1FZCB

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 93
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcB02
3HUSB 1JY3N 1LT9A 2XNXA 2HLOB 3BVHA 1LTJC 3HUSC 2J60A 2Z4EC 2D39A 1RE3A 2OYHA 2J0GA 3GHGA 1N86A 2Q9IC 3H32A 1FZGB 1W2EA 1FZBC 1FZAA 1FZGC 2OYIC 1FZFA 1FZEA 2HPCA 2J3UA 2J2PA 2OYHB 1LTJB 2Z4EB 4M7FA 4JYOX 1T3UA 1LT9C 2H43A 2XNXC 1RE4A 1JY2N 3BVHC 2Q9IB 1M1JA 1N73A 1RE3C 2OYHC 2A45G 3GHGC 1N86C 1FZBB 3H32C 3E1IA 2JHIF 1RF1A 1FZAC 2OYIB 1RF0A 2JHHC 3FIBA 2FIBA 1FZFC 1FZEC 2A45I 2HPCC 1LT9B 2FFDC 2XNXB 2FFDA 2J5ZA 3BVHB 1FZCA 1RE3B 2H43C 3GHGB 1RE4C 1N86B 2J0YA 3H32B 1M1JC 1N73C 4NYTA 1JY3P 2JHMF 1JY3O 2J1GA 2J0HA 2HODA 1FZDA 1FZAB 2HLOA 2GY7A 2J61A 3E1IC 1Z3SA 1RF1C 1FZFB 1RF0C 1FZEB 2J3GA 2HPCB 2FFDB 4ZFGA 2JHKF 4JZCA 2J64A 4EPUA 2H43B 1RE4B 1LWUC 2JHLF 1FZCC 1M1JB 1N73B 1LWUA 2HODB 1JC9A 2WNPF 2J61B 1FICA 4M7HA 4R9JA 3E1IB 4R9TA 1LTJA 3HUSA 2Z4EA 2HODC 1RF1B 2HLOC 1JY2P 1RF0B 2J3FA 1JY2O 2Q9IA 2J3FD 1FZBA 1Z3UA 1FIDA 1LWUB 1FZGA 2J3OA 1FZCB 1FIBA 2OYIA 2A45H
chains in the Genus database with same CATH superfamily
1SVFA 3Q1MA 3FXEA 1BCCD 1QGKB 4MN4C 2K9YA 1KN7A 1BSHA 2HLOB 3M9QA 2QJKB 4K3AA 1KQLA 4UB6H 1VQLP 3CI9A 3H1KD 2WT7A 1PPJG 1S2EA 1G2CA 3CD6P 2NZ2A 1QVGO 4KHXA 1KB9E 2XNXC 4H44B 1GU5A 1RE4A 1URQA 5E79H 1BGYJ 1HUCA 4IFDK 2FXOA 3A5TA 4UB8H 2KUBA 1HJ0A 3FXDA 2FFDA 3OAKA 1WT6A 3L75G 3GF7A 4WY4A 2OTLP 3H32B 1ZR4A 1JY3O 2C0XA 1LTTC 2ZXXA 2W83C 1PGOA 2E76D 5KLVD 5AVVB 5B5EE 1CI6B 1VF5C 3KHUA 4R4LA 3KPEA 2KB7P 3PLNA 5KLVK 3A7OA 1TU3F 3L71J 1HTLC 4O9BA 1ZMEC 2IZ0A 3VMXA 4OWFA 3CCUP 4U3FD 3Q2YA 1FZBA 1VQ4P 3RK2B 1LNQA 4YXWH 1EZVG 2Y0DA 1NTZG 4M3LA 2OTJP 3CX5E 4RKUJ 1L0LG 1RQVA 1KYOE 5GTIE 1BSNA 1SFCB 3HE5B 3KZIH 1N7SC 2RN0A 1W2BO 3H1LJ 1AA0A 1CZQA 2V4HA 2QM8A 1W2EA 4L75A 4PD4D 3L74G 1T6AA 2M5AB 1FZFA 4HH2A 4JYOX 3AEFC 4D6TJ 1RE3C 2A45G 2P7JA 3MD0A 4XE5B 5CBNA 3A0BE 2MKVA 5AVXB 3CWBJ 3M9BA 3W67A 1M1KQ 4IL6E 4NPEA 2ZT9C 4EIJA 1FU1A 5CHXA 1LTAC 2O01H 3H1JE 5AVSB 3BCCE 3SWYA 1RF1C 1VQ6P 2Y9YA 2PGDA 1IZNB 5KAIE 1PP9D 1CSBA 3CCRP 4PV1D 3HD7B 1D7MA 2FYUD 4HYTB 2E76B 2PRRA 1KQSO 1S5LX 2FYUK 3CXHH 2D2CB 3U59A 5AVWB 4BXLA 3L75J 1JY3N 2M0BA 3IF4A 1FDOA 1SQVG 1JTHA 3RK3D 3M0AA 4IFMA 1KQFB 1K73Q 1GL2D 1SQQG 1BGYD 4N6JA 2OYIC 2HFED 3R2PA 2WVRA 4IL6X 1LT9C 3T97A 4NPDA 1N73A 3G6EP 3AE3C 4CPGA 2G8YA 1G1JA 3MUDC 1NTZJ 5TISE 2E43A 3G3ZA 1L0LJ 2CK3H 2BCCD 1LP1A 2I8DA 2QSIA 2ZVNB 3BVHB 1L4AB 1M1JC 3EQ2A 2Y9ZA 3L74J 3B8EB 2WPSA 5KJ7A 3VMZA 2J3GA 1UIIA 2JHKF 4JZCA 3PH0A 1NJIQ 