QEXP 5KLIB 3SWFA 4L76A 2IYPA 2XU6A 1BGYG 1LWUB 2JHHC 5AVRB 1PV3A 1FOSF 1S5LE 2HPCC 1OWAA 1IK9A 1NTKD 4HKZH 1IFMA 2FYUK 3LIEA 4I2LC 2PP6A 1NTZG 3TNUA 1PPJE 2A45H 3V2RA 2O01H 2GM4A 1GK6A 3VMXA 5CCHD 2POHA 1LWUA 4I7ZB 1N73A 1URQB 2W6AA 1VDFA 1J2JB 5E79E 2B87A 4UB6E 2FYNC 2H89C 4W7ZA 1KQGB 4WB4A 3L73J 3B5NA 1L0NE 1YIJP 1ZV8A 3IN6A 5CJ4A 5APUA 1BCCJ 3JCUH 3FWLA 2J64A 3R2PA 1JB0J 1KV4A 4UB6H 1X79B 3H1HD 1LT1A 2KS1B 1J1DB 2DW3A 1URQC 5CCHC 4RJTA 1NGMB 1NU1K 1UIIA 1L4AA 1YTZI 5GTHE 3E1RA 1U57A 3RK2C 3W68A 1KQLA 1S9KD 2XNXA 3AE9C 3L75J 3M91A 3NFQA 1NTKJ 2FYUD 3FIBA 1EZVI 4D6TJ 1M1JC 1A02J 3A3YB 1LWUC 2J59M 5APQA 1VQ4P 4DT0A 1S1CX 1S2EA 1OVVA 4OH8B 1L4AD 1WT6A 2FFDC 1FS0E 5CJ0A 1FZGA 3E1IC 1URQD 1MUUA 2QM8A 3G9RA 4I7ZC 5L8RJ 1BSHA 3MTUE 1GL2C 3CC7P 1SQPE 1PGQA 1SQPJ 1CZQA 3RK2D 3KHUA 3FGAD 1BDCA 2HLOB 2ZYGA 4H13D 3SFDC 1J1DC 3NMDA 2Q6QA 3M9BA 4GIFA 1MFTA 1L0LG 1M8OB 5APYA 3S1KA 1RF1B 4JYBA 3NTNA 2HODB 2QJPB 3L75E 2WTYA 3B71A 2BCCJ 3AECC 3P32A 1NKZB 4GKGA 3L71E 4PV1C 3L71J 4JPZB 1LTJB 2KI7B 1KYOD 2E76B 2N1TB 2IBZE 3S4RA 3EFFK 1HVVA 3AEEC 3BCCJ 4TLFA 1MKMA 2K88A 1FZAA 1Y47A 2YMKA 3HTKB 1W5CE 4Y99C 3OAKA 2A06E 4RO0A 1MV8A 3Q2YA 1FZCC 2KXPB 3GW6A 2OGUA 1JM0A 3KYQA 3CL3D 5GTIH 2XNDH 1RQUA 3M06A 3EQ2A 3GG2A 2IFMA 2OYHA 5BVZA 4I6MC 3WMM0 3HUSC 4D6TD 5C39A 2CPBA 3CCJP 4JYOX 1SVFA 5GTIE 4UB8H 1M57D 2WPSA 2J3UA 1FOSE 3A0HE 1PP9D 2KP8A 3PLNA 1T2KD 2C0WA 1JTHB 2K9JB 1K73Q 3F5HA 2J0HA 1P84E 1SQQJ 1YJ9P 1YBKA 1SQVD 4WY4B 3RL0B 1NTMJ 2XV5A 4U3FE 1BDDA 1N7SC 1NU1D 1VQNP 3HRNA 2JP3A 1VQ6P 1P84H 3D6YA 2HR3A 3CX5I 2E5YA 4U3FD 1SQBG 4KJMA 4GT1A 2WNPF 1Q82Q 1YI2P 1VF5D 2K3RA 5KLIC 2O3JA 3E7KA 4GDOA 2P67A 4HH2A 2BCCD 2B89A 2E5TA 1Z3UA 4M7FA 2A06D 1NHLA 2KK7A 1NTKG 4DJGA 1PFIA 2L91A 3AEGC 2IFNA 1GL2B 5TISE 2Z5HA 3GHGC 1KYOE 5KLVG 4EPUA 1KB9D 3M0AA 2XDJA 1KFNA 1SQXG 4BRYA 1E79H 3U1CA 2JHMF 1KZUB 1QEXA 1FDOA 2OYHC 1KYOH 5DJUB 1DX7A 1GW3A 2Q9IB 5BU8B 4R4LA 2HODA 3L73G 3TGUE 2XNXB 5KJ7D 2YMYA 1FZFA 1P84I 3HUSB 5AVXB 1Y8AA 4R9JA 1BE3E 3HD7A 1OX3A 3WUUA 2HG5D 2PAJA 3TSIA 3M9QA 1Q81Q 1JCCA 3Q3DA 4NPDA 5B5EH 4LC1A 2QJPC 1IFPA 2UWJE 1EDIA 1CSBA 1SQPD 1OW7A 2QIWA 3D71A 2Z5IA 1E5WA 1BGYJ 1GTWA 2FYUG 1EDJA 4H44C 2J3FD 3BVHB 3H1KG 3WU2E 3CCMP 3CWBJ 2FYNB 2WWWA 4ZKPA 1VQ9P 1KQSO 1NWQA 3PH0A 4QMAA 3L70E 3I56P 5KAFH 1Q7YQ 2YIUC 1JO5A 2IYOA 1HF9A 1RQVA 4M3LA 1LNQA 4U3FJ 1JNMA 3B5ND 1JY3O 2QJYB 1M1KQ 2ZAEB 2YKPA 4IFDK 1OFCX 1YITP 1LTSC 2KLVA 3CX5D 4H0LB 4AUWA 1SQVJ 1KB9E 3AE5C 4H13C 3U1AA 1RF0A 1SFCC 1IFNA 3HD7B 2FXOA 2AXTE 3B8EB 5AVSB 2HPCA 1ZLLA 1DEBA 3AE4C 5AW1B 1WMKA 3MZWB 3BRVB 3FXDA 3P8MC 4R4MA 2Q7CA 1DD3A 3G3ZA 4C46A 1RE4C 4YXWH 4IL6X 1NTMD 4EI2A 2M0BA 2PRRA 1PPJD 3TGUG 3P8CD 3RGUA 1L0NJ 1GDTA 2J0YA 1USEA 1LTJC 2WQYC 2N1TA 3N4XA 2ZYDA 1GK4A 1NAYA 1SQQE 2W6JH 5KLVJ 3L71G 1SQVE 4L74A 1FZEA 1FZAC 2QA4P 2D2CD 1FZBA 1FDIA 2OYIB 3RL0C 4MN4C 2P10A 4LLHA 3MIWA 4GOEA 1GU5A 2YNYA 3IF4A 2ZYAA 4R9TA 3B4SA 4XA4A 2N9BA 3AEDC 2QM7A 1NVOA 3E1IB 1N7SA 1CI6B 2IX7C 1FJKA 4D6TG 2IPPA 2WPRA 2FFDB 1XTGB 2E42A 2Y0CA 2J61A 3KZIH 2O1JA 5DJTB 3L75G 2AEFA 2BASA 3VTPC 1BE3D 3L70G 1PL5A 3ITKA 5AVQB 5TJHA 2WT7B 1JCDA 3H6PA 2Y9ZA 2V7QH 2W6BA 4IL6E 4C7NA 1BGYE 3TF5A 1QLED 2E74D 1X22A 1T8ZA 2V4HA 2ZJSE 3L72E 1L4AB 4N6JA 2K1AA 2FKWB 1YQ4C 4ZKUA 4H0LC 1MFZA 4ASVA 1ZR4A 4TT3H 2XZRA 1NH4A 1AFOA 2AXCA 5AW8B 2H88C 2D2CB 1G1IA 2J1GA 3PHLA 1G2CA 1EDLA 1PIXA 2PGDA 4PV1D 2VRSA 1SFCA 1USDA 4ZMDA 3L70J
chains in the Genus database with same CATH topology
