1FZCB

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRIN
total genus 93
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcB02
1RF1A 3BVHC 2Z4EB 2J61B 2A45H 2OYIB 1FZEA 1RE3C 2FFDB 2J64A 2OYHC 2FFDA 1FZAC 1N86A 2J3FA 4JZCA 2Z4EC 3BVHB 2J61A 1N73A 1RF1B 1T3UA 1Z3UA 2D39A 2HODB 1FICA 2OYIC 2J0HA 2J1GA 1N73C 2A45G 1JC9A 1FZGA 2Z4EA 1FZBA 3GHGB 1RF0B 1LTJB 1FIDA 3HUSA 2J60A 1FZDA 2OYHA 1RE4A 1FZEC 3FIBA 2OYHB 2Q9IA 1FZFA 1FZAB 1N73B 3BVHA 1LTJC 4R9JA 2JHLF 3HUSB 2J2PA 2HODA 2J3UA 2GY7A 1RF0A 1JY3N 1FZGB 2JHMF 2HPCC 1JY2O 3GHGC 1RE4B 1RF0C 3E1IB 4M7FA 2WNPF 1LWUC 4JYOX 2H43C 1FIBA 1LTJA 1Z3SA 1FZEB 2J5ZA 2FIBA 2J0GA 4ZFGA 3H32A 1FZFC 1LT9B 2Q9IC 2HPCB 1RE4C 3E1IC 4M7HA 2J3OA 1LT9A 2HLOA 1N86B 3HUSC 3H32B 1LWUB 1M1JA 2XNXC 4R9TA 1FZBC 1FZGC 2XNXA 1M1JC 2OYIA 1JY3O 2HLOC 1FZCB 1LT9C 3E1IA 1JY2N 2J3FD 2J3GA 1W2EA 1JY2P 2H43B 4NYTA 1N86C 3H32C 1FZAA 2XNXB 1JY3P 1FZFB 2FFDC 1RE3B 2J0YA 2Q9IB 2H43A 1RE3A 4EPUA 2JHHC 1LWUA 3GHGA 2HPCA 2JHKF 2A45I 1RF1C 1FZBB 1FZCA 2HODC 1M1JB 2HLOB 1FZCC 2JHIF
chains in the Genus database with same CATH superfamily
2KZIA 1KN7A 5KAIE 1YJWP 3VMXA 5AW8B 1BE3J 1QX8A 2YO2A 2OTJP 1RQUA 1URQD 4Y99B 2L5GB 1SQVE 1VQLP 2J61A 1VF5C 4JBZA 2R3CA 3V5BA 2O01N 2OTKE 1FOSE 1VQNP 1FIDA 1DX7A 2J60A 3ABVC 3AE1C 2Q9IA 2NPSD 4I7ZB 3KXDA 1FE6A 2P58A 3TGUE 3VP8A 3HUSB 2ZVOB 1SQVD 1J2JB 5APYA 2JHMF 1URQA 1N7SA 3EWKA 1JO5A 3TF5A 2M8RA 2RKLA 3FXEA 1L4AB 3VMZA 3O6QA 1OX3A 1LWUB 2C0XA 3A0HH 3CPWO 1KFNA 2HG5D 1NU1E 1ZXGA 1USEA 1M57D 3E1IA 5KKZB 2QEXP 1NTMG 4HYTB 1RQVA 1Q86Q 1EXJA 3CCLP 4WY4C 1KQSO 2JJLA 3L37A 3RBXA 3MIWA 3Q3DA 3CI9A 1OFCX 1P84H 2YKOA 2MKVA 2BASA 1S5LX 4O9BA 3Q1MA 2J61B 1QGKB 1RE3C 3V2RA 1G1IA 3WUVA 4WY4A 3RK3C 4JZCA 3AE2C 1KFMA 2W6BA 1KYOI 2ZT9B 3A0BE 1FICA 1FZBA 1VQMP 1J1EC 3HUSA 1WRGA 1X8YA 1ZRTE 3NTNA 3GF7A 4GIFA 4N3YB 3CWBD 3FWLA 1LGHB 5C39A 4YXDC 2FXPA 1JY3N 2AEFA 2ZVNB 3GHGC 3VYIA 3MUDC 1NJIQ 5GTIH 2FIBA 1S2EA 1G2CB 4AYCA 3AE9C 5CCGA 1ZRTD 5KLVE 1RE4C 3FWNA 5H2FH 1N86B 3H32B 1SFCA 3CMAP 2KP8A 1NAFA 3PLNA 1QVFO 3IN6A 2HLOC 1OIPA 1BGYJ 1L2PA 2QJPC 1K9MQ 1GU4A 3SFDC 1AFOA 5GTHE 4IOIH 2JHKF 5AW3B 3AE3C 3CX5D 4YTPC 2XNDH 4OWFA 3L71J 3WU2E 3TNUB 2H7HA 3CCVP 1S9KD 2Q6QA 4RJTA 1DEBA 2WITA 5E79E 1SQQD 1BGYE 4DT0A 2JR8A 3IR9A 2Z4EA 1GL2D 2V4HA 1BSNA 2IBZE 2K1AA 1RE4A 4PJ0E 1X0TA 1VQ4P 1VQOP 2KS1A 3WUTA 3A0BH 3BVHA 1IFJA 1L4AC 1LTJC 3BATA 2WZ7A 3KPEA 1GZLA 1S4XA 1LWUC 1PFIA 2Y9ZA 4UB6E 5AW6B 1UIXA 2A06E 4I6MC 1SQQE 1LT1A 1GL2A 1VQ8P 1SQBK 3E1IC 1JCCA 1LTTC 1KYOH 2Q1KA 1H0TB 3M0DC 2M3BA 5CBNA 1YHQP 1L0NG 1QL1A 3KZIE 1PGJA 2ITAA 3CD6P 3LW5J 4R4LA 3Q5PA 2KSJA 3Q5RA 1LTIC 3JCUE 3VMYA 3AEAC 1MZ9A 5KKZC 4XFJA 1RF1C 3VP9A 3BASA 3RK3B 2ZXEB 1YYCA 3MP7B 3L70E 4YPCA 1Z56A 3NXSA 3P8CD 2WSSH 1EDIA 2FFDB 2O01H 2C9NY 1G2CA 4HH2A 2E74D 2WT7B 4UB8E 4OGQC 2WSCJ 3H1HJ 2RMZA 1SQPG 2YO3A 4EOTA 2NRGA 1BGYD 3CWBE 1H8AA 1SQBD 3HE4A 1JMMA 2PAJA 1RE4B 2YMKA 3NMDA 2P2UA 1HGZA 4U3FJ 1PIXA 1G1JA 3H1IJ 3H32A 1FBMA 2BCCG 4H13B 1SP4A 3AE8C 3K5BA 2W6AA 2FYZA 1FZGC 4MN4C 2N1TA 3IAOA 1JY2N 2J3FD 1JY2P 4RESB 1L0LJ 1N86C 3H32C 2JEEA 3L75J 1QEXA 3H1LJ 3LIDA 1MV8A 1LTGC 1L0NE 1T3JA 2B88A 3BCCD 4RKUJ 2J59M 1SQXJ 2W83C 2IYPA 1P84I 2IDBA 2IBZG 3E1RA 3P8MC 5CCHA 2WPQA 3PTZA 2J3FA 1U7JA 1NGMB 4I1LA 1H89A 1LTJB 3V4WA 1BCCE 3CCEP 2CPSA 1X9VA 2OQQA 3H1LE 2OYHB 3JSVC 1QVGO 4GODA 1PV3A 5KJ7D 1ZOYC 2GA1A 3L74G 3V4QA 1OMIA 2V7QH 2J2PA 1N7SC 5L8RJ 2QJKC 1RY3A 4QMAA 2R32A 3L72E 1SQBE 3E1IB 5CCHD 2WNPF 1GL2B 1QLED 3PP5A 2VRSA 4L73A 4IL6E 1Q82Q 4D6TJ 2E74C 3OW2O 1D7MA 2CPBA 2JDIH 2QSIA 3H1KG 3V2NA 4IFFA 5EFWB 2KNCB 1EDLA 2Z5HA 2KXPB 1NU1D 2G8YA 3AEEC 3G6EP 1CZQA 1SLQA 2R3SA 3CX5I 1JY3P 1M56D 1HTLC 1LWUA 1ZMEC 4RO0A 3N7NA 2OYOA 2E75D 3MHVA 2JWDA 5AW9B 1HH0A 3D70A 1P84D 2OYIB 1FZEA 4C7NB 1R8EA 5B66E 1FZAC 2K3RA 1KD1Q 5BU8B 2OARA 1VQ6P 1PZQA 2J0HA 1KB9I 5B66H 3M0DA 3CXHD 2HYNA 1HVVA 3B4SA 3KZIH 1J1DC 1FU1A 3H1LD 2V7QJ 1GD2E 2I1KA 3BCCJ 1EZVI 4JYCA 3JCUH 1FJPA 2FYUE 4H13C 1KC8Q 1RF0C 3WUUA 4EI2A 5AW4B 2H88C 3L75G 4C7NA 1FZEB 3KHUA 3GLMA 2HLOA 4WB4A 3CXHE 1NTZE 3L74E 3CXHH 4GT1A 4OVNF 3LW5H 4KJMA 5KAFH 3RK2B 2IBZI 2QM7A 2O1JA 2FFDC 1L4AD 1YBKA 2JP3A 5KLVG 1H88A 3KQGA 2A45I 2WVRA 3G71P 3H1KJ 3U59A 1FDMA 4HKZH 4H44D 2O01J 3BRTB 1FDOA 1IZNB 1NVOA 5CBOA 2GM4A 3H1LG 4GOFA 4UB6H 