2J58A 3CCJP 3SSUA 3OJAB 2ZYGA 1SQPG 4M7HA 1RF0B 4HB1A 1KZUB 1JO5A 4W7YA 2E76C 3HRNA 1OFCX 3KQGA 4GOEA 2JEEA 5AW8B 1FZCB 2R5BA 2A45H 2KIKA 2IX7C 3AEBC 3TYYA 2Z4EC 2PP6A 3IN6A 1Q86Q 1GK4A 3CWBD 3CCMP 5E79E 1FS0E 3RK3B 3H1HD 1SQBG 3P32A 1H88A 2OQQA 1Q90D 1GL2B 4UB8E 1OVVA 1X79B 4HJGH 3RK3E 3L72G 1PPJD 2FKWB 1X8YA 4ASVA 2H7HA 1GZLA 3CXHD 2FFDC 1PIXA 3A0HH 2K3RA 4C7NB 2WITA 2E74B 1N86B 3AEDC 2KLUA 1VQPP 2XKMA 1SQQJ 1EDJA 3VMYA 2JDIH 2H8PD 1FZAB 2HLOA 1OXZA 2YO3A 2K9JB 2WSSH 5AVUB 2R44A 4R4MA 1S1CX 1PP9G 1YQ4C 2IZ1A 1LWUA 5APQA 3F5HA 3L75D 3O8ZA 2J61B 3L71E 4QMAA 2FYUG 3E1IB 3AECC 5AVRB 1RY3A 2QIWA 1PL5A 1Z3UA 1S4XA 2AXCA 1KB9I 5EFWB 1VQ9P 2J3OA 2AEFA 4PV1C 1K05A 1DEEG 3BRTB 1ZOYC 1KC8Q 1NOHA 1Q81Q 1GD2E 5CMZA 3H32A 5KLVJ 3H1LE 2HR3A 3RL0D 1J1DC 1NTZD 5APTA 2RH0A 1L0LD 3EFFK 4JQ0D 1EQ7A 2ZYAA 1YJNP 1IFNA 1SQPJ 3NXSA 1NTZK 1PGQA 1P84D 3B5NA 1KILD 1L0LK 3RK3C 3CC2P 3U1AA 2QG4A 3CLQA 1GL2C 4D6TE 2N9YB 5CJ4A 2ITAA 3CWBE 2R32A 1M90Q 1YQ3C 3AE8C 4PJ0H 5CCGD 2BCCG 2XNXB 2B87B 1OW7A 1U57A 1JMMA 1SFCA 2JHMF 3V2RA 2J0HA 3CX5I 1HF9A 2W6BA 2GY7A 2KSEA 1KYOI 2G3AA 1SQXE 4ZFGA 1FJPA 1SQBJ 2J64A 3FWNA 3CXHE 3E1RA 3L70G 4LC1A 3VP8A 1L2PA 2M5AA 2WNPF 3OW2O 3L72J 4PD4H 1YBKA 4JYBA 2P58A 2J3FD 2GUSA 2NPSA 2IYOA 1VF5B 2QM7A 1WRGA 1FIDA 1VQKP 2QVAA 5AW4B 5AVTB 2E75D 1YYCA 2XNDH 1EC5A 1G1IA 3RBZA 1R5SA 2C9NY 1K9MQ 5KTBA 2AEJA 4Y28J 1ZV8A 2IBZD 1PP9J 1N7SB 3MIWA 1AQ5A 3H1HG 2FYUJ 3TK1A 3G4SP 1T3UA 1SQVD 3HD7A 3Q5PA 3GHGC 2PAJA 1SQVK 1HJBA 1SQQD 2K1AA 1JUNA 1PGJA 1EZVE 1NTZE 3FIBA 1SQQK 2FIBA 1K04A 2KP8A 2Z5IA 1N7LA 1RE3B 1FAVA 3PJSK 5L8RJ 2XV5A 1E79H 3CMAP 2KS1B 1EDLA 4BRYA 3Q5RA 2JO1A 2ZT9B 3L74E 2FYZA 4WBAA 1JB0J 1R5LA 1DX7A 3RGUA 1MKMA 1HGZA 1JC9A 3V2QA 4R9TA 1L0ND 4N78E 1RF1B 3V2PA 1JY2P 1VQNP 1L0NK 2OYOA 2N1TD 1KD1Q 1OX3A 2BCCJ 1Y8AA 2IFNA 3C9IA 1FIBA 3AEEC 1KFMA 1NO4A 4WWIA 1SQPD 1YITP 3I5CA 3BVHA 1LTJC 2ZXEB 1L4AA 2V7QJ 1USDA 1SQPK 4OGQD 3L73D 2KNCB 3L70J 1BDDA 3WUVA 4I2LC 2OYHB 1NGMB 2V7QH 1NVOA 3AEGC 3A0HE 1URQD 3M91A 1USEA 1GK6A 3RL0C 2OYIB 1RF0A 3D6YA 1KQGB 4JPZB 1LT9B 1SQBD 2YKOA 1KILC 1FZCA 2H43C 1BCCE 3FWLA 2J0YA 4WY4D 1SQBK 1JM0A 3D70A 3L72D 1ZRTD 2QA4P 3CC7P 1SQQE 2UWJE 1Z3SA 2YMYA 1QLED 3H1KE 5GTHH 2A06D 4L74A 4TLFA 5CCGC 2VRSA 3H1HJ 3M0DA 5AW3B 1LWUC 1M1JB 2ZAEB 2P2UA 4GOFA 1FICA 5CJ0A 3HUSA 1GMJA 1FJKA 1LTBC 5AW7B 3R4YA 1FC2C 2YIUC 3AE9C 1FBMA 2FYNC 2Y0EA 1FZGA 3JCUE 3AE1C 5AW2B 1AFOA 4I6MC 3KXDA 3N4XA 1NTMD 3M06A 4C7NA 2J0GA 3AE5C 2N1TB 1IJDB 1H0TB 1N86A 2Q9IC 3F89A 1OW6A 