4WY4A 2Q9IA 1J1EB 2W27A 3BASA 2H43C 2NPSA 5CCGC 4N78D 1H88A 2WPSA 3NXSA 2J3UA 1FOSE 3A7OA 3EFGA 1QL2A 4N3YB 4HYTB 1RF0C 1AQ5A 1GW4A 1SQPK 2KP8A 1X9VA 1FJPA 2ZFCA 1T2KD 2C0WA 1FZFC 1JTHB 4XE5B 3L35A 1FIBA 2M8RA 4W7YA 2J0HA 1HH0A 1FZAB 1LT9A 1N7LA 1YTZT 2MJZA 3II6A 3VMYA 2J0GA 3H32C 3VP8A 3HE5B 2P1JA 3GHGB 5AW2B 4W80A 4WY4B 1HWTC 3RL0B 1MZ9A 3VN0A 2XV5A 2JHIF 5AW7B 1RE3C 1HGZA 1N7SC 2Q3IA 2GY7A 1M1JA 3HD7C 3HRNA 1LTAC 3TNUB 2P2UA 4IFFA 1KILB 2NPSB 1H89A 5AW9B 2C0XA 1JUNA 1M7LA 3RL0D 5AVVB 3VP9A 2KYVA 4GT1A 2WNPF 1RE3A 3V2QA 1GL2D 2J3OA 3BVHC 2CPSA 2OYIA 1KILA 3C9IA 2NPSD 2P67A 3H32A 3I5CA 4HH2A 1RE4B 1KILD 1Z3UA 3GHGA 1M1JB 4M7FA 1NHLA 3M0DC 1LTJA 1LT9B 5CMZA 5AVTB 2YO3A 2FIBA 1PFIA 2P7JA 2IFNA 1GL2B 1IO4A 2HYNA 5KLVK 1SQVK 1NTKK 1N7SD 2J2PA 2Q5UA 1FZEB 2Z5HA 3GHGC 3SWYA 2C9NY 5APTA 5APXA 1FZFB 2E43A 4EPUA 3E1IA 1FZGB 1N86A 2GUSA 3M0AA 1GD2E 2XDJA 1JY2P 1OXZA 2R5BA 3V4QA 2Z4EC 3CLQA 1KFNA 3BRTB 3U1CA 3HUSA 2JHMF 1KZUB 2JHLF 5CCGA 2NPSC 5AVUB 1N73C 1FICA 2OYHC 5AVZB 4WY4D 1DX7A 1GW3A 2JEEA 2Q9IB 1LTBC 1NOHA 1ZN5A 1NTMK 3VYIA 5BU8B 2HODA 2FXMA 2XNXB 5KJ7D 2A45I 2J3GA 1KILC 2YMYA 1HJBA 1FZFA 3HUSB 5AVXB 3RK3B 2XKMA 4R9JA 3HD7A 5KJ7A 2HG5D 2PAJA 3TSIA 3M9QA 1JCCA 2WPQA 3N7NA 3HE4B 2I1KA 2JJLA 4ZFGA 1JY3P 3U59A 1LT9C 5AW0B 2H7HA 5AW6B 3KQGA 5AW4B 1JY2O 4LC1A 1FAVA 1IFJA 1QL1A 1T3JA 1LTIC 3P8CE 4RESB 3L4FA 1JMMA 5CCGD 1N86C 1FBMA 1JOCA 3B5NC 3IR9A 3RK3D 1CSBA 1SQQK 3HTKA 3KPEA 1FZCA 1T3UA 3SWFA 1JY3N 2Z5IA 1E5WA 3P7KA 1GTWA 2XU6A 2WSEH 3CI9A 1LWUB 2JHHC 5AVRB 1FOSF 2HPCC 1OWAA 2J3FD 3BVHB 1IK9A 2J3FA 2N1TC 1IFMA 2FYUK 3LIEA 4I2LC 1JC9A 2PP6A 3TNUA 4KHXA 5KJ7C 2WWWA 4ZKPA 1EQ7A 3O8ZA 2A45H 3V2RA 1NWQA 4JZCA 4O9BA 1N7SB 2O01H 2GM4A 1NKNA 1GK6A 3VMXA 5AVWB 1NTZK 3V5BA 5CCHD 2POHA 1LWUA 4M7HA 1N73A 1XTCC 2OARA 3BATA 1JO5A 1URQB 2W6AA 1VDFA 3H32B 1IJDB 1J2JB 4WY4C 4M3LA 5APVA 1HBWA 1CI6A 1SLQA 1JNMA 4W7ZA 2WITA 3B5ND 4WB4A 2XNXC 1JY3O 3RK3C 3B5NA 1LTGC 1ZV8A 2YKPA 4IFDK 2J61B 2GUVA 5CJ4A 5APUA 1IFIA 3A2AA 1N73B 1LTSC 2KLVA 1GL2A 4AUWA 3A5TA 2J64A 3R2PA 3B5NB 1X79B 4LGDE 4NYTA 3U1AA 1Z3SA 3MUDA 1RF0A 1J1DB 1SFCC 2YO2A 1URQC 5CCHC 2WT7A 1NU1K 1IFNA 3HD7B 4EOTA 3B8EB 1L4AA 5AVSB 2HPCA 1YTZI 3TYYA 1ZLLA 2H43A 1DEBA 3RK2C 3BVHA 1FZEC 1RE3B 1KQLA 1S9KD 5AW1B 1HTLC 2R5DA 3HE4A 2XNXA 3BRVB 3P8MC 3M91A 3NFQA 2Q7CA 3FIBA 1NAFA 1Z56A 1SFCB 1SQBK 2I1JA 3G3ZA 2FFDA 4C46A 1RE4C 2ZXEB 2HFED 1M1JC 5AW5B 4DZOA 3A3YB 3KDPB 1LWUC 1A02J 1RF1C 1RY3A 1RF0B 2J59M 5APQA 2A45G 1YYCA 2M3BA 3P8CD 4OH8B 1L4AD 2WSFH 1WT6A 1GDTA 2FFDC 2J0YA 1LTJC 3LW5H 1FZBB 2R32A 2N1TA 3N4XA 5CJ0A 1GK4A 1HUCA 1FZGA 4EIJA 3E1IC 2WSCH 1URQD 1MUUA 4JF7A 1IFDA 1SP4A 2QM8A 1FZEA 4DOJA 3MTUE 2H8PD 1FZAC 1GL2C 3OA7A 2D39A 1IC2A 1CZQA 1FZBA 3RK2D 4AYCA 2J5ZA 3IFMA 3MGNA 1X8YA 3OJAB 2OYIB 3RL0C 2HLOB 4LLHA 3MD0A 3M9HA 3MIWA 1W2EA 1RE4A 1GU5A 2YNYA 1H8AA 1DH3A 1SQXK 4R9TA 1J1DC 4XA4A 1S9KE 2Q9IC 2N9BA 2QM7A 3E1IB 2HODC 2N1TD 3L37A 1N7SA 1CI6B 3PP5A 3NMDA 2IX7C 1FJKA 2IPPA 2YKOA 1FZBC 2WPRA 2H43B 2FFDB 3M9BA 4I1LA 1XTGB 4GIFA 2E42A 2HLOA 1ZR2A 2J61A 2OYHB 2O1JA 3HD7D 1L4AC 5APYA 4IFMA 2BASA 1G2CB 3VTPC 1LGHB 4N78E 4JYBA 1RF1B 4C7RA 1FZGC 4Y99B 3NTNA 1FDMA 1L0LK 2HODB 5AVQB 2J60A 1G1JA 2OYIC 3LIDA 3HE5A 2O1KA 2WTYA 2HLOC 3V2NA 2WT7B 1JCDA 1N2DC 3H6PA 5APSA 3RK2B 2JHKF 3P32A 1NKZB 4GKGA 4AQRD 1VPCA 1JY2N 2W6BA 3VOPA 4C7NA 1HGVA 3UIAA 1LTJB 3M0DA 2N1TB 1T8ZA 1FZCB 1HVVA 2R3CA 1L4AB 2L5GB 4N6JA 3VMZA 1FZAA 3HTKB 2FKWB 4C7NB 4Y99C 4ZKUA 3OAKA 1FU1A 5AVYB 5KTBA 1A02F 