2K37A 1KB9D 1EZVG 3L73E 4AQRD 4L75A 1NTZK 3L72G 4ZKPA 1JMBA 3HD7A 2IBZD 4PD4D 4U7JA 2YNYA 3AEBC 1SQPK 3H1IG 3PHLA 4L76A 5APVA 4PJ0H 3V6IA 2OGUA 1R5SA 2JKVA 3B71A 3B8EB 1Q90D 2O3JA 2POHA 1Z3SA 3TGUG 5KLVJ 3WMM0 2P67A 1XTGB 1YTZT 1YITP 1HJ0A 1YTZI 2FYNC 1WT6A 4U3FE 1JTHB 3V2QA 1X22A 1GK6A 1M90Q 1LTAC 1PGQA 2BEZF 5DJTB 3HRNA 3OJAB 2M5AA 4EPUA 3O8ZA 4Y99C 3I55P 3L73J 1OVRA 4W7YA 1FZBB 1NOHA 1FZCA 1M1JB 1SQVG 2WT7A 1AVYA 1SS1A 5TJHA 1SQPE 2ZFCA 1LP1A 3I56P 3EQ2A 1NKNA 3BRVB 3A3YB 2GUVA 5AVUB 2I1JA 2WSFJ 3L70J 1JEKA 5KLIB 5TISE 1HF9A 2IZ0A 1N7SB 2QJKB 4OH8B 4TT3H 2OYIC 2NPSA 1JM0A 3L73D 1RHZB 2AXTE 2PRRA 1FAVA 1L0NJ 1KQLA 4KHXA 3CL3D 3Q5SA 3HD7B 1LJ2A 3L75E 3L70D 3R2PA 3RL0D 5APUA 3S4RA 5B5EH 2JHLF 3D6ZA 2G3AA 2W90A 2QIWA 2N1TB 1PPJD 1DEEG 1RH5B 1ZV8A 3TYYA 3CCUP 2J0GA 1S9KE 1S3JA 3H1IE 2HPCB 3O6QB 1W5CE 4IFDK 1T2KD 2WPRA 3H1JG 2OYIA 3GW6A 2RN0A 5APWA 2K9YA 3II6A 1RE3B 2J5UA 2Q9IB 3CWBJ 2BCCE 2JHHC 3H6PA 5APSA 3P7KA 3H1JJ 1FZCC 3UIAA 2GUSA 1HWTC 3L71G 1T8ZA 2KNCA 3AEFC 5GTHH 2FFDA 1NAYA 3VMAA 1KB9H 1FOSF 1Z3UA 4LC1A 2WTYA 1AQTA 1TU3F 1S1CX 2A45G 3H1ID 1JC9A 1LP1B 3GHGB 1RF0B 1NO4A 4BRYB 4PV1B 1BE3D 1E5WA 1FS0E 2B9BA 1CI6B 3KYQA 4HB1A 4WVZA 1PPJE 1IK9A 2J3UA 3CX5E 2O1KA 3L36A 2H8PD 1YQ4C 4JYOX 1JB0J 1SFCD 2QA4P 2FKWB 1NU1K 1LT9B 1SQQJ 2K9JA 3MTUE 3PRJA 1OXZA 1JCDA 2QG4A 4M7HA 3SFEC 2J3OA 1AQ5A 1BDDA 2ZT9D 3CC7P 1E79H 3H1HG 4WY4D 1JY3O 4YXWH 2FYNB 1SQQG 1L0LK 1W2EA 2H43B 3A5TA 1PGOA 4DOJA 1Y47A 3G4SP 1IO4A 1M7LA 4DCKA 5AW7B 2XKMA 5CHXA 2Q3EA 3FXDA 1N7SD 1U7MA 3MZWB 2M5AB 2HR3A 3QWOC 1KTMA 3LIEA 1KZUB 5AW0B 1NKZB 1IFDA 2YMYA 2ZYAA 3IFMA 2R5BA 3M9BA 3SWKA 1K04A 4N78D 1ZN5A 4W80A 3F89A 4L74A 1GW4A 4C7RA 4GOEA 2HODB 1IFIA 1SQXG 2IYOA 1VQ5P 2I8DA 4B86A 2KLVA 5KLIC 3WU2H 3M06A 1L0LE 1DIPA 4UB8H 1VQPP 1NTZG 1KILA 1NU1J 1GDTA 2GY7A 1IJDB 1K8AQ 3ITKA 4PD4I 2HPCC 3CWBG 2ZJSE 3H1JD 3GF3A 1AV1A 1ZW0A 3Q2YA 2L91A 3HTKB 5APXA 1SQPD 5K5GB 1KB9E 1L0NK 2IFMA 3VTPC 1PPJG 3RBZA 2KOGA 2IZ1A 1FZBC 4R4MA 2NPSC 1LTBC 2FYUG 1AJYA 2OTLP 1KILD 4NYTA 1S72P 5CMZA 1VF5D 3H25A 1N7LA 2YKQA 3B5NB 1Y8AA 4TLFA 2D2CD 3H1HE 4H44B 3L4FA 4WBAA 3C9IA 5GTIE 1SQPJ 2KSEA 1NTME 4OGQB 2DW3A 4IFMA 4WY4B 1BE3E 4LGDE 3HD7C 2LXCB 3A7OA 1EDJA 3HE5A 2N9YB 4KT0J 2N1TC 2SPZA 1BSHA 2Y0DA 3FIBA 1M8OB 2R5DA 2FY8A 1GMJA 3P8CE 5KJ7C 4ASWA 2HODA 1JNMA 1SQXD 1CI6A 1NTMJ 1FZGB 5E79H 3D6YA 1H0TA 2M0BA 3M9HA 1NWQA 4ZMDA 2J5ZA 5APQA 1NYHA 3AE4C 2Q9IC 2QM8A 4M3LA 2RH0A 3CC4P 1L0LG 2FXOA 1NH4A 2CK3H 1W2BO 4Y28J 2ZAEB 5CCGD 3BCCG 1FZCB 1LT9C 1Q2NA 1P84E 2Q3IA 2WMMA 5CCHC 3T97A 3P32A 2H43A 2FYUK 1CSBA 4Z1MH 2E43A 3CC2P 1MKMA 1GU5A 1Y9BA 5DJUB 2HLOB 1A02F 1BCCG 2QJPB 4PV1C 2E76D 1YJNP 2J64A 2OYHC 4JPZB 3CCSP 4PD4H 2E5YA 1OW6A 5TISH 1PP9J 3F5HA 2J1GA 1PP9G 4WWIA 3L74J 1YJ9P 2YXRB 2FBWC 3OA7A 5AVTB 4OGQD 3W68A 2E5TA 4NPDA 2N1TD 3L72D 1IK7A 4R9JA 4ZKUA 5H2FE 1PP9D 3VN0A 3SWFA 1KV4A 2FYUJ 3H1KE 2YIUC 2QVAA 1KILC 2Q5UA 3C8VA 5AVRB 3B5ND 3L75D 1USDA 1KMIZ 1JTHA 4N78E 1KORA 1NTKE 2KI7B 3L35A 4GKGA 1SFCC 4H44C 4EDFA 4ZNCA 1JOCA 1MFZA 4NPFX 4EYYQ 1PGPA 2IPPA 1HUCA 1ZP0C 1Q7YQ 2UWJE 3TSIA 1FZFB 2C0WA 4BXLA 2FXMA 2NPSB 3EFGA 1A02J 3A0HE 3CCRP 1VQKP 1EXIA 1L0ND 3B5NA 3E7KA 1GW3A 2HODC 3EFFK 2QJYC 2AEMA 3H1JE 4BWNA 3B5NC 1WMKA 1R5LA 2BEQD 2BCCJ 2JO1A 1J1DB 1KYOE 4H13D 1JUNA 2Y9YA 2XU6A 3USSA 3TNUA 1OVUA 1N73A 1RF1B 2WWWA 4CPGA 4K35A 3ZDMA 1LNQA 2PP6A 3AECC 2WPVB 1FZDA 5CJ4A 1NTKK 1U57A 2XV5A 1FZEC 1IFPA 1OWAA 1N73B 2E76B 3OAKA 2A06G 1EZVE 3L73G 2E75B 1RF0A 1JY2O 3D71A 5M1BA 1VL2A 2QE7H 1FC2C 2QRXA 1SVFA 1BCCJ 3GG2A 3G9RA 1M1JA 1FDIA 3AEGC 1Q81Q 4GDOA 3TGUJ 1PL5A 1EDKA 3M0AA 4D6TE 1FZAA 3M9QA 5AVZB 4D6TD 1RE3A 2ZXXA 1KQFB 2B89A 1OVVA 1URQC 2WSCH 2FYUD 3L72J 2C9LY 4LLHA 4XE5B 2W8ZA 2JHIF 1SQVJ 2Z4EB 2WSEJ 2E42A 2PGDA 4U3FD 3SWYA 1SQVK 4DJGA 3AEDC 3TGUD 1HGVA 5AVVB 3RL0C 1AA0A 3BVHB 4JQ0D 3MD0A 2YKPA 4JF7A 1FZGA 3RK2D 3TDKA 4BRYA 5AVXB 3RK3E 3AE5C 1S5LE 3G3ZA 2M3EA 2P7JA 2KLUA 3FX0A 4I2LC 3W67A 2YIUB 2XZRA 2WQYC 4U3FG 2D2CC 2KZJA 2H89C 2KS1B 4K3AA 3CLQA 5KJ7A 2KUBA 1M1KQ 2B87A 1FIBA 1YIJP 1KYOD 3C1LA 5B5EE 4H0LB 2WSEH 1NHLA 2BCCD 1K05A 3RGUA 2B87B 3RK3D 3GMAA 5APTA 3HUSC 3M91A 2XNXC 2LKMA 2WSFH 1S5LH 2LXBA 3R4YA 4XA4A 1M1JC 1YQ3C 3HE4B 4W7ZA 1SQBG 3CCJP 2J3GA 1GL2C 3CXHI 1YI2P 2Z5IA 2E74B 2J0YA 3AE6C 1SFCB 1NTMD 