1FZAA 5KLVE 2IBZG 4H13D 2K9JA 4LGDE 5APSA 3D71A 2J3UA 2IYPA 2E75C 5AVZB 2Z4EB 3LIEA 1FDMA 4EI2A 4PJ0E 2DW3A 2LKMA 2WT7B 3CC4P 2OYHC 3EWKA 1G2CB 3HE4B 4IOIH 3E1IA 4U3FE 3ZDMA 3H6PA 1QL2A 1GW3A 1M56D 5M1BA 1FZEC 3IAOA 3VTPC 3PP5A 2HPCC 1EDIA 5CCHA 1T8ZA 3NFQA 1RHZB 2HODA 2L5GB 3EFGA 4PD4E 2WTYA 2M8RA 2FFDB 1MZ9A 4WY4B 4K35A 1SQBE 2O3JA 5AW9B 3H25A 5APWA 1GDTA 3H1JG 1WMKA 2KSJA 4KT0J 3BCCG 1JOCA 1L0NG 2QRXA 3V2NA 3L72E 1ZRTE 1ZN5A 1NYHA 1XTCC 4WB4A 2E5TA 1E5WA 2C0WA 1P84H 1NTKD 4GKGA 1RQUA 3L70D 1DH3A 2GA1A 2XNXA 2B87A 1DD3A 5AVQB 2B9BA 2N1TC 4PV1B 1BE3G 3L73G 3P8MC 1PP9E 4UB6E 2Q7CA 2Z5HA 3FGAD 2FYUE 2YNYA 4OGQC 1R8EA 3CXHI 1J1DB 2FXMA 1S9KD 2ZJSE 3SWKA 3D6ZA 1PV3A 4I7ZC 1RE4C 3CCVP 2SPZA 1ZW0A 1YTZT 1URQC 3TNUB 5KJ7D 4H0LD 1BGYE 2A06G 4DCKA 2M3BA 1SQVJ 4WY4C 4R9JA 1KMIZ 2YKQA 3AE6C 1K8AQ 4JF7A 1MFTA 2WSCJ 2J59M 3FX0A 3V5BA 1S5LH 4C46A 3H1IG 2BCCE 1IO4A 5APVA 2MJZA 3MHVA 3W68A 2AXTH 1YIJP 1EXIA 1NTMG 2Q5UA 2O01N 2WSCH 1RE3A 2D39A 1GTWA 1EZVI 1N8RQ 3KZIE 1FZBC 2KS1A 1QEXA 1SS1A 1FOSE 1JTHB 1VPCA 3P7KA 3H1JJ 5AW6B 2LXBA 3BCCJ 1VQ8P 1M8OB 1L0NJ 2M3EA 3E7KA 4EDFA 1YJWP 1OVUA 5AW1B 1HVVA 2POHA 2FXPA 1RF1A 4GDOA 4H13C 2FY8A 1FZFC 2E42A 2A45I 3T97B 2XDJA 1CI6A 3B71A 3GHGB 3O6QB 4NPFX 1OIPA 1FZDA 5BU8B 1BE3J 3L73J 4ZKUA 1IFPA 1PZQA 5KLIC 1S9KE 3H1HE 2KNCA 1KTMA 1XTGB 3A3YB 3VYIA 4EYYQ 3HE5A 1AQTA 4H44D 2XZRA 1BDCA 2GM4A 1PPJE 2NRGA 1JCDA 3VP9A 1NTKG 2OYIA 1HGVA 2WSEJ 2O1KA 3TF5A 1LT9A 3IR9A 2FBWC 1VQMP 1NU1G 3KDPB 1HBWA 2YMKA 3UIAA 3C8VA 3MUDA 1YTZI 4Z1MH 1OW8A 3Q3DA 4TT3H 2WSEH 4Y99B 3JC22 1LTJB 3L4FA 3B5ND 3WMM0 3L75E 1M1JA 1ZXGA 4YXDC 3L35A 3TGUG 3H1IJ 2JHHC 1HH0A 2WPVB 4LLHA 4OH8B 3V4QA 1KYOD 3RK2D 1ZLLA 1NTMJ 2J5ZA 2OARA 1N73C 5H2FH 1JY3P 1SFCD 2H88C 1M7LA 3RL0B 3CCEP 1MFZA 1A02J 1KV4A 1KILB 1L0LE 2H43B 2JHLF 4YPCA 3ITKA 2C9LY 3MZWB 2JR8A 1P84E 1KILE 4W7ZA 3BASA 1OVRA 2Z4EA 2KLVA 3I56P 2NPSD 1OWAA 2H89C 5KJ7C 1VQ7P 4H0LC 1SQXG 3HE4A 1LWUB 2W6JH 4WVZA 5KKZC 1X22A 1U7JA 1IK7A 3L37A 2AEMA 3H1JD 2HYNA 4DOJA 3BCCD 3S4RA 2J60A 1JMBA 4YTPC 2WPRA 2YIUB 1ZP0C 3CMEP 4I1LA 2FYNB 2BEZF 2ZVOB 1QVFO 3USSA 3SWFA 2YXRB 1NWQA 5AVYB 3CPWO 1IFIA 3GMAA 4U7JA 1FOSF 4Y99C 2K37A 2Q9IB 3HTKB 4PD4I 3HD7D 2W8ZA 1QL1A 1IC2A 2IPPA 1NTKJ 1AJYA 1BE3D 1YHQP 3B5NB 2D2CD 2E75B 2QJPB 3II6A 4C7RA 3AEAC 1NU1J 4ZKPA 2J1GA 5BU5A 1J1EC 3CCLP 1LT1A 4XA4A 2QJYC 1FZEB 2HPCB 2IBZE 2IFMA 5KAFH 3QWOC 4RJTA 5AW0B 3G9RA 1AVOA 1S5LE 4W80A 1SQVE 1M57D 1EXJA 1JCCA 4A7PA 3TGUJ 2HLOC 1JY2O 2AXTE 2QJKC 2Q3EA 2KOGA 1QX8A 