1JTHA 1MFZA 2KSJA 2Z4EB 1ZR4A 1FIDA 1RF1A 4WBAA 2HPCB 1MV8A 1J1EC 4JYCA 3V2PA 1T2KC 5CCHA 1GU4A 1SFCD 2XZRA 1FZCC 5APWA 1NH4A 1AFOA 4B86A 2J58A 3KYQA 3CL3D 1CW5A 2YKQA 5AW8B 1G1IA 3M06A 1N86B 2KOGA 2FYZA 3EQ2A 2J1GA 2IFMA 2OYHA 5BVZA 2WZ7A 3V4WA 4I6MC 3WMM0 1WRGA 2LKMA 1G2CA 1GZLA 5CHXA 3HUSC 3T97A 1LTTC 1KFMA 3L36A 5BU5A 2VRSA 1URQA 2C9LY 2Z4EA 1NO4A 1SFCA 2CPBA 4JYOX 3TK1A 1L0NK 5AW3B 1SVFA 2KB7P 1FZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I A;  1JY2 P;  2Z4E C;  2H43 C;  1FZB C;  2H43 B;  2FFD B;  3HUS A;  2JHM F;  2J61 B;  2HLO A;  2J3U A;  2J61 A;  2OYH B;  2JHL F;  1N73 B;  1N73 C;  1FIC A;  2OYH C;  1RF0 C;  1RF1 B;  2J64 A;  1FZG C;  2Q9I B;  1FZF C;  2HOD A;  4NYT A;  1Z3S A;  2HOD B;  1FIB A;  1RF0 A;  2J60 A;  2XNX B;  2J3G A;  2A45 I;  1FZF A;  3HUS B;  2J0H A;  2OYI C;  1FZA B;  4R9J A;  1LT9 A;  2J0G A;  2HLO C;  3H32 C;  3GHG B;  2HPC A;  2JHK F;  2H43 A;  4ZFG A;  1JY3 P;  3BVH A;  1FZE C;  1LT9 C;  1RE3 B;  1JY2 N;  2JHI F;  1JY2 O;  1RE3 C;  1N86 C;  2XNX A;  1LTJ B;  2GY7 A;  3FIB A;  1M1J A;  1FZC B;  1FZC A;  2FFD A;  1RE4 C;  1T3U A;  1JY3 N;  1M1J C;  1FZA A;  1LWU C;  1RF1 C;  1RF0 B;  1LWU B;  2JHH C;  2A45 G;  2WNP F;  1RE3 A;  2HPC C;  2J3F D;  3BVH B;  2Z4E B;  2J3O A;  1FID A;  1RF1 A;  3BVH C;  2HPC B;  2J3F A;  2OYI A;  2FFD C;  2J0Y A;  1JC9 A;  1LTJ C;  1FZC C;  1FZB B;  3H32 A;  1RE4 B;  1Z3U A;  3GHG A;  1M1J B;  4M7F A;  2A45 H;  1FZG A;  1LTJ A;  1LT9 B;  3E1I C;  4JZC A;  2FIB A;  1N86 B;  2J1G A;  1FZE A;  1LWU A;  2OYH A;  1FZA C;  4M7H A;  1N73 A;  2D39 A;  1FZB A;  3H32 B;  2J2P A;  2J5Z A;  2OYI B;  1FZE B;  3GHG C;  3HUS C;  2HLO B;  1FZF B;  1W2E A;  1RE4 A;  4EPU A;  2Z4E A;  4JYO X;  4R9T A;  2XNX C;  3E1I A;  1JY3 O;  1FZG B;  1N86 A;  2Q9I C;  3E1I B;  2HOD C;  1FZD A; 
#chains in the Genus database with same CATH topology
 4WY4 A;  1J1E B;  2W27 A;  3BAS A;  4N78 D;  1PZQ A;  1BCC G;  3H1L D;  2QSI A;  3EFG A;  1QL2 A;  1AQ5 A;  1GW4 A;  2RMZ A;  2ZFC A;  4W7Y A;  1N7L A;  2MJZ A;  3II6 A;  3VMY A;  4NPE A;  5AW2 B;  5KAI H;  4HJG H;  1HWT C;  2QE7 H;  5AW7 B;  1RE3 C;  3G71 P;  4L73 A;  1SQB E;  1HGZ A;  2IZ1 A;  5CBN A;  1AQT A;  2GY7 A;  3TNU B;  4IFF A;  1EXJ A;  1H89 A;  5AW9 B;  1JUN A;  1M7L A;  3RL0 D;  3VP9 A;  4PD4 H;  5KAI E;  1RE3 A;  3V2Q A;  1NTK E;  3CC2 P;  3GMA A;  3BVH C;  2CPS A;  3H1J J;  3C9I A;  2NPS D;  3I5C A;  1RE4 B;  1M1J B;  5KKZ B;  3WUT A;  4BRY B;  2P7J A;  1IO4 A;  5KLV K;  2LXB A;  1FE6 A;  1YQ3 C;  2J2P A;  2Q5U A;  4UB8 E;  3BCC D;  1SQV G;  3L72 D;  3E1I A;  2IBZ D;  1N86 A;  3AE8 C;  1GD2 E;  3V4Q A;  1D7M A;  3G6E P;  1H0T A;  2Z4E C;  2LR2 A;  2JKV A;  1BSN A;  2JHL F;  3LW5 J;  5CCG A;  1L0N D;  1K05 A;  3CWB G;  5K5G B;  2WSF J;  4WY4 D;  3H1I J;  2V7Q J;  2FXM A;  2J3G A;  2GA1 A;  2XKM A;  3EWK A;  3CCR P;  2CK3 H;  3HE4 B;  2BCC G;  2I1K A;  4ZFG A;  3ZDM A;  5AW0 B;  5AW6 B;  3KQG A;  1JY2 O;  1IFJ A;  1N86 C;  1JMM A;  1FBM A;  1OVR A;  1SQQ K;  2R44 A;  3HTK A;  2Q3E A;  1JY3 N;  1L0L J;  3H1J G;  5KLV D;  3CI9 A;  3AE2 C;  2BEZ F;  2J3F A;  1DD4 A;  2P58 A;  1JC9 A;  3CXH H;  5KJ7 C;  3O8Z A;  3L74 J;  3H1K E;  2ZXX A;  4O9B A;  1NKN A;  1Y9B A;  3C1L A;  4DCK A;  2ZVO B;  4ZNC A;  2K37 A;  4H0L D;  4M7H A;  2R3S A;  1XTC C;  3BAT A;  1Q86 Q;  3H32 B;  1IJD B;  1GMJ A;  1VQ8 P;  3WUV A;  2MKV A;  4WY4 C;  5APV A;  1CI6 A;  1SLQ A;  2WIT A;  2XNX C;  4BWN A;  3H1I G;  