3MGNA 1BGYG 1KQGB 2HPCA 2LR2A 1FJKA 1DH3A 1EZVD 3AE7C 4A7PA 5KAFE 3PJSK 2A45H 2AXCA 3RL0g 2AEJA 1KILE 2IX7C 1HBWA 3QH9A 2XDJA 1MUUA 3TK1A 2KB7P 3N4XA 3U1AA 1N86A 1ZR2A 5CJ0A 1T3UA 2WPSA 2N9BA 2KK7A 5KLVD 1N73C 1KILB 1VF5B 1T2KC 1BE3G 2KYVA 1FZAB 1GTWA 3HE5B 2Q7CA 5AVSB 1EQ7A 1BDCA 2YXQB 3PH0A 4I7ZC 4M7FA 1J1EB 2E76C 1LTJA 1CW5A 2W6JH 3SSUA 1N8RQ 1FZFC 2E75C 3HTKA 3L71D 1VDFA 3U1CA 4D6TG 2K88A 1DD4A 2NZ2A 1OZHA 3H1HD 4HJGH 5BU5A 1K73Q 1VQ7P 1XTCC 2W27A 1NTZJ 5AVYB 4AUWA 2QJYB 4ASVA 1URQB 4IL6H 5KTBA 3I5CA 1IFMA 1MFTA 1N2DC 3MUDA 1DD3A 3L71E 3GHGA 3KDPB 4EIJA 1PP9E 5AW5B 3RK2C 1L4AA 3V2PA 4IL6X 2IFNA 1RF1A 3BVHC 3BCCE 1QL2A 1GK4A 1NTZD 2A06D 4DZOA 1EC5A 2HFED 2ZYGA 3CCMP 2Z4EC 4PD4E 2J58A 5AVWB 3A2AA 3NFQA 2D39A 1L0LD 1NTKD 2D2CB 1VQ9P 4N6JA 3RL0B 4H0LD 3L70G 3S1KA 3CMEP 4C46A 2Y0EA 2OYHA 2ZT9C 2R44A 1FZFA 4JYBA 1SQXK 1ZLLA 5AW1B 4NPEA 1BCCD 3CCQP 1LTSC 1NTKG 3HD7D 3H1KD 1NU1G 1NTKJ 3IF4A 2Y0CA 2AXTH 2H43C 4ZFGA 2P10A 3FGAD 1SQQK 1LT9A 2K9JB 2MJZA 1NTMK 5AVQB 1UIIA 1T6AA 4R9TA 1OW7A 2XNXA 1OW8A 4H0LC 1IC2A 1X79B 1VPCA 1AVOA 3JC22 5KLVK 5CCGC 4PV1D 3CX5H 3L74D 2XNXB 3VOPA 1IFNA 3T97B 2JWAA 1SQBJ 2P1JA 2PFXA 5KAIH 1ZR4A 2KIKA 3S9OA 1SQXE 5AW2B 1HJBA 5BVZA 2ZYDA
chains in the Genus database with same CATH topology
3B5NC 3UIAA 2GUSA 1HWTC 3VMXA 1T8ZA 5AW8B 2YO2A 1J1DB 1JUNA 2FFDA 1URQD 3P8MC 4Y99B 5CCHA 2XU6A 2L5GB 3TNUA 2WPQA 2J3FA 2J61A 1N73A 1RF1B 1FOSF 1Z3UA 2WWWA 4LC1A 2WTYA 2A45G 4I1LA 1JC9A 2R3CA 2PP6A 3GHGB 3V5BA 1RF0B 1H89A 1LTJB 1FOSE 1NO4A 1FIDA 3V4WA 1DX7A 2J60A 1FZDA 2CPSA 5CJ4A 1X9VA 1NTKK 2XV5A 1FZEC 2OYHB 2Q9IA 1E5WA 2NPSD 1CI6B 3KYQA 1OWAA 1N73B 3VP8A 3OAKA 5KJ7D 1IK9A 3V4QA 3HUSB 1N7SC 2J2PA 1RY3A 2J3UA 2O1KA 1J2JB 5APYA 1RF0A 2R32A 3L36A 2JHMF 2H8PD 1URQA 1JY2O 3E1IB 5CCHD 1N7SA 2WNPF 1JO5A 2M8RA 4JYOX 1GL2B 1L4AB 1SFCD 2FKWB 3VMZA 3PP5A 2VRSA 1NU1K 1LT9B 3MTUE 1SVFA 1OXZA 2CPBA 1JCDA 4M7HA 2J3OA 1AQ5A 1LWUB 1M1JA 3V2NA 4IFFA 2C0XA 1KFNA 2HG5D 4WY4D 1JY3O 2Z5HA 3E1IA 1L0LK 1W2EA 2H43B 4HYTB 3A5TA 3M0AA 4DOJA 1CZQA 1SLQA 1IO4A 1FZAA 3M9QA 4WY4C 1JY3P 1M7LA 5AVZB 5AW7B 1HTLC 2XKMA 1RE3A 2JJLA 5CHXA 1LWUA 3L37A 1N7SD 3N7NA 1URQC 3MIWA 2WSCH 2C9LY 4LLHA 3CI9A 4XE5B 2YKOA 2JHIF 2BASA 5AW9B 3LIEA 4O9BA 1HH0A 2Z4EB 2J61B 1KZUB 5AW0B 1NKZB 2E42A 1IFDA 2YMYA 2OYIB 1FZEA 4C7NB 1RE3C 3IFMA 3SWYA 1SQVK 2R5BA 3M9BA 3V2RA 1G1IA 4N78D 4WY4A 1ZN5A 1FZAC 3RK3C 1HGVA 4W80A 5AVVB 3RL0C 4JZCA 3BVHB 1KFMA 3MD0A 5BU8B 2W6BA 2YKPA 2OARA 1GW4A 4C7RA 2HODB 4JF7A 1FICA 2J0HA 1IFIA 1FZGA 1FZBA 3M0DA 2HYNA 1J1EC 3RK2D 3HUSA 4B86A 5AVXB 2KLVA 1WRGA 3G3ZA 1HVVA 1X8YA 2P7JA 4I2LC 1J1DC 1FU1A 3NTNA 2XZRA 3M06A 4GIFA 1GD2E 2I1KA 4N3YB 1KILA 1GDTA 1LGHB 4JYCA 2GY7A 1IJDB 1FJPA 1JY3N 2HPCC 3GHGC 1RF0C 3VYIA 5AW4B 3CLQA 5KJ7A 1FIBA 4C7NA 1FZEB 2FIBA 1G2CB 3HTKB 4AYCA 5APXA 2WSEH 1L0NK 5CCGA 1NHLA 2IFMA 1RE4C 3RK3D 3VTPC 2HLOA 4WB4A 5APTA 1N86B 3HUSC 3H32B 1SFCA 3M91A 2XNXC 2LKMA 2KOGA 2WSFH 2KP8A 1NAFA 4GT1A 1FZBC 4XA4A 2NPSC 1M1JC 1LTBC 3HE4B 2HLOC 3LW5H 4W7ZA 3RK2B 2J3GA 1GL2C 2QM7A 1KILD 4NYTA 2Z5IA 2O1JA 5CMZA 2FFDC 2J0YA 1N7LA 2YKQA 3B5NB 1GU4A 1L4AD 1SFCB 1AFOA 3MGNA 3L4FA 1H88A 3KQGA 3C9IA 4WBAA 2A45I 2HPCA 2JHKF 3U59A 1FDMA 5AW3B 1FJKA 1DH3A 2A45H 3BRTB 4IFMA 3TNUB 2IX7C 2H7HA 1S9KD 4WY4B 1HBWA 4LGDE 2XDJA 3HD7C 1MUUA 3TK1A 1DEBA 2WITA 2GM4A 2KB7P 3N4XA 3U1AA 1N86A 3A7OA 1ZR2A 5CJ0A 3HE5A 1T3UA 2WPSA 2N9BA 2N1TC 1N73C 3IR9A 2Z4EA 1GL2D 4AQRD 1NTZK 1KILB 4ZKPA 3HD7A 1RE4A 1T2KC 3FIBA 2YNYA 2KYVA 2R5DA 1FZAB 1GTWA 3HE5B 2Q7CA 3BVHA 1IFJA 1L4AC 1LTJC 1SQPK 1EQ7A 5AVSB 3P8CE 5KJ7C 5APVA 2HODA 1JNMA 1CI6A 3BATA 2WZ7A 1FZGB 3KPEA 4M7FA 1GZLA 3M9HA 1J1EB 3B8EB 1LWUC 1NWQA 1PFIA 1LTJA 2POHA 1CW5A 1Z3SA 5APQA 5AW6B 2P67A 1XTGB 3WMM0 2J5ZA 4I6MC 1YTZT 1FZFC 1YTZI 3HTKA 1VDFA 2Q9IC 2QM8A 1GL2A 4M3LA 3U1CA 1SQBK 3E1IC 1JCCA 1WT6A 1LTTC 1JTHB 3V2QA 1GK6A 1NH4A 3M0DC 5BU5A 2M3BA 1XTCC 2W27A 5CCGD 5AVYB 4AUWA 1FZCB 1LT9C 1LTAC 1QL1A 1URQB 3HRNA 2Q3IA 5KTBA 3I5CA 5CCHC 1IFMA 3OJAB 3T97A 3P32A 2KSJA 2H43A 4EPUA 3O8ZA 1N2DC 2FYUK 4Y99C 1CSBA 3MUDA 2E43A 1LTIC 3VMYA 3GHGA 1MZ9A 4W7YA 1RF1C 1FZBB 3KDPB 3VP9A 1NOHA 4EIJA 3BASA 1FZCA 1M1JB 1GU5A 5AW5B 2WT7A 3RK3B 2ZXEB 2HLOB 3RK2C 1A02F 1L4AA 1YYCA 2ZFCA 3V2PA 2IFNA 1RF1A 3BVHC 1Z56A 3EQ2A 1NKNA 3BRVB 3A3YB 3NXSA 