3OA7A 1KORA 4BWNA 2JKVA 2BASA 2NPSB 2O01J 2Q6QA 1L4AD 4H44C 1W5CE 3WU2H 3P8CD 1LJ2A 3LIDA 1HWTC 1GL2A 2W27A 3TNUA 3CCSP 1IFDA 1NKNA 3H1ID 1S3JA 1JEKA 2J5UA 3K5BA 2CPSA 1L0NE 3H32C 5DJUB 1NTMK 1SQXJ 1JNMA 1NH4A 1AV1A 1NHLA 3B5NC 2QEXP 2QJPC 5TJHA 1NAYA 1SQPE 4OGQB 2CPBA 1YJ9P 2Q3IA 2J61A 1FE6A 1MV8A 2LR2A 5APUA 4N3YB 2I1KA 1BE3E 3L73E 1S72P 1PFIA 4AUWA 4EPUA 3RK2C 4I7ZB 1LTSC 1RE4B 2W90A 1BCCG 4BRYB 3SFEC 1URQB 4GT1A 1SFCC 4DJGA 2E5YA 1Q7YQ 3IFMA 3H1KG 3I55P 1X9VA 4HKZH 1OZHA 4AYCA 1NKZB 1NAFA 2KYVA 3VN0A 4RO0A 2RMZA 1KFNA 2GUVA 2WZ7A 2B89A 3GW6A 4DT0A 3GHGA 3PRJA 2E74D 5B66H 3S1KA 3O6QA 2NPSC 1YI2P 1H89A 5APXA 1T2KD 2A06E 3BATA 3N7NA 2Q1KA 2Y0CA 3RL0g 2WQYC 4L73A 2P67A 1NTKK 3L71D 5C39A 1JY2N 1NU1D 1EDKA 3NTNA 1FZBB 3P8CE 1VDFA 3VOPA 1NU1K 3AE4C 2P1JA 5H2FE 5KLVG 1KB9H 4DZOA 1AVYA 3H1IE 1Y47A 5CCHD 2PFXA 4RESB 3RBXA 2P10A 3PTZA 1NTME 3HD7C 4NYTA 2L91A 3H1LD 4H13B 4U3FG 4EOTA 3TGUD 1FZFB 2JJLA 3NMDA 2D2CC 1DIPA 2YKPA 1VL2A 4GIFA 4ASWA 2WMMA 5B5EH 1LTJA 3QH9A 4D6TD 2KI7B 1U7MA 1DD4A 5KLIB 1SP4A 2HG5D 2JWDA 4L76A 2N9BA 3HUSB 1LTIC 2JWAA 1N7SA 1SLQA 5BVZA 3CX5H 2W6AA 1FZGB 2LXCB 4ZNCA 1KYOH 5GTIH 3TDKA 5AW5B 1SQXD 5K5GB 3V6IA 2BEQD 1CW5A 1RH5B 1BCCJ 2WPQA 1SQXK 2J2PA 1GW4A 1KILA 3GF3A 2H43A 3BVHC 1L4AC 3H1KJ 1MUUA 1OMIA 2JHIF 3KYQA 1VQ5P 2B88A 2R3CA 1DEBA 3MTUE 1UIXA 2KK7A 1P84I 3Q5SA 5CCGA 1VF5D 1NTKE 3VMAA 4XFJA 3L70E 4JBZA 1N2DC 3A0BH 5KAFE 1IFMA 2IDBA 1NU1E 2XU6A 3TSIA 2K88A 3GLMA 4IL6H 2WWWA 2R5DA 2OGUA 1RF0C 1X0TA 4B86A 3AE7C 1VQOP 1J2JB 1FZCC 1N73B 5GTHE 2HODB 1N7SD 3M9HA 3AE2C 2KZJA 5KAIH 2J3FA 3JCUH 3JSVC 2Q9IA 3HTKA 5APYA 3TGUE 2ZFCA 2ZYDA 2KZIA 1LP1B 1IFJA 1EZVD 1BGYG 3WUTA 3WU2E 2OTKE 3MGNA 3M0DC 4JYCA 1T3JA 1LTGC 3WUUA 1KB9D 1LGHB 2YXQB 3U1CA 3HUSC 2OYHA 4KJMA 4U3FJ 2RKLA 3MP7B 4H0LB 2WSFJ 3L74D 2O1JA 3L36A 5DJTB 3A2AA 5KKZB 1FZGC 1GU4A 1FZEA 4ZMDA 2ZT9D 3CL3D 2HPCA 3BRVB 4GODA 3G71P 1H8AA 4M7FA 4AQRD 3L71G 4N78D 2WSFH 2E74C 3LW5J 2I1JA 2IBZI 1N86C 1PGPA 1FZAC 1T2KC 2R3SA 1ZR2A 4OVNF 2KXPB 3V4WA 3LW5H 5TISH 5CBOA 3ABVC 2QE7H 3SFDC 3E1IC 3H1LG 2YO2A 4IFFA 2JP3A 3S9OA 3PHLA 1Z56A 3CX5D 1IK9A 1Y9BA 5CCHC 3C1LA 1FDIA 1A02F 3B4SA 3GG2A 1J1EB 2HODC 2QJYB 4D6TG 3CCQP 1Q2NA 1Q82Q 2N1TA 1H0TA 3CWBG 5B66E
chains in the Genus database with same CATH topology