1KC8 Q;  1VF5 C;  5H2F H;  1OZH A;  4YPC A;  3Q5R A;  2AEJ A;  2GUV A;  1IFI A;  1N73 B;  1K8A Q;  2K9J A;  5CBO A;  3B5N B;  5B66 H;  4LGD E;  4NYT A;  1VQP P;  2FBW C;  1JEK A;  1SQQ D;  2WSE J;  2YO2 A;  3H1K D;  3GF7 A;  4YXD C;  2ITA A;  2ZT9 D;  3TYY A;  3BVH A;  1FZE C;  1RE3 B;  3Q1M A;  1HTL C;  2B87 B;  4PD4 I;  2D2C C;  1QGK B;  2WMM A;  3AE1 C;  1SFC B;  1SQB K;  2ZXE B;  3QH9 A;  2HFE D;  5AW5 B;  4DZO A;  1SQB J;  1RF1 C;  3QWO C;  1RF0 B;  1U7M A;  1YYC A;  2M3B A;  1R8E A;  1IZN B;  3T97 B;  1LP1 A;  2IDB A;  2R32 A;  2BCC E;  4GOF A;  4Z1M H;  1HUC A;  2BEQ D;  2WSC H;  5KLV E;  4JF7 A;  1SP4 A;  3Q5S A;  3AE3 C;  1N8R Q;  2D39 A;  1IC2 A;  4AYC A;  3IFM A;  3MGN A;  1X0T A;  2YXQ B;  3MD0 A;  3M9H A;  1W2E A;  1H8A A;  1DH3 A;  2Q9I C;  3TDK A;  2E76 D;  2N1T D;  2E74 B;  3PP5 A;  2I8D A;  1FZB C;  2H43 B;  5TIS H;  1ZME C;  4I1L A;  2HLO A;  1OW8 A;  3HD7 D;  1L4A C;  1PGJ A;  1G2C B;  1S72 P;  4C7R A;  1VF5 B;  3CX5 E;  3TGU D;  3K5B A;  1DIP A;  2YIU B;  3LID A;  3HE5 A;  4L75 A;  3V2N A;  5APS A;  2JHK F;  4AQR D;  3H1I E;  5KKZ C;  3UIA A;  1QX8 A;  3CCE P;  3CX5 H;  4WVZ A;  2Q1K A;  3VMZ A;  4ASW A;  3MUD C;  3JSV C;  3PJS K;  1FU1 A;  5AVY B;  1W2B O;  1JTH A;  1S4X A;  2Z4E B;  2QJY C;  1RF1 A;  3H1K J;  4H44 B;  3V2P A;  1T2K C;  1EZV E;  1SFC D;  1ZRT E;  3CME P;  4JBZ A;  2Y0D A;  1CW5 A;  2O01 J;  4EDF A;  3L73 E;  3I55 P;  1N86 B;  1IK7 A;  2KOG A;  3PRJ A;  2M5A A;  1NTZ E;  2WZ7 A;  3V4W A;  1WRG A;  2LKM A;  2SPZ A;  1GZL A;  3WU2 H;  3T97 A;  1LTT C;  1YJW P;  1URQ A;  3KZI E;  2PFX A;  2OTL P;  2FYU J;  2KB7 P;  1Q2N A;  3SFE C;  2H43 C;  2NZ2 A;  3L72 G;  5GTH H;  1JMB A;  3A7O A;  3Q5P A;  4N3Y B;  1RF0 C;  1VQM P;  1SQP K;  1X9V A;  3AE6 C;  2WPV B;  1NU1 G;  3L35 A;  1FIB A;  1SQP G;  3CWB D;  1LT9 A;  3H32 C;  3HE5 B;  2JDI H;  3A0B H;  2J5U A;  2W90 A;  4H13 B;  1KB9 H;  1ZRT D;  3H25 A;  2Q3I A;  1VL2 A;  2Y9Y A;  5M1B A;  3HD7 C;  3CCQ P;  1LTA C;  3L74 G;  1KIL B;  2AXT H;  2C0X A;  2KYV A;  3A0B E;  4OGQ D;  1EZV D;  1KIL A;  1QVF O;  3H32 A;  3H1L G;  3GHG A;  5E79 H;  3M0D C;  1S5L H;  1LTJ A;  1LT9 B;  2QVA A;  2IBZ I;  5CMZ A;  2YO3 A;  2FIB A;  1M90 Q;  1OW6 A;  2KNC B;  1SQV K;  1N7S D;  2C9N Y;  5APT A;  1BGY D;  2E43 A;  4WWI A;  4XFJ A;  3D6Z A;  3CWB E;  2GUS A;  2A06 G;  3AEB C;  2WSC J;  3RBX A;  3FXE A;  3CLQ A;  4U7J A;  1NTZ D;  1NU1 J;  2NRG A;  3HUS A;  4PJ0 E;  5AVZ B;  2JEE A;  1LJ2 A;  1NOH A;  1ZN5 A;  1NTM K;  3VYI A;  2OTJ P;  3TGU J;  1VQL P;  1KIL C;  1HJB A;  3RK3 B;  3JCU E;  1L0L E;  1NTM G;  1AVO A;  3BCC E;  2QG4 A;  3N7N A;  3AE7 C;  4PJ0 H;  2JJL A;  2YXR B;  1LT9 C;  4K35 A;  3D70 A;  1SQQ G;  2WSS H;  2KIK A;  1PP9 G;  1FAV A;  3P8C E;  1QL1 A;  4RES B;  1LTI C;  5CCG D;  3L4F A;  4PD4 E;  3ABV C;  1EXI A;  1FZC A;  1T3U A;  4BXL A;  4OGQ B;  2OYO A;  3P7K A;  2WSE H;  3L72 J;  1YJN P;  3H1H G;  1ZXG A;  1AV1 A;  3H1H J;  4JQ0 D;  2IBZ G;  1UIX A;  2E76 C;  2N1T C;  2M3E A;  4KHX A;  1NYH A;  1EQ7 A;  3CCS P;  3CCL P;  3JC2 2;  3O6Q B;  3F89 A;  2AEM A;  4JZC A;  1N7S B;  4U3F G;  5AVW B;  1NTZ K;  3V5B A;  2OAR A;  3W67 A;  3A0H H;  1QVG O;  1M56 D;  1HBW A;  3RK3 C;  1KMI Z;  1LTG C;  2J61 B;  3A2A A;  3H1L E;  1GL2 A;  3H1J E;  3A5T A;  3AEF C;  2JR8 A;  4A7P A;  1Z3S A;  3MUD A;  3SWK A;  2WT7 A;  2RN0 A;  4EOT A;  4CPG A;  3FX0 A;  2H43 A;  3CCU P;  1PPJ G;  2JWD A;  2R5D A;  3HE4 A;  3L73 D;  