1QL2A 3P8CD 1GK4A 2GUVA 2FFDB 2J64A 5AVUB 2OYHC 4DZOA 2I1JA 2O01H 2C9NY 1G2CA 2HFED 4HH2A 2Z4EC 2WT7B 1N7SB 2J58A 3A2AA 3NFQA 5AVWB 4OH8B 2D39A 2OYIC 2J1GA 2NPSA 4N6JA 1FAVA 2YO3A 3RL0B 1KQLA 3OA7A 4KHXA 5AVTB 3CL3D 4C46A 4EOTA 2OYHA 3HD7B 1H8AA 2N1TD 4JYBA 1FZFA 1SQXK 1ZLLA 5AW1B 3R2PA 3RL0D 5APUA 4R9JA 2JHLF 4ZKUA 1LTSC 3HD7D 3HE4A 3VN0A 3SWFA 1JMMA 2N1TB 2PAJA 1RE4B 3NMDA 1ZV8A 2P2UA 1HGZA 1KILC 2H43C 2Q5UA 3TYYA 5AVRB 1G1JA 3B5ND 2J0GA 4ZFGA 3H32A 1FBMA 1S9KE 1JTHA 1SP4A 2HPCB 1SQQK 4N78E 1LT9A 2MJZA 1NTMK 5AVQB 4IFDK 4R9TA 2W6AA 1T2KD 2FYZA 2WPRA 1FZGC 2XNXA 3L35A 4GKGA 2N1TA 1SFCC 2OYIA 1IC2A 1X79B 1VPCA 1JY2N 2J3FD 5KLVK 1JOCA 1JY2P 1MFZA 4RESB 5CCGC 2IPPA 1N86C 1HUCA 3H32C 2JEEA 5APWA 3TSIA 2XNXB 1FZFB 3II6A 2C0WA 3VOPA 1RE3B 2Q9IB 2FXMA 1IFNA 2NPSB 3EFGA 3LIDA 2JHHC 3H6PA 1MV8A 1LTGC 1A02J 5APSA 1T3JA 2P1JA 3P7KA 3B5NA 1ZR4A 1GW3A 2J59M 2HODC 5AW2B 1HJBA 5BVZA 1FZCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 A;  3BVH C;  2Z4E B;  2J61 B;  2A45 H;  2OYI B;  1FZE A;  1RE3 C;  2FFD B;  2J64 A;  2OYH C;  2FFD A;  1FZA C;  1N86 A;  2J3F A;  4JZC A;  2Z4E C;  3BVH B;  2J61 A;  1N73 A;  1RF1 B;  1T3U A;  1Z3U A;  2D39 A;  2HOD B;  1FIC A;  2OYI C;  2J0H A;  2J1G A;  1N73 C;  2A45 G;  1JC9 A;  1FZG A;  2Z4E A;  1FZB A;  3GHG B;  1RF0 B;  1LTJ B;  1FID A;  3HUS A;  2J60 A;  1FZD A;  2OYH A;  1RE4 A;  1FZE C;  3FIB A;  2OYH B;  2Q9I A;  1FZF A;  1FZA B;  1N73 B;  3BVH A;  1LTJ C;  4R9J A;  2JHL F;  3HUS B;  2J2P A;  2HOD A;  2J3U A;  2GY7 A;  1RF0 A;  1JY3 N;  1FZG B;  2JHM F;  2HPC C;  1JY2 O;  3GHG C;  1RE4 B;  1RF0 C;  3E1I B;  4M7F A;  2WNP F;  1LWU C;  4JYO X;  2H43 C;  1FIB A;  1LTJ A;  1Z3S A;  1FZE B;  2J5Z A;  2FIB A;  2J0G A;  4ZFG A;  3H32 A;  1FZF C;  1LT9 B;  2Q9I C;  2HPC B;  1RE4 C;  3E1I C;  4M7H A;  2J3O A;  1LT9 A;  2HLO A;  1N86 B;  3HUS C;  3H32 B;  1LWU B;  1M1J A;  2XNX C;  4R9T A;  1FZB C;  1FZG C;  2XNX A;  1M1J C;  2OYI A;  1JY3 O;  2HLO C;  1FZC B;  1LT9 C;  3E1I A;  1JY2 N;  2J3F D;  2J3G A;  1W2E A;  1JY2 P;  2H43 B;  4NYT A;  1N86 C;  3H32 C;  1FZA A;  2XNX B;  1JY3 P;  1FZF B;  2FFD C;  1RE3 B;  2J0Y A;  2Q9I B;  2H43 A;  1RE3 A;  4EPU A;  2JHH C;  1LWU A;  3GHG A;  2HPC A;  2JHK F;  2A45 I;  1RF1 C;  1FZB B;  1FZC A;  2HOD C;  1M1J B;  2HLO B;  1FZC C;  2JHI F; 
#chains in the Genus database with same CATH topology
 2KZI A;  1KN7 A;  5KAI E;  1YJW P;  3VMX A;  5AW8 B;  1BE3 J;  1QX8 A;  2YO2 A;  2OTJ P;  1RQU A;  1URQ D;  4Y99 B;  2L5G B;  1SQV E;  1VQL P;  2J61 A;  1VF5 C;  4JBZ A;  2R3C A;  3V5B A;  2O01 N;  2OTK E;  1FOS E;  1VQN P;  1FID A;  1DX7 A;  2J60 A;  3ABV C;  3AE1 C;  2Q9I A;  2NPS D;  4I7Z B;  3KXD A;  1FE6 A;  2P58 A;  3TGU E;  3VP8 A;  3HUS B;  2ZVO B;  1SQV D;  1J2J B;  5APY A;  2JHM F;  1URQ A;  1N7S A;  3EWK A;  1JO5 A;  3TF5 A;  2M8R A;  2RKL A;  3FXE A;  1L4A B;  3VMZ A;  3O6Q A;  1OX3 A;  1LWU B;  2C0X A;  3A0H H;  3CPW O;  1KFN A;  2HG5 D;  1NU1 E;  1ZXG A;  1USE A;  1M57 D;  3E1I A;  5KKZ B;  2QEX P;  1NTM G;  4HYT B;  1RQV A;  1Q86 Q;  1EXJ A;  3CCL P;  4WY4 C;  1KQS O;  2JJL A;  3L37 A;  3RBX A;  3MIW A;  3Q3D A;  3CI9 A;  1OFC X;  1P84 H;  2YKO A;  2MKV A;  2BAS A;  1S5L X;  4O9B A;  3Q1M A;  2J61 B;  1QGK B;  1RE3 C;  3V2R A;  1G1I A;  3WUV A;  4WY4 A;  3RK3 C;  4JZC A;  3AE2 C;  1KFM A;  2W6B A;  1KYO I;  2ZT9 B;  3A0B E;  1FIC A;  1FZB A;  1VQM P;  1J1E C;  3HUS A;  1WRG A;  1X8Y A;  1ZRT E;  3NTN A;  3GF7 A;  4GIF A;  4N3Y B;  3CWB D;  3FWL A;  1LGH B;  5C39 A;  4YXD C;  2FXP A;  1JY3 N;  2AEF A;  2ZVN B;  3GHG C;  3VYI A;  3MUD C;  1NJI Q;  5GTI H;  2FIB A;  1S2E A;  1G2C B;  4AYC A;  3AE9 C;  5CCG A;  1ZRT D;  5KLV E;  1RE4 C;  3FWN A;  5H2F H;  1N86 B;  3H32 B;  1SFC A;  3CMA P;  2KP8 A;  1NAF A;  3PLN A;  1QVF O;  3IN6 A;  2HLO C;  1OIP A;  1BGY J;  1L2P A;  2QJP C;  1K9M Q;  1GU4 A;  3SFD C;  1AFO A;  5GTH E;  4IOI H;  2JHK F;  5AW3 B;  3AE3 C;  3CX5 D;  4YTP C;  2XND H;  4OWF A;  3L71 J;  3WU2 E;  3TNU B;  2H7H A;  3CCV P;  1S9K D;  2Q6Q A;  4RJT A;  1DEB A;  2WIT A;  5E79 E;  1SQQ D;  1BGY E;  4DT0 A;  2JR8 A;  3IR9 A;  2Z4E A;  1GL2 D;  2V4H A;  1BSN A;  2IBZ E;  2K1A A;  1RE4 A;  4PJ0 E;  1X0T A;  1VQ4 P;  1VQO P;  2KS1 A;  3WUT A;  3A0B H;  3BVH A;  