3OA7A 1SVFA 1DH3A 2BASA 2XNXA 2NPSB 2HLOB 3BRTB 1NOHA 1L4AD 1GD2E 3M9QA 3P8CD 5CMZA 3LIDA 1HWTC 1GL2A 3H32A 1KQLA 5AVQB 3CI9A 2W27A 2WT7A 2N1TC 3TNUA 1G2CA 3RL0D 1J1DC 1IFDA 3P8MC 5APTA 1NKNA 4KHXA 1EQ7A 1IFNA 3NXSA 1NTZK 3B5NA 1KILD 1L0LK 2XNXC 2Q7CA 1GU5A 2Z5HA 1RE4A 3RK3C 2CPSA 3U1AA 2YNYA 3CLQA 1GL2C 1URQA 3H32C 1NTMK 1J1DB 5CJ4A 1JNMA 1HUCA 4IFDK 3A5TA 1NH4A 2FXMA 2R32A 5CCGD 1NHLA 1S9KD 2XNXB 2FFDA 3B5NC 3OAKA 1WT6A 1RE4C 4WY4A 3H32B 1ZR4A 1JMMA 1SFCA 2JHMF 2CPBA 1JY3O 3V2RA 2C0XA 2J0HA 1LTTC 1YTZT 1URQC 3TNUB 2W6BA 2Q3IA 2GY7A 2J61A 1MV8A 5APUA 5AVVB 1CI6B 4N3YB 5KJ7D 2I1KA 4ZFGA 4AUWA 1PFIA 1FJPA 2J64A 4EPUA 3RK2C 3KPEA 2KB7P 5KLVK 1LTSC 2M3BA 3A7OA 1RE4B 4LC1A 3VP8A 1HTLC 4O9BA 2WNPF 4WY4C 1URQB 4GT1A 4R9JA 1SFCC 2YKQA 4JYBA 3VMXA 4JF7A 2J3FD 2GUSA 2NPSA 3IFMA 2J59M 2QM7A 1FZBA 1WRGA 1X9VA 3RK2B 1FIDA 3V5BA 4M3LA 4C46A 5AW4B 4AYCA 1NKZB 1NAFA 2KYVA 3VN0A 1SFCB 5AVTB 3HE5B 1IO4A 1N7SC 5APVA 2MJZA 1KFNA 2GUVA 2WZ7A 2Q5UA 1YYCA 2D39A 2WSCH 1RE3A 1G1IA 3GHGA 1GTWA 1CZQA 2C9NY 2QM8A 2NPSC 1W2EA 5KTBA 1H89A 5APXA 1FZBC 1ZV8A 1T2KD 3BATA 1FZFA 1FOSE 1JTHB 1N7SB 1VPCA 3P7KA 3MIWA 3N7NA 4HH2A 1AQ5A 5AW6B 3TK1A 4JYOX 1T3UA 2P67A 1NTKK 1JY2N 1RE3C 2A45G 3HD7A 2P7JA 3GHGC 3NTNA 1FZBB 2PAJA 3MD0A 1VDFA 3P8CE 1SQVK 4XE5B 5AW1B 1HJBA 5AVXB 3VOPA 1HVVA 1NU1K 3M9BA 2POHA 1RF1A 2P1JA 1JUNA 4DZOA 3FIBA 1SQQK 2FIBA 1FZFC 4EIJA 2E42A 2A45I 1FU1A 2XDJA 1CI6A 2KP8A 5CHXA 2Z5IA 5CCHD 1LTAC 1N7LA 1RE3B 4RESB 1FAVA 2O01H 3GHGB 2XV5A 3HD7C 4NYTA 5AVSB 3SWYA 1FZDA 5BU8B 4EOTA 1RF1C 1FZFB 4ZKUA 2JJLA 2FYZA 4WBAA 3NMDA 1CSBA 1DX7A 2YKPA 1S9KE 3HD7B 4GIFA 1HGZA 1JC9A 1XTGB 4HYTB 3A3YB 3V2QA 3VYIA 4R9TA 1LTJA 4N78E 3HE5A 1RF1B 3V2PA 1JY2P 2FYUK 2XZRA 3U59A 1L0NK 2GM4A 1SP4A 2N1TD 2HG5D 5AVWB 2IFNA 3C9IA 1JCDA 3VP9A 1FIBA 2OYIA 2N9BA 1HGVA 3HUSB 1LTIC 1JY3N 1KFMA 1NO4A 2O1KA 1LT9A 1JTHA 1N7SA 3IR9A 3I5CA 3BVHA 1LTJC 2ZXEB 1L4AA 3RK3D 3KDPB 1HBWA 3M0AA 1SLQA 4IFMA 5BVZA 3UIAA 1SQPK 2W6AA 1GL2D 1FZGB 3MUDA 1YTZI 5AW5B 1CW5A 4N6JA 2WSEH 4Y99B 2OYIC 2WPQA 1SQXK 2HFED 3R2PA 4I2LC 2J2PA 1GW4A 2OYHB 1KILA 1LTJB 3L4FA 2H43A 1LT9C 3B5ND 3WMM0 3T97A 3BVHC 1L4AC 1M1JA 1N73A 1G1JA 1MUUA 1URQD 2JHIF 3KYQA 3L35A 3M91A 2E43A 3G3ZA 1GK6A 2R3CA 1DEBA 3RL0C 1HH0A 1RF0A 2OYIB 2JHHC 3MTUE 4LLHA 4OH8B 5CCGA 3V4QA 1LT9B 3RK2D 1ZLLA 2YKOA 2J5ZA 3BVHB 1KILC 1FZCA 1L4AB 1N2DC 2H43C 2OARA 1IFMA 2J0YA 1M1JC 1N73C 4WY4D 1JY3P 1SQBK 2XU6A 3EQ2A 3TSIA 1SFCD 1M7LA 2WWWA 3RL0B 2R5DA 1Z3SA 2YMYA 1MFZA 3B8EB 1RF0C 2WPSA 5KJ7A 3VMZA 2J3GA 4B86A 1A02J 5CCGC 2VRSA 2JHKF 4JZCA 1KILB 3M0DA 2H43B 5AW3B 1LWUC 1J2JB 2J58A 2JHLF 1FZCC 1M1JB 1N73B 2C9LY 2HODB 2P2UA 3OJAB 1N7SD 1FICA 4M7HA 4W7ZA 3M9HA 5CJ0A 3BASA 3HUSA 2Z4EA 5AW7B 1FJKA 1LTBC 2KLVA 1RF0B 2J3FA 1KZUB 2Q9IA 3HTKA 4W7YA 5APYA 1JO5A 2NPSD 1OWAA 3HRNA 2ZFCA 5KJ7C 1FBMA 1IFJA 3HE4A 3KQGA 2JEEA 1LWUB 5AW8B 1FZGA 1FZCB 3MGNA 3M0DC 2R5BA 4JYCA 2A45H 1T3JA 5AW2B 1LTGC 1AFOA 2IX7C 4I6MC 1LGHB 3L37A 3U1CA 3N4XA 3TYYA 2HYNA 3M06A 4DOJA 3HUSC 2J60A 2Z4EC 4C7NA 2OYHA 2J0GA 2WPRA 2N1TB 2PP6A 1IJDB 1N86A 4I1LA 2Q9IC 1FZAA 2O1JA 3L36A 3A2AA 3SWFA 1GK4A 1FZGC 1GU4A 4LGDE 5APSA 1NWQA 1FZEA 5AVYB 3CL3D 3RK3B 2HPCA 2J3UA 1IFIA 3BRVB 1H8AA 3P32A 5AVZB 2Z4EB 4M7FA 1FOSF 1H88A 4Y99C 1GL2B 4AQRD 3LIEA 1FDMA 1X79B 2LKMA 3HTKB 4N78D 2WT7B 2Q9IB 2OYHC 2WSFH 3HD7D 1G2CB 2I1JA 1N86C 3HE4B 3E1IA 1QL1A 2FKWB 1X8YA 3H6PA 1FZAC 1T2KC 1QL2A 1IC2A 2IPPA 1GW3A 2H7HA 3B5NB 1GZLA 1FZEC 3VTPC 3II6A 3PP5A 2HPCC 2FFDC 4C7RA 1ZR2A 5CCHA 1T8ZA 3V4WA 4C7NB 2WITA 3LW5H 3NFQA 1N86B 4ZKPA 2XKMA 2J1GA 3VMYA 2HODA 2H8PD 5BU5A 1FZAB 2HLOA 3E1IC 1OXZA 1J1EC 4XA4A 2L5GB 2YO3A 2YO2A 3EFGA 4IFFA 1FZEB 1Z56A 2WTYA 2M8RA 2HPCB 5AVUB 2FFDB 2IFMA 1MZ9A 1IK9A 5AW0B 4WY4B 5CCHC 1LWUA 5APQA 5AW9B 1A02F 3O8ZA 5APWA 4W80A 2J61B 1GDTA 2KSJA 3E1IB 1J1EB 1JOCA 1JCCA 5AVRB 2HODC 1RY3A 3V2NA 2HLOC 1ZN5A 1JY2O 1XTCC 4WB4A 1E5WA 2N1TA 1Z3UA 2C0WA 2J3OA 2KOGA 4GKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS B;  1JY3 N;  1LT9 A;  2XNX A;  2HLO B;  3BVH A;  1LTJ C;  3HUS C;  2J60 A;  2Z4E C;  2D39 A;  1RE3 A;  2OYH A;  2J0G A;  3GHG A;  1N86 A;  2Q9I C;  3H32 A;  1FZG B;  1W2E A;  1FZB C;  1FZA A;  1FZG C;  2OYI C;  1FZF A;  1FZE A;  2HPC A;  2J3U A;  2J2P A;  2OYH B;  1LTJ B;  2Z4E B;  4M7F A;  4JYO X;  1T3U A;  1LT9 C;  2H43 A;  2XNX C;  1RE4 A;  1JY2 N;  3BVH C;  2Q9I B;  1M1J A;  1N73 A;  1RE3 C;  2OYH C;  2A45 G;  3GHG C;  1N86 C;  1FZB B;  3H32 C;  3E1I A;  2JHI F;  1RF1 A;  1FZA C;  2OYI B;  1RF0 A;  2JHH C;  3FIB A;  2FIB A;  1FZF C;  1FZE C;  2A45 I;  2HPC C;  1LT9 B;  2FFD C;  2XNX B;  2FFD A;  2J5Z A;  3BVH B;  1FZC A;  1RE3 B;  2H43 C;  3GHG B;  1RE4 C;  1N86 B;  2J0Y A;  3H32 B;  1M1J C;  1N73 C;  4NYT A;  1JY3 P;  2JHM F;  1JY3 O;  2J1G A;  2J0H A;  2HOD A;  1FZD A;  1FZA B;  2HLO A;  2GY7 A;  2J61 A;  3E1I C;  1Z3S A;  1RF1 C;  1FZF B;  1RF0 C;  1FZE B;  2J3G A;  2HPC B;  2FFD B;  4ZFG A;  2JHK F;  4JZC A;  2J64 A;  4EPU A;  2H43 B;  1RE4 B;  1LWU C;  2JHL F;  1FZC C;  1M1J B;  1N73 B;  1LWU A;  2HOD B;  1JC9 A;  2WNP F;  2J61 B;  1FIC A;  4M7H A;  4R9J A;  3E1I B;  4R9T A;  1LTJ A;  3HUS A;  2Z4E A;  2HOD C;  1RF1 B;  2HLO C;  1JY2 P;  1RF0 B;  2J3F A;  1JY2 O;  2Q9I A;  2J3F D;  1FZB A;  1Z3U A;  1FID A;  1LWU B;  1FZG A;  2J3O A;  1FZC B;  1FIB A;  2OYI A;  2A45 H; 
#chains in the Genus database with same CATH topology
 1SVF A;  3Q1M A;  3FXE A;  1BCC D;  1QGK B;  4MN4 C;  2K9Y A;  1KN7 A;  1BSH A;  2HLO B;  3M9Q A;  2QJK B;  4K3A A;  1KQL A;  4UB6 H;  1VQL P;  3CI9 A;  3H1K D;  2WT7 A;  1PPJ G;  1S2E A;  1G2C A;  3CD6 P;  2NZ2 A;  1QVG O;  4KHX A;  1KB9 E;  2XNX C;  4H44 B;  1GU5 A;  1RE4 A;  1URQ A;  5E79 H;  1BGY J;  1HUC A;  4IFD K;  2FXO A;  3A5T A;  4UB8 H;  2KUB A;  1HJ0 A;  3FXD A;  2FFD A;  3OAK A;  1WT6 A;  3L75 G;  3GF7 A;  4WY4 A;  2OTL P;  3H32 B;  1ZR4 A;  1JY3 O;  2C0X A;  1LTT C;  2ZXX A;  2W83 C;  1PGO A;  2E76 D;  5KLV D;  5AVV B;  5B5E E;  1CI6 B;  1VF5 C;  3KHU A;  4R4L A;  3KPE A;  2KB7 P;  3PLN A;  5KLV K;  3A7O A;  1TU3 F;  3L71 J;  1HTL C;  4O9B A;  1ZME C;  2IZ0 A;  3VMX A;  4OWF A;  3CCU P;  4U3F D;  3Q2Y A;  1FZB A;  1VQ4 P;  3RK2 B;  1LNQ A;  4YXW H;  1EZV G;  2Y0D A;  1NTZ G;  4M3L A;  2OTJ P;  3CX5 E;  4RKU J;  1L0L G;  1RQV A;  1KYO E;  5GTI E;  1BSN A;  1SFC B;  3HE5 B;  3KZI H;  1N7S C;  2RN0 A;  1W2B O;  3H1L J;  1AA0 A;  1CZQ A;  2V4H A;  2QM8 A;  1W2E A;  4L75 A;  4PD4 D;  3L74 G;  1T6A A;  2M5A B;  1FZF A;  4HH2 A;  4JYO X;  3AEF C;  4D6T J;  1RE3 C;  2A45 G;  2P7J A;  3MD0 A;  4XE5 B;  5CBN A;  3A0B E;  2MKV A;  5AVX B;  3CWB J;  3M9B A;  3W67 A;  1M1K Q;  4IL6 E;  4NPE A;  2ZT9 C;  4EIJ A;  1FU1 A;  5CHX A;  1LTA C;  2O01 H;  3H1J E;  5AVS B;  3BCC E;  3SWY A;  1RF1 C;  1VQ6 P;  2Y9Y A;  2PGD A;  1IZN B;  5KAI E;  1PP9 D;  1CSB A;  3CCR P;  4PV1 D;  3HD7 B;  1D7M A;  2FYU D;  4HYT B;  2E76 B;  2PRR A;  1KQS O;  1S5L X;  2FYU K;  3CXH H;  2D2C B;  3U59 A;  5AVW B;  4BXL A;  3L75 J;  1JY3 N;  2M0B A;  3IF4 A;  1FDO A;  1SQV G;  1JTH A;  3RK3 D;  3M0A A;  4IFM A;  1KQF B;  1K73 Q;  1GL2 D;  1SQQ G;  1BGY D;  4N6J A;  2OYI C;  2HFE D;  3R2P A;  2WVR A;  4IL6 X;  1LT9 C;  3T97 A;  4NPD A;  1N73 A;  3G6E P;  3AE3 C;  4CPG A;  2G8Y A;  1G1J A;  3MUD C;  1NTZ J;  5TIS E;  2E43 A;  3G3Z A;  1L0L J;  2CK3 H;  2BCC D;  1LP1 A;  2I8D A;  2QSI A;  2ZVN B;  3BVH B;  1L4A B;  1M1J C;  3EQ2 A;  2Y9Z A;  3L74 J;  3B8E B;  2WPS A;  5KJ7 A;  3VMZ A;  2J3G A;  1UII A;  2JHK F;  4JZC A;  3PH0 A;  1NJI Q;  2J58 A;  3CCJ P;  3SSU A;  3OJA B;  2ZYG A;  1SQP G;  4M7H A;  1RF0 B;  4HB1 A;  1KZU B;  1JO5 A;  4W7Y A;  2E76 C;  3HRN A;  1OFC X;  3KQG A;  4GOE A;  2JEE A;  5AW8 B;  1FZC B;  2R5B A;  2A45 H;  2KIK A;  2IX7 C;  3AEB