1VQ7 P;  1NAF A;  1Z56 A;  2I1J A;  1Q90 D;  2FFD A;  1H0T B;  2K9Y A;  2QJK B;  3KDP B;  3CXH E;  1RY3 A;  2KS1 A;  2FXP A;  1K04 A;  2A45 G;  4Y28 J;  2ZVN B;  2WSF H;  3RBZ A;  4IOI H;  1BCC E;  2JWA A;  3LW5 H;  1FZB B;  3CXH D;  2E75 C;  4EIJ A;  1IFD A;  4DOJ A;  2IZ0 A;  2H8P D;  3OA7 A;  3CMA P;  3L75 D;  2J5Z A;  1X8Y A;  3OJA B;  3V6I A;  1RE4 A;  4NPF X;  1SQX K;  1FC2 C;  1S9K E;  2HOD C;  3L37 A;  1KN7 A;  1LP1 B;  1SQX J;  2YKO A;  3MHV A;  1KTM A;  1YHQ P;  2OTK E;  3RL0 g;  1ZR2 A;  2OYH B;  1PGO A;  4IFM A;  1LGH B;  4N78 E;  5H2F E;  2ZT9 B;  3CCV P;  1FZG C;  4Y99 B;  3CD6 P;  1FDM A;  1NJI Q;  1L0L K;  1U7J A;  3CC4 P;  2J60 A;  1G1J A;  2OYI C;  3MP7 B;  2O1K A;  1R5S A;  2HLO C;  3IAO A;  1N2D C;  3RK2 B;  5B66 E;  4K3A A;  1RHZ B;  1VPC A;  1JY2 N;  3VOP A;  1HGV A;  1BE3 G;  1OMI A;  3M0D A;  1ZW0 A;  2JO1 A;  1FZC B;  1AA0 A;  1AJY A;  2R3C A;  2L5G B;  2E75 B;  2M5A B;  3R4Y A;  1KD1 Q;  2O01 N;  3AEA C;  4C7N B;  1NU1 E;  5KTB A;  1A02 F;  2KSJ A;  1FID A;  4WBA A;  2HPC B;  1J1E C;  4JYC A;  5CCH A;  1GU4 A;  5APW A;  3VMA A;  1RH5 B;  2FYU E;  2KZJ A;  3H1H E;  4B86 A;  2J58 A;  2LXC B;  2YKQ A;  4PV1 B;  1BE3 J;  1S3J A;  1EZV G;  4GOD A;  2FYZ A;  1L2P A;  4PD4 D;  1NTZ J;  4H44 D;  3C8V A;  1L0N G;  1VQO P;  3L74 E;  5CHX A;  1KFM A;  3L36 A;  3H1L J;  1SQB D;  5BU5 A;  2C9L Y;  2Z4E A;  2OQQ A;  1NO4 A;  3G4S P;  2WVR A;  3PTZ A;  3TK1 A;  1L0N K;  5AW3 B;  1L0L D;  1FZD A;  2Q9I A;  2W83 C;  3L71 D;  2NPS A;  5CCG C;  1H88 A;  2KSE A;  3NXS A;  4OVN F;  1S5L X;  2QJK C;  4HYT B;  2B9B A;  1FJP A;  4OGQ C;  1FZF C;  2E75 D;  4XE5 B;  5B5E E;  4KT0 J;  4YTP C;  1ZOY C;  2M8R A;  1HH0 A;  1FZA B;  4RKU J;  1YTZ T;  2KZI A;  2J0G A;  3VP8 A;  2P1J A;  3GHG B;  3GLM A;  1TU3 F;  4W80 A;  2KUB A;  1SS1 A;  1KOR A;  1T6A A;  1MZ9 A;  3VN0 A;  2JHI F;  4EYY Q;  3CPW O;  1K9M Q;  1SQX D;  4D6T E;  3L70 D;  1M1J A;  2P2U A;  2G3A A;  1OVU A;  2NPS B;  2Y0E A;  3KXD A;  3USS A;  1ZP0 C;  5AVV B;  2QRX A;  1GL2 D;  2G8Y A;  3GF3 A;  1DEE G;  2KLU A;  1EC5 A;  2J3O A;  2OYI A;  1P84 D;  1NTM E;  5KAF E;  3RK3 E;  1KIL D;  3H1I D;  5AVT B;  1PP9 J;  1PP9 E;  2HYN A;  1AVY A;  3S9O A;  4HB1 A;  1NTK K;  4OWF A;  2N9Y B;  1R5L A;  1FZE B;  3SWY A;  1SQX E;  1HJ0 A;  5APX A;  1FZF B;  1KB9 I;  1FZG B;  2ZT9 C;  1PGP A;  1JY2 P;  1OXZ A;  2R5B A;  3BRT B;  2RKL A;  2B88 A;  2W8Z A;  1KQF B;  3L74 D;  2NPS C;  5AVU B;  1N73 C;  1FIC A;  4IL6 H;  3OW2 O;  1VQK P;  3BCC G;  2KNC A;  1LTB C;  2FY8 A;  2E74 C;  2A45 I;  3SSU A;  5KJ7 A;  3CXH I;  3H1J D;  2RH0 A;  2WPQ A;  5EFW B;  3FWN A;  1BCC D;  1JY3 P;  3U59 A;  2H7H A;  5AW4 B;  1T3J A;  1OIP A;  1JOC A;  3O6Q A;  1KIL E;  3B5N C;  1VQ5 P;  3IR9 A;  1KYO I;  1EDK A;  3RK3 D;  3KPE A;  2QEX P;  5KLI B;  3SWF A;  4L76 A;  2IYP A;  2XU6 A;  1BGY G;  1LWU B;  2JHH C;  5AVR B;  1PV3 A;  1FOS F;  1S5L E;  2HPC C;  1OWA A;  1IK9 A;  1NTK D;  4HKZ H;  1IFM A;  2FYU K;  3LIE A;  4I2L C;  2PP6 A;  1NTZ G;  3TNU A;  1PPJ E;  2A45 H;  3V2R A;  2O01 H;  2GM4 A;  1GK6 A;  3VMX A;  5CCH D;  2POH A;  1LWU A;  4I7Z B;  1N73 A;  1URQ B;  2W6A A;  1VDF A;  1J2J B;  5E79 E;  2B87 A;  4UB6 E;  2FYN C;  2H89 C;  4W7Z A;  1KQG B;  4WB4 A;  3L73 J;  3B5N A;  1L0N E;  1YIJ P;  1ZV8 A;  3IN6 A;  5CJ4 A;  5APU A;  1BCC J;  3JCU H;  3FWL A;  2J64 A;  3R2P A;  1JB0 J;  1KV4 A;  4UB6 H;  1X79 B;  3H1H D;  1LT1 A;  2KS1 B;  1J1D B;  2DW3 A;  1URQ C;  5CCH C;  4RJT A;  1NGM B;  1NU1 K;  1UII A;  1L4A A;  1YTZ I;  5GTH E;  3E1R A;  1U57 A;  3RK2 C;  3W68 A;  1KQL A;  1S9K D;  2XNX A;  3AE9 C;  3L75 J;  3M91 A;  3NFQ A;  1NTK J;  2FYU D;  3FIB A;  1EZV I;  4D6T J;  1M1J C;  1A02 J;  3A3Y B;  1LWU C;  2J59 M;  5APQ A;  1VQ4 P;  4DT0 A;  1S1C X;  1S2E A;  1OVV A;  4OH8 B;  1L4A D;  1WT6 A;  2FFD C;  1FS0 E;  5CJ0 A;  1FZG A;  3E1I C;  1URQ D;  1MUU A;  2QM8 A;  3G9R A;  4I7Z C;  5L8R J;  1BSH A;  3MTU E;  1GL2 C;  3CC7 P;  1SQP E;  1PGQ A;  1SQP J;  1CZQ A;  3RK2 D;  3KHU A;  3FGA D;  1BDC A;  2HLO B;  2ZYG A;  4H13 D;  3SFD C;  1J1D C;  3NMD A;  2Q6Q A;  3M9B A;  4GIF A;  1MFT A;  1L0L G;  1M8O B;  5APY A;  3S1K A;  1RF1 B;  4JYB A;  3NTN A;  2HOD B;  2QJP B;  3L75 E;  2WTY A;  3B71 A;  2BCC J;  3AEC C;  3P32 A;  1NKZ B;  4GKG A;  3L71 E;  4PV1 C;  3L71 J;  4JPZ B;  1LTJ B;  2KI7 B;  1KYO D;  2E76 B;  2N1T B;  2IBZ E;  3S4R A;  3EFF K;  1HVV A;  3AEE C;  3BCC J;  4TLF A;  1MKM A;  2K88 A;  1FZA A;  1Y47 A;  2YMK A;  3HTK B;  1W5C E;  4Y99 C;  3OAK A;  2A06 E;  4RO0 A;  1MV8 A;  3Q2Y A;  1FZC C;  2KXP B;  3GW6 A;  2OGU A;  1JM0 A;  3KYQ A;  3CL3 D;  5GTI H;  2XND H;  1RQU A;  3M06 A;  3EQ2 A;  3GG2 A;  2IFM A;  2OYH A;  5BVZ A;  4I6M C;  3WMM 0;  3HUS C;  4D6T D;  5C39 A;  2CPB A;  3CCJ P;  4JYO X;  1SVF A;  5GTI E;  4UB8 H;  1M57 D;  2WPS A;  2J3U A;  1FOS E;  3A0H E;  1PP9 D;  2KP8 A;  3PLN A;  1T2K D;  2C0W A;  1JTH B;  2K9J B;  1K73 Q;  3F5H A;  2J0H A;  1P84 E;  1SQQ J;  1YJ9 P;  1YBK A;  1SQV D;  4WY4 B;  3RL0 B;  1NTM J;  2XV5 A;  4U3F E;  1BDD A;  1N7S C;  1NU1 D;  1VQN P;  3HRN A;  2JP3 A;  1VQ6 P;  1P84 H;  3D6Y A;  2HR3 A;  3CX5 I;  2E5Y A;  4U3F D;  1SQB G;  4KJM A;  4GT1 A;  2WNP F;  1Q82 Q;  1YI2 P;  1VF5 D;  2K3R A;  5KLI C;  2O3J A;  3E7K A;  4GDO A;  2P67 A;  4HH2 A;  2BCC D;  2B89 A;  2E5T A;  1Z3U A;  4M7F A;  2A06 D;  1NHL A;  2KK7 A;  1NTK G;  4DJG A;  1PFI A;  2L91 A;  3AEG C;  2IFN A;  1GL2 B;  5TIS E;  2Z5H A;  3GHG C;  1KYO E;  5KLV G;  4EPU A;  1KB9 D;  3M0A A;  2XDJ A;  1KFN A;  1SQX G;  4BRY A;  1E79 H;  3U1C A;  2JHM F;  1KZU B;  1QEX A;  1FDO A;  2OYH C;  1KYO H;  5DJU B;  1DX7 A;  1GW3 A;  2Q9I B;  5BU8 B;  4R4L A;  2HOD A;  3L73 G;  3TGU E;  2XNX B;  5KJ7 D;  2YMY A;  1FZF A;  1P84 I;  3HUS B;  5AVX B;  1Y8A A;  4R9J A;  1BE3 E;  3HD7 A;  1OX3 A;  3WUU A;  2HG5 D;  2PAJ A;  3TSI A;  3M9Q A;  1Q81 Q;  1JCC A;  3Q3D A;  4NPD A;  5B5E H;  4LC1 A;  2QJP C;  1IFP A;  2UWJ E;  1EDI A;  1CSB A;  1SQP D;  1OW7 A;  2QIW A;  3D71 A;  2Z5I A;  1E5W A;  1BGY J;  1GTW A;  2FYU G;  1EDJ A;  4H44 C;  2J3F D;  3BVH B;  3H1K G;  3WU2 E;  3CCM P;  3CWB J;  2FYN B;  2WWW A;  4ZKP A;  1VQ9 P;  1KQS O;  1NWQ A;  3PH0 A;  4QMA A;  3L70 E;  3I56 P;  5KAF H;  1Q7Y Q;  2YIU C;  1JO5 A;  2IYO A;  1HF9 A;  1RQV A;  4M3L A;  1LNQ A;  4U3F J;  1JNM A;  3B5N D;  1JY3 O;  2QJY B;  1M1K Q;  2ZAE B;  2YKP A;  4IFD K;  1OFC X;  1YIT P;  1LTS C;  2KLV A;  3CX5 D;  4H0L B;  4AUW A;  1SQV J;  1KB9 E;  3AE5 C;  4H13 C;  3U1A A;  1RF0 A;  1SFC C;  1IFN A;  3HD7 B;  2FXO A;  2AXT E;  3B8E B;  5AVS B;  2HPC A;  1ZLL A;  1DEB A;  3AE4 C;  5AW1 B;  1WMK A;  3MZW B;  3BRV B;  3FXD A;  3P8M C;  4R4M A;  2Q7C A;  1DD3 A;  3G3Z A;  4C46 A;  1RE4 C;  4YXW H;  4IL6 X;  1NTM D;  4EI2 A;  2M0B A;  2PRR A;  1PPJ D;  3TGU G;  3P8C D;  3RGU A;  1L0N J;  1GDT A;  2J0Y A;  1USE A;  1LTJ C;  2WQY C;  2N1T A;  3N4X A;  2ZYD A;  1GK4 A;  1NAY A;  1SQQ E;  2W6J H;  5KLV J;  3L71 G;  1SQV E;  4L74 A;  1FZE A;  1FZA C;  2QA4 P;  2D2C D;  1FZB A;  1FDI A;  2OYI B;  3RL0 C;  4MN4 C;  2P10 A;  4LLH A;  3MIW A;  4GOE A;  1GU5 A;  2YNY A;  3IF4 A;  2ZYA A;  4R9T A;  3B4S A;  4XA4 A;  2N9B A;  3AED C;  2QM7 A;  1NVO A;  3E1I B;  1N7S A;  1CI6 B;  2IX7 C;  1FJK A;  4D6T G;  2IPP A;  2WPR A;  2FFD B;  1XTG B;  2E42 A;  2Y0C A;  2J61 A;  3KZI H;  2O1J A;  5DJT B;  3L75 G;  2AEF A;  2BAS A;  3VTP C;  1BE3 D;  3L70 G;  1PL5 A;  3ITK A;  5AVQ B;  5TJH A;  2WT7 B;  1JCD A;  3H6P A;  2Y9Z A;  2V7Q H;  2W6B A;  4IL6 E;  4C7N A;  1BGY E;  3TF5 A;  1QLE D;  2E74 D;  1X22 A;  1T8Z A;  2V4H A;  2ZJS E;  3L72 E;  1L4A B;  4N6J A;  2K1A A;  2FKW B;  1YQ4 C;  4ZKU A;  4H0L C;  1MFZ A;  4ASV A;  1ZR4 A;  4TT3 H;  2XZR A;  1NH4 A;  1AFO A;  2AXC A;  5AW8 B;  2H88 C;  2D2C B;  1G1I A;  2J1G A;  3PHL A;  1G2C A;  1EDL A;  1PIX A;  2PGD A;  4PV1 D;  2VRS A;  1SFC A;  1USD A;  4ZMD A;  3L70 J; 
#chains in the Genus database with same CATH homology
 4WY4 A;  2Q9I A;  1J1E B;  2W27 A;  3BAS A;  2H43 C;  2NPS A;  5CCG C;  4N78 D;  1H88 A;  2WPS A;  3NXS A;  2J3U A;  1FOS E;  3A7O A;  3EFG A;  1QL2 A;  4N3Y B;  4HYT B;  1RF0 C;  1AQ5 A;  1GW4 A;  1SQP K;  2KP8 A;  1X9V A;  1FJP A;  2ZFC A;  1T2K D;  2C0W A;  1FZF C;  1JTH B;  4XE5 B;  3L35 A;  1FIB A;  2M8R A;  4W7Y A;  2J0H A;  1HH0 A;  1FZA B;  1LT9 A;  1N7L A;  1YTZ T;  2MJZ A;  3II6 A;  3VMY A;  2J0G A;  3H32 C;  3VP8 A;  3HE5 B;  2P1J A;  3GHG B;  5AW2 B;  4W80 A;  4WY4 B;  1HWT C;  3RL0 B;  1MZ9 A;  3VN0 A;  2XV5 A;  2JHI F;  5AW7 B;  1RE3 C;  1HGZ A;  1N7S C;  2Q3I A;  2GY7 A;  1M1J A;  3HD7 C;  3HRN A;  1LTA C;  3TNU B;  2P2U A;  4IFF A;  1KIL B;  2NPS B;  1H89 A;  5AW9 B;  2C0X A;  1JUN A;  1M7L A;  3RL0 D;  5AVV B;  3VP9 A;  2KYV A;  4GT1 A;  2WNP F;  1RE3 A;  3V2Q A;  1GL2 D;  2J3O A;  3BVH C;  2CPS A;  2OYI A;  1KIL A;  3C9I A;  2NPS D;  2P67 A;  3H32 A;  3I5C A;  4HH2 A;  1RE4 B;  1KIL D;  1Z3U A;  3GHG A;  1M1J B;  4M7F A;  1NHL A;  3M0D C;  1LTJ A;  1LT9 B;  5CMZ A;  5AVT B;  2YO3 A;  2FIB A;  1PFI A;  2P7J A;  2IFN A;  1GL2 B;  1IO4 A;  2HYN A;  5KLV K;  1SQV K;  1NTK K;  1N7S D;  2J2P A;  2Q5U A;  1FZE B;  2Z5H A;  3GHG C;  3SWY A;  2C9N Y;  5APT A;  5APX A;  1FZF B;  2E43 A;  4EPU A;  3E1I A;  1FZG B;  1N86 A;  2GUS A;  3M0A A;  1GD2 E;  2XDJ A;  1JY2 P;  1OXZ A;  2R5B A;  3V4Q A;  2Z4E C;  3CLQ A;  1KFN A;  3BRT B;  3U1C A;  3HUS A;  2JHM F;  1KZU B;  2JHL F;  5CCG A;  2NPS C;  5AVU B;  1N73 C;  1FIC A;  2OYH C;  5AVZ B;  4WY4 D;  1DX7 A;  1GW3 A;  2JEE A;  2Q9I B;  1LTB C;  1NOH A;  1ZN5 A;  1NTM K;  3VYI A;  5BU8 B;  2HOD A;  2FXM A;  2XNX B;  5KJ7 D;  2A45 I;  2J3G A;  1KIL C;  2YMY A;  1HJB A;  1FZF A;  3HUS B;  5AVX B;  3RK3 B;  2XKM A;  4R9J A;  3HD7 A;  5KJ7 A;  2HG5 D;  2PAJ A;  3TSI A;  3M9Q A;  1JCC A;  2WPQ A;  3N7N A;  3HE4 B;  2I1K A;  2JJL A;  4ZFG A;  1JY3 P;  3U59 A;  1LT9 C;  5AW0 B;  2H7H A;  5AW6 B;  3KQG A;  5AW4 B;  1JY2 O;  4LC1 A;  1FAV A;  1IFJ A;  1QL1 A;  1T3J A;  1LTI C;  3P8C E;  4RES B;  3L4F A;  1JMM A;  5CCG D;  1N86 C;  1FBM A;  1JOC A;  3B5N C;  3IR9 A;  3RK3 D;  1CSB A;  1SQQ K;  3HTK A;  3KPE A;  1FZC A;  1T3U A;  3SWF A;  1JY3 N;  2Z5I A;  1E5W A;  3P7K A;  1GTW A;  2XU6 A;  2WSE H;  3CI9 A;  1LWU B;  2JHH C;  5AVR B;  1FOS F;  2HPC C;  1OWA A;  2J3F D;  3BVH B;  1IK9 A;  2J3F A;  2N1T C;  1IFM A;  2FYU K;  3LIE A;  4I2L C;  1JC9 A;  2PP6 A;  3TNU A;  4KHX