1IFJ A;  1L4A C;  1LTJ C;  3BAT A;  2WZ7 A;  3KPE A;  1GZL A;  1S4X A;  1LWU C;  1PFI A;  2Y9Z A;  4UB6 E;  5AW6 B;  1UIX A;  2A06 E;  4I6M C;  1SQQ E;  1LT1 A;  1GL2 A;  1VQ8 P;  1SQB K;  3E1I C;  1JCC A;  1LTT C;  1KYO H;  2Q1K A;  1H0T B;  3M0D C;  2M3B A;  5CBN A;  1YHQ P;  1L0N G;  1QL1 A;  3KZI E;  1PGJ A;  2ITA A;  3CD6 P;  3LW5 J;  4R4L A;  3Q5P A;  2KSJ A;  3Q5R A;  1LTI C;  3JCU E;  3VMY A;  3AEA C;  1MZ9 A;  5KKZ C;  4XFJ A;  1RF1 C;  3VP9 A;  3BAS A;  3RK3 B;  2ZXE B;  1YYC A;  3MP7 B;  3L70 E;  4YPC A;  1Z56 A;  3NXS A;  3P8C D;  2WSS H;  1EDI A;  2FFD B;  2O01 H;  2C9N Y;  1G2C A;  4HH2 A;  2E74 D;  2WT7 B;  4UB8 E;  4OGQ C;  2WSC J;  3H1H J;  2RMZ A;  1SQP G;  2YO3 A;  4EOT A;  2NRG A;  1BGY D;  3CWB E;  1H8A A;  1SQB D;  3HE4 A;  1JMM A;  2PAJ A;  1RE4 B;  2YMK A;  3NMD A;  2P2U A;  1HGZ A;  4U3F J;  1PIX A;  1G1J A;  3H1I J;  3H32 A;  1FBM A;  2BCC G;  4H13 B;  1SP4 A;  3AE8 C;  3K5B A;  2W6A A;  2FYZ A;  1FZG C;  4MN4 C;  2N1T A;  3IAO A;  1JY2 N;  2J3F D;  1JY2 P;  4RES B;  1L0L J;  1N86 C;  3H32 C;  2JEE A;  3L75 J;  1QEX A;  3H1L J;  3LID A;  1MV8 A;  1LTG C;  1L0N E;  1T3J A;  2B88 A;  3BCC D;  4RKU J;  2J59 M;  1SQX J;  2W83 C;  2IYP A;  1P84 I;  2IDB A;  2IBZ G;  3E1R A;  3P8M C;  5CCH A;  2WPQ A;  3PTZ A;  2J3F A;  1U7J A;  1NGM B;  4I1L A;  1H89 A;  1LTJ B;  3V4W A;  1BCC E;  3CCE P;  2CPS A;  1X9V A;  2OQQ A;  3H1L E;  2OYH B;  3JSV C;  1QVG O;  4GOD A;  1PV3 A;  5KJ7 D;  1ZOY C;  2GA1 A;  3L74 G;  3V4Q A;  1OMI A;  2V7Q H;  2J2P A;  1N7S C;  5L8R J;  2QJK C;  1RY3 A;  4QMA A;  2R32 A;  3L72 E;  1SQB E;  3E1I B;  5CCH D;  2WNP F;  1GL2 B;  1QLE D;  3PP5 A;  2VRS A;  4L73 A;  4IL6 E;  1Q82 Q;  4D6T J;  2E74 C;  3OW2 O;  1D7M A;  2CPB A;  2JDI H;  2QSI A;  3H1K G;  3V2N A;  4IFF A;  5EFW B;  2KNC B;  1EDL A;  2Z5H A;  2KXP B;  1NU1 D;  2G8Y A;  3AEE C;  3G6E P;  1CZQ A;  1SLQ A;  2R3S A;  3CX5 I;  1JY3 P;  1M56 D;  1HTL C;  1LWU A;  1ZME C;  4RO0 A;  3N7N A;  2OYO A;  2E75 D;  3MHV A;  2JWD A;  5AW9 B;  1HH0 A;  3D70 A;  1P84 D;  2OYI B;  1FZE A;  4C7N B;  1R8E A;  5B66 E;  1FZA C;  2K3R A;  1KD1 Q;  5BU8 B;  2OAR A;  1VQ6 P;  1PZQ A;  2J0H A;  1KB9 I;  5B66 H;  3M0D A;  3CXH D;  2HYN A;  1HVV A;  3B4S A;  3KZI H;  1J1D C;  1FU1 A;  3H1L D;  2V7Q J;  1GD2 E;  2I1K A;  3BCC J;  1EZV I;  4JYC A;  3JCU H;  1FJP A;  2FYU E;  4H13 C;  1KC8 Q;  1RF0 C;  3WUU A;  4EI2 A;  5AW4 B;  2H88 C;  3L75 G;  4C7N A;  1FZE B;  3KHU A;  3GLM A;  2HLO A;  4WB4 A;  3CXH E;  1NTZ E;  3L74 E;  3CXH H;  4GT1 A;  4OVN F;  3LW5 H;  4KJM A;  5KAF H;  3RK2 B;  2IBZ I;  2QM7 A;  2O1J A;  2FFD C;  1L4A D;  1YBK A;  2JP3 A;  5KLV G;  1H88 A;  3KQG A;  2A45 I;  2WVR A;  3G71 P;  3H1K J;  3U59 A;  1FDM A;  4HKZ H;  4H44 D;  2O01 J;  3BRT B;  1FDO A;  1IZN B;  1NVO A;  5CBO A;  2GM4 A;  3H1L G;  4GOF A;  4UB6 H;  2K37 A;  1KB9 D;  1EZV G;  3L73 E;  4AQR D;  4L75 A;  1NTZ K;  3L72 G;  4ZKP A;  1JMB A;  3HD7 A;  2IBZ D;  4PD4 D;  4U7J A;  2YNY A;  3AEB C;  1SQP K;  3H1I G;  3PHL A;  4L76 A;  5APV A;  4PJ0 H;  3V6I A;  2OGU A;  1R5S A;  2JKV A;  3B71 A;  3B8E B;  1Q90 D;  2O3J A;  2POH A;  1Z3S A;  3TGU G;  5KLV J;  3WMM 0;  2P67 A;  1XTG B;  1YTZ T;  1YIT P;  1HJ0 A;  1YTZ I;  2FYN C;  1WT6 A;  4U3F E;  1JTH B;  3V2Q A;  1X22 A;  1GK6 A;  1M90 Q;  1LTA C;  1PGQ A;  2BEZ F;  5DJT B;  3HRN A;  3OJA B;  2M5A A;  4EPU A;  3O8Z A;  4Y99 C;  3I55 P;  3L73 J;  1OVR A;  4W7Y A;  1FZB B;  1NOH A;  1FZC A;  1M1J B;  1SQV G;  2WT7 A;  1AVY A;  1SS1 A;  5TJH A;  1SQP E;  2ZFC A;  1LP1 A;  3I56 P;  3EQ2 A;  1NKN A;  3BRV B;  3A3Y B;  2GUV A;  5AVU B;  2I1J A;  2WSF J;  3L70 J;  1JEK A;  5KLI B;  5TIS E;  1HF9 A;  2IZ0 A;  1N7S B;  2QJK B;  4OH8 B;  4TT3 H;  2OYI C;  2NPS A;  1JM0 A;  3L73 D;  1RHZ B;  2AXT E;  2PRR A;  1FAV A;  1L0N J;  1KQL A;  4KHX A;  3CL3 D;  3Q5S A;  3HD7 B;  1LJ2 A;  3L75 E;  3L70 D;  3R2P A;  3RL0 D;  5APU A;  3S4R A;  5B5E H;  2JHL F;  3D6Z A;  2G3A A;  2W90 A;  2QIW A;  2N1T B;  1PPJ D;  1DEE G;  1RH5 B;  1ZV8 A;  3TYY A;  3CCU P;  2J0G A;  1S9K E;  1S3J A;  3H1I E;  2HPC B;  3O6Q B;  1W5C E;  4IFD K;  1T2K D;  2WPR A;  3H1J G;  2OYI A;  3GW6 A;  2RN0 A;  5APW A;  2K9Y A;  3II6 A;  1RE3 B;  2J5U A;  2Q9I B;  3CWB J;  2BCC E;  2JHH C;  3H6P A;  5APS A;  3P7K A;  3H1J J;  1FZC C;  3UIA A;  2GUS A;  1HWT C;  3L71 G;  1T8Z A;  2KNC A;  3AEF C;  5GTH H;  2FFD A;  1NAY A;  3VMA A;  1KB9 H;  1FOS F;  1Z3U A;  4LC1 A;  2WTY A;  1AQT A;  1TU3 F;  1S1C X;  2A45 G;  3H1I D;  1JC9 A;  1LP1 B;  3GHG B;  1RF0 B;  1NO4 A;  4BRY B;  4PV1 B;  1BE3 D;  1E5W A;  1FS0 E;  2B9B A;  1CI6 B;  3KYQ A;  4HB1 A;  4WVZ A;  1PPJ E;  1IK9 A;  2J3U A;  3CX5 E;  2O1K A;  3L36 A;  2H8P D;  1YQ4 C;  4JYO X;  1JB0 J;  1SFC D;  2QA4 P;  2FKW B;  1NU1 K;  1LT9 B;  1SQQ J;  2K9J A;  3MTU E;  3PRJ A;  1OXZ A;  1JCD A;  2QG4 A;  4M7H A;  3SFE C;  2J3O A;  1AQ5 A;  1BDD A;  2ZT9 D;  3CC7 P;  1E79 H;  3H1H G;  4WY4 D;  1JY3 O;  4YXW H;  2FYN B;  1SQQ G;  1L0L K;  1W2E A;  2H43 B;  3A5T A;  1PGO A;  4DOJ A;  1Y47 A;  3G4S P;  1IO4 A;  1M7L A;  4DCK A;  5AW7 B;  2XKM A;  5CHX A;  2Q3E A;  3FXD A;  1N7S D;  1U7M A;  3MZW B;  2M5A B;  2HR3 A;  3QWO C;  1KTM A;  3LIE A;  1KZU B;  5AW0 B;  1NKZ B;  1IFD A;  2YMY A;  2ZYA A;  3IFM A;  2R5B A;  3M9B A;  3SWK A;  1K04 A;  4N78 D;  1ZN5 A;  4W80 A;  3F89 A;  4L74 A;  1GW4 A;  4C7R A;  4GOE A;  2HOD B;  1IFI A;  1SQX G;  2IYO A;  1VQ5 P;  2I8D A;  4B86 A;  2KLV A;  5KLI C;  3WU2 H;  3M06 A;  1L0L E;  1DIP A;  4UB8 H;  1VQP P;  1NTZ G;  1KIL A;  1NU1 J;  1GDT A;  2GY7 A;  1IJD B;  1K8A Q;  3ITK A;  4PD4 I;  2HPC C;  3CWB G;  2ZJS E;  3H1J D;  3GF3 A;  1AV1 A;  1ZW0 A;  3Q2Y A;  2L91 A;  3HTK B;  5APX A;  1SQP D;  5K5G B;  1KB9 E;  1L0N K;  2IFM A;  3VTP C;  1PPJ G;  3RBZ A;  2KOG A;  2IZ1 A;  1FZB C;  4R4M A;  2NPS C;  1LTB C;  2FYU G;  1AJY A;  2OTL P;  1KIL D;  4NYT A;  1S72 P;  5CMZ A;  1VF5 D;  3H25 A;  1N7L A;  2YKQ A;  3B5N B;  1Y8A A;  4TLF A;  2D2C D;  3H1H E;  4H44 B;  3L4F A;  4WBA A;  3C9I A;  5GTI E;  1SQP J;  2KSE A;  1NTM E;  4OGQ B;  2DW3 A;  4IFM A;  4WY4 B;  1BE3 E;  4LGD E;  3HD7 C;  2LXC B;  3A7O A;  1EDJ A;  3HE5 A;  2N9Y B;  4KT0 J;  2N1T C;  2SPZ A;  1BSH A;  2Y0D A;  3FIB A;  1M8O B;  2R5D A;  2FY8 A;  1GMJ A;  3P8C E;  5KJ7 C;  4ASW A;  2HOD A;  1JNM A;  1SQX D;  1CI6 A;  1NTM J;  1FZG B;  5E79 H;  3D6Y A;  1H0T A;  2M0B A;  3M9H A;  1NWQ A;  4ZMD A;  2J5Z A;  5APQ A;  1NYH A;  3AE4 C;  2Q9I C;  2QM8 A;  4M3L A;  2RH0 A;  3CC4 P;  1L0L G;  2FXO A;  1NH4 A;  2CK3 H;  1W2B O;  4Y28 J;  2ZAE B;  5CCG D;  3BCC G;  1FZC B;  1LT9 C;  1Q2N A;  1P84 E;  2Q3I A;  2WMM A;  5CCH C;  3T97 A;  3P32 A;  2H43 A;  2FYU K;  1CSB A;  4Z1M H;  2E43 A;  3CC2 P;  1MKM A;  1GU5 A;  1Y9B A;  5DJU B;  2HLO B;  1A02 F;  1BCC G;  2QJP B;  4PV1 C;  2E76 D;  1YJN P;  2J64 A;  2OYH C;  4JPZ B;  3CCS P;  4PD4 H;  2E5Y A;  1OW6 A;  5TIS H;  1PP9 J;  3F5H A;  2J1G A;  1PP9 G;  4WWI A;  3L74 J;  1YJ9 P;  2YXR B;  2FBW C;  3OA7 A;  5AVT B;  4OGQ D;  3W68 A;  2E5T A;  4NPD A;  2N1T D;  3L72 D;  1IK7 A;  4R9J A;  4ZKU A;  5H2F E;  1PP9 D;  3VN0 A;  3SWF A;  1KV4 A;  2FYU J;  3H1K E;  2YIU C;  2QVA A;  1KIL C;  2Q5U A;  3C8V A;  5AVR B;  3B5N D;  3L75 D;  1USD A;  1KMI Z;  1JTH A;  4N78 E;  1KOR A;  1NTK E;  2KI7 B;  3L35 A;  4GKG A;  1SFC C;  4H44 C;  4EDF A;  4ZNC A;  1JOC A;  1MFZ A;  4NPF X;  4EYY Q;  1PGP A;  2IPP A;  1HUC A;  1ZP0 C;  1Q7Y Q;  2UWJ E;  3TSI A;  1FZF B;  2C0W A;  4BXL A;  2FXM A;  2NPS B;  3EFG A;  1A02 J;  3A0H E;  3CCR P;  1VQK P;  1EXI A;  1L0N D;  3B5N A;  3E7K A;  1GW3 A;  2HOD C;  3EFF K;  2QJY C;  2AEM A;  3H1J E;  4BWN A;  3B5N C;  1WMK A;  1R5L A;  2BEQ D;  2BCC J;  2JO1 A;  1J1D B;  1KYO E;  4H13 D;  1JUN A;  2Y9Y A;  2XU6 A;  3USS A;  3TNU A;  1OVU A;  1N73 A;  1RF1 B;  2WWW A;  4CPG A;  4K35 A;  3ZDM A;  1LNQ A;  2PP6 A;  3AEC C;  2WPV B;  1FZD A;  5CJ4 A;  1NTK K;  1U57 A;  2XV5 A;  1FZE C;  1IFP A;  1OWA A;  1N73 B;  2E76 B;  3OAK A;  2A06 G;  1EZV E;  3L73 G;  2E75 B;  1RF0 A;  1JY2 O;  3D71 A;  5M1B A;  1VL2 A;  2QE7 H;  1FC2 C;  2QRX A;  1SVF A;  1BCC J;  3GG2 A;  3G9R A;  1M1J A;  1FDI A;  3AEG C;  1Q81 Q;  4GDO A;  3TGU J;  1PL5 A;  1EDK A;  3M0A A;  4D6T E;  1FZA A;  3M9Q A;  5AVZ B;  4D6T D;  1RE3 A;  2ZXX A;  1KQF B;  2B89 A;  1OVV A;  1URQ C;  2WSC H;  2FYU D;  3L72 J;  2C9L Y;  4LLH A;  4XE5 B;  2W8Z A;  2JHI F;  1SQV J;  2Z4E B;  2WSE J;  2E42 A;  2PGD A;  4U3F D;  3SWY A;  1SQV K;  4DJG A;  3AED C;  3TGU D;  1HGV A;  