A;  5KJ7 C;  2WWW A;  4ZKP A;  1EQ7 A;  3O8Z A;  2A45 H;  3V2R A;  1NWQ A;  4JZC A;  4O9B A;  1N7S B;  2O01 H;  2GM4 A;  1NKN A;  1GK6 A;  3VMX A;  5AVW B;  1NTZ K;  3V5B A;  5CCH D;  2POH A;  1LWU A;  4M7H A;  1N73 A;  1XTC C;  2OAR A;  3BAT A;  1JO5 A;  1URQ B;  2W6A A;  1VDF A;  3H32 B;  1IJD B;  1J2J B;  4WY4 C;  4M3L A;  5APV A;  1HBW A;  1CI6 A;  1SLQ A;  1JNM A;  4W7Z A;  2WIT A;  3B5N D;  4WB4 A;  2XNX C;  1JY3 O;  3RK3 C;  3B5N A;  1LTG C;  1ZV8 A;  2YKP A;  4IFD K;  2J61 B;  2GUV A;  5CJ4 A;  5APU A;  1IFI A;  3A2A A;  1N73 B;  1LTS C;  2KLV A;  1GL2 A;  4AUW A;  3A5T A;  2J64 A;  3R2P A;  3B5N B;  1X79 B;  4LGD E;  4NYT A;  3U1A A;  1Z3S A;  3MUD A;  1RF0 A;  1J1D B;  1SFC C;  2YO2 A;  1URQ C;  5CCH C;  2WT7 A;  1NU1 K;  1IFN A;  3HD7 B;  4EOT A;  3B8E B;  1L4A A;  5AVS B;  2HPC A;  1YTZ I;  3TYY A;  1ZLL A;  2H43 A;  1DEB A;  3RK2 C;  3BVH A;  1FZE C;  1RE3 B;  1KQL A;  1S9K D;  5AW1 B;  1HTL C;  2R5D A;  3HE4 A;  2XNX A;  3BRV B;  3P8M C;  3M91 A;  3NFQ A;  2Q7C A;  3FIB A;  1NAF A;  1Z56 A;  1SFC B;  1SQB K;  2I1J A;  3G3Z A;  2FFD A;  4C46 A;  1RE4 C;  2ZXE B;  2HFE D;  1M1J C;  5AW5 B;  4DZO A;  3A3Y B;  3KDP B;  1LWU C;  1A02 J;  1RF1 C;  1RY3 A;  1RF0 B;  2J59 M;  5APQ A;  2A45 G;  1YYC A;  2M3B A;  3P8C D;  4OH8 B;  1L4A D;  2WSF H;  1WT6 A;  1GDT A;  2FFD C;  2J0Y A;  1LTJ C;  3LW5 H;  1FZB B;  2R32 A;  2N1T A;  3N4X A;  5CJ0 A;  1GK4 A;  1HUC A;  1FZG A;  4EIJ A;  3E1I C;  2WSC H;  1URQ D;  1MUU A;  4JF7 A;  1IFD A;  1SP4 A;  2QM8 A;  1FZE A;  4DOJ A;  3MTU E;  2H8P D;  1FZA C;  1GL2 C;  3OA7 A;  2D39 A;  1IC2 A;  1CZQ A;  1FZB A;  3RK2 D;  4AYC A;  2J5Z A;  3IFM A;  3MGN A;  1X8Y A;  3OJA B;  2OYI B;  3RL0 C;  2HLO B;  4LLH A;  3MD0 A;  3M9H A;  3MIW A;  1W2E A;  1RE4 A;  1GU5 A;  2YNY A;  1H8A A;  1DH3 A;  1SQX K;  4R9T A;  1J1D C;  4XA4 A;  1S9K E;  2Q9I C;  2N9B A;  2QM7 A;  3E1I B;  2HOD C;  2N1T D;  3L37 A;  1N7S A;  1CI6 B;  3PP5 A;  3NMD A;  2IX7 C;  1FJK A;  2IPP A;  2YKO A;  1FZB C;  2WPR A;  2H43 B;  2FFD B;  3M9B A;  4I1L A;  1XTG B;  4GIF A;  2E42 A;  2HLO A;  1ZR2 A;  2J61 A;  2OYH B;  2O1J A;  3HD7 D;  1L4A C;  5APY A;  4IFM A;  2BAS A;  1G2C B;  3VTP C;  1LGH B;  4N78 E;  4JYB A;  1RF1 B;  4C7R A;  1FZG C;  4Y99 B;  3NTN A;  1FDM A;  1L0L K;  2HOD B;  5AVQ B;  2J60 A;  1G1J A;  2OYI C;  3LID A;  3HE5 A;  2O1K A;  2WTY A;  2HLO C;  3V2N A;  2WT7 B;  1JCD A;  1N2D C;  3H6P A;  5APS A;  3RK2 B;  2JHK F;  3P32 A;  1NKZ B;  4GKG A;  4AQR D;  1VPC A;  1JY2 N;  2W6B A;  3VOP A;  4C7N A;  1HGV A;  3UIA A;  1LTJ B;  3M0D A;  2N1T B;  1T8Z A;  1FZC B;  1HVV A;  2R3C A;  1L4A B;  2L5G B;  4N6J A;  3VMZ A;  1FZA A;  3HTK B;  2FKW B;  4C7N B;  4Y99 C;  4ZKU A;  3OAK A;  1FU1 A;  5AVY B;  5KTB A;  1A02 F;  1JTH A;  1MFZ A;  2KSJ A;  2Z4E B;  1ZR4 A;  1FID A;  1RF1 A;  4WBA A;  2HPC B;  1MV8 A;  1J1E C;  4JYC A;  3V2P A;  1T2K C;  5CCH A;  1GU4 A;  1SFC D;  2XZR A;  1FZC C;  5APW A;  1NH4 A;  1AFO A;  4B86 A;  2J58 A;  3KYQ A;  3CL3 D;  1CW5 A;  2YKQ A;  5AW8 B;  1G1I A;  3M06 A;  1N86 B;  2KOG A;  2FYZ A;  3EQ2 A;  2J1G A;  2IFM A;  2OYH A;  5BVZ A;  2WZ7 A;  3V4W A;  4I6M C;  3WMM 0;  1WRG A;  2LKM A;  1G2C A;  1GZL A;  5CHX A;  3HUS C;  3T97 A;  1LTT C;  1KFM A;  3L36 A;  5BU5 A;  2VRS A;  1URQ A;  2C9L Y;  2Z4E A;  1NO4 A;  1SFC A;  2CPB A;  4JYO X;  3TK1 A;  1L0N K;  5AW3 B;  1SVF A;  2KB7 P;  1FZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...