5AVV B;  3RL0 C;  1AA0 A;  3BVH B;  4JQ0 D;  3MD0 A;  2YKP A;  4JF7 A;  1FZG A;  3RK2 D;  3TDK A;  4BRY A;  5AVX B;  3RK3 E;  3AE5 C;  1S5L E;  3G3Z A;  2M3E A;  2P7J A;  2KLU A;  3FX0 A;  4I2L C;  3W67 A;  2YIU B;  2XZR A;  2WQY C;  4U3F G;  2D2C C;  2KZJ A;  2H89 C;  2KS1 B;  4K3A A;  3CLQ A;  5KJ7 A;  2KUB A;  1M1K Q;  2B87 A;  1FIB A;  1YIJ P;  1KYO D;  3C1L A;  5B5E E;  4H0L B;  2WSE H;  1NHL A;  2BCC D;  1K05 A;  3RGU A;  2B87 B;  3RK3 D;  3GMA A;  5APT A;  3HUS C;  3M91 A;  2XNX C;  2LKM A;  2WSF H;  1S5L H;  2LXB A;  3R4Y A;  4XA4 A;  1M1J C;  1YQ3 C;  3HE4 B;  4W7Z A;  1SQB G;  3CCJ P;  2J3G A;  1GL2 C;  3CXH I;  1YI2 P;  2Z5I A;  2E74 B;  2J0Y A;  3AE6 C;  1SFC B;  1NTM D;  3MGN A;  1BGY G;  1KQG B;  2HPC A;  2LR2 A;  1FJK A;  1DH3 A;  1EZV D;  3AE7 C;  4A7P A;  5KAF E;  3PJS K;  2A45 H;  2AXC A;  3RL0 g;  2AEJ A;  1KIL E;  2IX7 C;  1HBW A;  3QH9 A;  2XDJ A;  1MUU A;  3TK1 A;  2KB7 P;  3N4X A;  3U1A A;  1N86 A;  1ZR2 A;  5CJ0 A;  1T3U A;  2WPS A;  2N9B A;  2KK7 A;  5KLV D;  1N73 C;  1KIL B;  1VF5 B;  1T2K C;  1BE3 G;  2KYV A;  1FZA B;  1GTW A;  3HE5 B;  2Q7C A;  5AVS B;  1EQ7 A;  1BDC A;  2YXQ B;  3PH0 A;  4I7Z C;  4M7F A;  1J1E B;  2E76 C;  1LTJ A;  1CW5 A;  2W6J H;  3SSU A;  1N8R Q;  1FZF C;  2E75 C;  3HTK A;  3L71 D;  1VDF A;  3U1C A;  4D6T G;  2K88 A;  1DD4 A;  2NZ2 A;  1OZH A;  3H1H D;  4HJG H;  5BU5 A;  1K73 Q;  1VQ7 P;  1XTC C;  2W27 A;  1NTZ J;  5AVY B;  4AUW A;  2QJY B;  4ASV A;  1URQ B;  4IL6 H;  5KTB A;  3I5C A;  1IFM A;  1MFT A;  1N2D C;  3MUD A;  1DD3 A;  3L71 E;  3GHG A;  3KDP B;  4EIJ A;  1PP9 E;  5AW5 B;  3RK2 C;  1L4A A;  3V2P A;  4IL6 X;  2IFN A;  1RF1 A;  3BVH C;  3BCC E;  1QL2 A;  1GK4 A;  1NTZ D;  2A06 D;  4DZO A;  1EC5 A;  2HFE D;  2ZYG A;  3CCM P;  2Z4E C;  4PD4 E;  2J58 A;  5AVW B;  3A2A A;  3NFQ A;  2D39 A;  1L0L D;  1NTK D;  2D2C B;  1VQ9 P;  4N6J A;  3RL0 B;  4H0L D;  3L70 G;  3S1K A;  3CME P;  4C46 A;  2Y0E A;  2OYH A;  2ZT9 C;  2R44 A;  1FZF A;  4JYB A;  1SQX K;  1ZLL A;  5AW1 B;  4NPE A;  1BCC D;  3CCQ P;  1LTS C;  1NTK G;  3HD7 D;  3H1K D;  1NU1 G;  1NTK J;  3IF4 A;  2Y0C A;  2AXT H;  2H43 C;  4ZFG A;  2P10 A;  3FGA D;  1SQQ K;  1LT9 A;  2K9J B;  2MJZ A;  1NTM K;  5AVQ B;  1UII A;  1T6A A;  4R9T A;  1OW7 A;  2XNX A;  1OW8 A;  4H0L C;  1IC2 A;  1X79 B;  1VPC A;  1AVO A;  3JC2 2;  5KLV K;  5CCG C;  4PV1 D;  3CX5 H;  3L74 D;  2XNX B;  3VOP A;  1IFN A;  3T97 B;  2JWA A;  1SQB J;  2P1J A;  2PFX A;  5KAI H;  1ZR4 A;  2KIK A;  3S9O A;  1SQX E;  5AW2 B;  1HJB A;  5BVZ A;  2ZYD A; 
#chains in the Genus database with same CATH homology
 3B5N C;  3UIA A;  2GUS A;  1HWT C;  3VMX A;  1T8Z A;  5AW8 B;  2YO2 A;  1J1D B;  1JUN A;  2FFD A;  1URQ D;  3P8M C;  4Y99 B;  5CCH A;  2XU6 A;  2L5G B;  3TNU A;  2WPQ A;  2J3F A;  2J61 A;  1N73 A;  1RF1 B;  1FOS F;  1Z3U A;  2WWW A;  4LC1 A;  2WTY A;  2A45 G;  4I1L A;  1JC9 A;  2R3C A;  2PP6 A;  3GHG B;  3V5B A;  1RF0 B;  1H89 A;  1LTJ B;  1FOS E;  1NO4 A;  1FID A;  3V4W A;  1DX7 A;  2J60 A;  1FZD A;  2CPS A;  5CJ4 A;  1X9V A;  1NTK K;  2XV5 A;  1FZE C;  2OYH B;  2Q9I A;  1E5W A;  2NPS D;  1CI6 B;  3KYQ A;  1OWA A;  1N73 B;  3VP8 A;  3OAK A;  5KJ7 D;  1IK9 A;  3V4Q A;  3HUS B;  1N7S C;  2J2P A;  1RY3 A;  2J3U A;  2O1K A;  1J2J B;  5APY A;  1RF0 A;  2R32 A;  3L36 A;  2JHM F;  2H8P D;  1URQ A;  1JY2 O;  3E1I B;  5CCH D;  1N7S A;  2WNP F;  1JO5 A;  2M8R A;  4JYO X;  1GL2 B;  1L4A B;  1SFC D;  2FKW B;  3VMZ A;  3PP5 A;  2VRS A;  1NU1 K;  1LT9 B;  3MTU E;  1SVF A;  1OXZ A;  2CPB A;  1JCD A;  4M7H A;  2J3O A;  1AQ5 A;  1LWU B;  1M1J A;  3V2N A;  4IFF A;  2C0X A;  1KFN A;  2HG5 D;  4WY4 D;  1JY3 O;  2Z5H A;  3E1I A;  1L0L K;  1W2E A;  2H43 B;  4HYT B;  3A5T A;  3M0A A;  4DOJ A;  1CZQ A;  1SLQ A;  1IO4 A;  1FZA A;  3M9Q A;  4WY4 C;  1JY3 P;  1M7L A;  5AVZ B;  5AW7 B;  1HTL C;  2XKM A;  1RE3 A;  2JJL A;  5CHX A;  1LWU A;  3L37 A;  1N7S D;  3N7N A;  1URQ C;  3MIW A;  2WSC H;  2C9L Y;  4LLH A;  3CI9 A;  4XE5 B;  2YKO A;  2JHI F;  2BAS A;  5AW9 B;  3LIE A;  4O9B A;  1HH0 A;  2Z4E B;  2J61 B;  1KZU B;  5AW0 B;  1NKZ B;  2E42 A;  1IFD A;  2YMY A;  2OYI B;  1FZE A;  4C7N B;  1RE3 C;  3IFM A;  3SWY A;  1SQV K;  2R5B A;  3M9B A;  3V2R A;  1G1I A;  4N78 D;  4WY4 A;  1ZN5 A;  1FZA C;  3RK3 C;  1HGV A;  4W80 A;  5AVV B;  3RL0 C;  4JZC A;  3BVH B;  1KFM A;  3MD0 A;  5BU8 B;  2W6B A;  2YKP A;  2OAR A;  1GW4 A;  4C7R A;  2HOD B;  4JF7 A;  1FIC A;  2J0H A;  1IFI A;  1FZG A;  1FZB A;  3M0D A;  2HYN A;  1J1E C;  3RK2 D;  3HUS A;  4B86 A;  5AVX B;  2KLV A;  1WRG A;  3G3Z A;  1HVV A;  1X8Y A;  2P7J A;  4I2L C;  1J1D C;  1FU1 A;  3NTN A;  2XZR A;  3M06 A;  4GIF A;  1GD2 E;  2I1K A;  4N3Y B;  1KIL A;  1GDT A;  1LGH B;  4JYC A;  2GY7 A;  1IJD B;  1FJP A;  1JY3 N;  2HPC C;  3GHG C;  1RF0 C;  3VYI A;  5AW4 B;  3CLQ A;  5KJ7 A;  1FIB A;  4C7N A;  1FZE B;  2FIB A;  1G2C B;  3HTK B;  4AYC A;  5APX A;  2WSE H;  1L0N K;  5CCG A;  1NHL A;  2IFM A;  1RE4 C;  3RK3 D;  3VTP C;  2HLO A;  4WB4 A;  5APT A;  1N86 B;  3HUS C;  3H32 B;  1SFC A;  3M91 A;  2XNX C;  2LKM A;  2KOG A;  2WSF H;  2KP8 A;  1NAF A;  4GT1 A;  1FZB C;  4XA4 A;  2NPS C;  1M1J C;  1LTB C;  3HE4 B;  2HLO C;  3LW5 H;  4W7Z A;  3RK2 B;  2J3G A;  1GL2 C;  2QM7 A;  1KIL D;  4NYT A;  2Z5I A;  2O1J A;  5CMZ A;  2FFD C;  2J0Y A;  1N7L A;  2YKQ A;  3B5N B;  1GU4 A;  1L4A D;  1SFC B;  1AFO A;  3MGN A;  3L4F A;  1H88 A;  3KQG A;  3C9I A;  4WBA A;  2A45 I;  2HPC A;  2JHK F;  3U59 A;  1FDM A;  5AW3 B;  1FJK A;  1DH3 A;  2A45 H;  3BRT B;  4IFM A;  3TNU B;  2IX7 C;  2H7H A;  1S9K D;  4WY4 B;  1HBW A;  4LGD E;  2XDJ A;  3HD7 C;  1MUU A;  3TK1 A;  1DEB A;  2WIT A;  2GM4 A;  2KB7 P;  3N4X A;  3U1A A;  1N86 A;  3A7O A;  1ZR2 A;  5CJ0 A;  3HE5 A;  1T3U A;  2WPS A;  2N9B A;  2N1T C;  1N73 C;  3IR9 A;  2Z4E A;  1GL2 D;  4AQR D;  1NTZ K;  1KIL B;  4ZKP A;  3HD7 A;  1RE4 A;  1T2K C;  3FIB A;  2YNY A;  2KYV A;  2R5D A;  1FZA B;  1GTW A;  3HE5 B;  2Q7C A;  3BVH A;  1IFJ A;  1L4A C;  1LTJ C;  1SQP K;  1EQ7 A;  5AVS B;  3P8C E;  5KJ7 C;  5APV A;  2HOD A;  1JNM A;  1CI6 A;  3BAT A;  2WZ7 A;  1FZG B;  3KPE A;  4M7F A;  1GZL A;  3M9H A;  1J1E B;  3B8E B;  1LWU C;  1NWQ A;  1PFI A;  1LTJ A;  2POH A;  1CW5 A;  1Z3S A;  5APQ A;  5AW6 B;  2P67 A;  1XTG B;  3WMM 0;  2J5Z A;  4I6M C;  1YTZ T;  1FZF C;  1YTZ I;  3HTK A;  1VDF A;  2Q9I C;  2QM8 A;  1GL2 A;  4M3L A;  3U1C A;  1SQB K;  3E1I C;  1JCC A;  1WT6 A;  1LTT C;  1JTH B;  3V2Q A;  1GK6 A;  1NH4 A;  3M0D C;  5BU5 A;  2M3B A;  1XTC C;  2W27 A;  5CCG D;  5AVY B;  4AUW A;  1FZC B;  1LT9 C;  1LTA C;  1QL1 A;  1URQ B;  3HRN A;  2Q3I A;  5KTB A;  3I5C A;  5CCH C;  1IFM A;  3OJA B;  3T97 A;  3P32 A;  2KSJ A;  2H43 A;  4EPU A;  3O8Z A;  1N2D C;  2FYU K;  4Y99 C;  1CSB A;  3MUD A;  2E43 A;  1LTI C;  3VMY A;  3GHG A;  1MZ9 A;  4W7Y A;  1RF1 C;  1FZB B;  3KDP B;  3VP9 A;  1NOH A;  4EIJ A;  3BAS A;  1FZC A;  1M1J B;  1GU5 A;  5AW5 B;  2WT7 A;  3RK3 B;  2ZXE B;  2HLO B;  3RK2 C;  1A02 F;  1L4A A;  1YYC A;  2ZFC A;  3V2P A;  2IFN A;  1RF1 A;  3BVH C;  1Z56 A;  3EQ2 A;  1NKN A;  3BRV B;  3A3Y B;  3NXS A;  1QL2 A;  3P8C D;  1GK4 A;  2GUV A;  2FFD B;  2J64 A;  5AVU B;  2OYH C;  4DZO A;  2I1J A;  2O01 H;  2C9N Y;  1G2C A;  2HFE D;  4HH2 A;  2Z4E C;  2WT7 B;  1N7S B;  2J58 A;  3A2A A;  3NFQ A;  5AVW B;  4OH8 B;  2D39 A;  2OYI C;  2J1G A;  2NPS A;  4N6J A;  1FAV A;  2YO3 A;  3RL0 B;  1KQL A;  3OA7 A;  4KHX A;  5AVT B;  3CL3 D;  4C46 A;  4EOT A;  2OYH A;  3HD7 B;  1H8A A;  2N1T D;  4JYB A;  1FZF A;  1SQX K;  1ZLL A;  5AW1 B;  3R2P A;  3RL0 D;  5APU A;  4R9J A;  2JHL F;  4ZKU A;  1LTS C;  3HD7 D;  3HE4 A;  3VN0 A;  3SWF A;  1JMM A;  2N1T B;  2PAJ A;  1RE4 B;  3NMD A;  1ZV8 A;  2P2U A;  1HGZ A;  1KIL C;  2H43 C;  2Q5U A;  3TYY A;  5AVR B;  1G1J A;  3B5N D;  2J0G A;  4ZFG A;  3H32 A;  1FBM A;  1S9K E;  1JTH A;  1SP4 A;  2HPC B;  1SQQ K;  4N78 E;  1LT9 A;  2MJZ A;  1NTM K;  5AVQ B;  4IFD K;  4R9T A;  2W6A A;  1T2K D;  2FYZ A;  2WPR A;  1FZG C;  2XNX A;  3L35 A;  4GKG A;  2N1T A;  1SFC C;  2OYI A;  1IC2 A;  1X79 B;  1VPC A;  1JY2 N;  2J3F D;  5KLV K;  1JOC A;  1JY2 P;  1MFZ A;  4RES B;  5CCG C;  2IPP A;  1N86 C;  1HUC A;  3H32 C;  2JEE A;  5APW A;  3TSI A;  2XNX B;  1FZF B;  3II6 A;  2C0W A;  3VOP A;  1RE3 B;  2Q9I B;  2FXM A;  1IFN A;  2NPS B;  3EFG A;  3LID A;  2JHH C;  3H6P A;  1MV8 A;  1LTG C;  1A02 J;  5APS A;  1T3J A;  2P1J A;  3P7K A;  3B5N A;  1ZR4 A;  1GW3 A;  2J59 M;  2HOD C;  5AW2 B;  1HJB A;  5BVZ A;  1FZC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...