C;  3TYY A;  2Z4E C;  2PP6 A;  3IN6 A;  1Q86 Q;  1GK4 A;  3CWB D;  3CCM P;  5E79 E;  1FS0 E;  3RK3 B;  3H1H D;  1SQB G;  3P32 A;  1H88 A;  2OQQ A;  1Q90 D;  1GL2 B;  4UB8 E;  1OVV A;  1X79 B;  4HJG H;  3RK3 E;  3L72 G;  1PPJ D;  2FKW B;  1X8Y A;  4ASV A;  2H7H A;  1GZL A;  3CXH D;  2FFD C;  1PIX A;  3A0H H;  2K3R A;  4C7N B;  2WIT A;  2E74 B;  1N86 B;  3AED C;  2KLU A;  1VQP P;  2XKM A;  1SQQ J;  1EDJ A;  3VMY A;  2JDI H;  2H8P D;  1FZA B;  2HLO A;  1OXZ A;  2YO3 A;  2K9J B;  2WSS H;  5AVU B;  2R44 A;  4R4M A;  1S1C X;  1PP9 G;  1YQ4 C;  2IZ1 A;  1LWU A;  5APQ A;  3F5H A;  3L75 D;  3O8Z A;  2J61 B;  3L71 E;  4QMA A;  2FYU G;  3E1I B;  3AEC C;  5AVR B;  1RY3 A;  2QIW A;  1PL5 A;  1Z3U A;  1S4X A;  2AXC A;  1KB9 I;  5EFW B;  1VQ9 P;  2J3O A;  2AEF A;  4PV1 C;  1K05 A;  1DEE G;  3BRT B;  1ZOY C;  1KC8 Q;  1NOH A;  1Q81 Q;  1GD2 E;  5CMZ A;  3H32 A;  5KLV J;  3H1L E;  2HR3 A;  3RL0 D;  1J1D C;  1NTZ D;  5APT A;  2RH0 A;  1L0L D;  3EFF K;  4JQ0 D;  1EQ7 A;  2ZYA A;  1YJN P;  1IFN A;  1SQP J;  3NXS A;  1NTZ K;  1PGQ A;  1P84 D;  3B5N A;  1KIL D;  1L0L K;  3RK3 C;  3CC2 P;  3U1A A;  2QG4 A;  3CLQ A;  1GL2 C;  4D6T E;  2N9Y B;  5CJ4 A;  2ITA A;  3CWB E;  2R32 A;  1M90 Q;  1YQ3 C;  3AE8 C;  4PJ0 H;  5CCG D;  2BCC G;  2XNX B;  2B87 B;  1OW7 A;  1U57 A;  1JMM A;  1SFC A;  2JHM F;  3V2R A;  2J0H A;  3CX5 I;  1HF9 A;  2W6B A;  2GY7 A;  2KSE A;  1KYO I;  2G3A A;  1SQX E;  4ZFG A;  1FJP A;  1SQB J;  2J64 A;  3FWN A;  3CXH E;  3E1R A;  3L70 G;  4LC1 A;  3VP8 A;  1L2P A;  2M5A A;  2WNP F;  3OW2 O;  3L72 J;  4PD4 H;  1YBK A;  4JYB A;  2P58 A;  2J3F D;  2GUS A;  2NPS A;  2IYO A;  1VF5 B;  2QM7 A;  1WRG A;  1FID A;  1VQK P;  2QVA A;  5AW4 B;  5AVT B;  2E75 D;  1YYC A;  2XND H;  1EC5 A;  1G1I A;  3RBZ A;  1R5S A;  2C9N Y;  1K9M Q;  5KTB A;  2AEJ A;  4Y28 J;  1ZV8 A;  2IBZ D;  1PP9 J;  1N7S B;  3MIW A;  1AQ5 A;  3H1H G;  2FYU J;  3TK1 A;  3G4S P;  1T3U A;  1SQV D;  3HD7 A;  3Q5P A;  3GHG C;  2PAJ A;  1SQV K;  1HJB A;  1SQQ D;  2K1A A;  1JUN A;  1PGJ A;  1EZV E;  1NTZ E;  3FIB A;  1SQQ K;  2FIB A;  1K04 A;  2KP8 A;  2Z5I A;  1N7L A;  1RE3 B;  1FAV A;  3PJS K;  5L8R J;  2XV5 A;  1E79 H;  3CMA P;  2KS1 B;  1EDL A;  4BRY A;  3Q5R A;  2JO1 A;  2ZT9 B;  3L74 E;  2FYZ A;  4WBA A;  1JB0 J;  1R5L A;  1DX7 A;  3RGU A;  1MKM A;  1HGZ A;  1JC9 A;  3V2Q A;  4R9T A;  1L0N D;  4N78 E;  1RF1 B;  3V2P A;  1JY2 P;  1VQN P;  1L0N K;  2OYO A;  2N1T D;  1KD1 Q;  1OX3 A;  2BCC J;  1Y8A A;  2IFN A;  3C9I A;  1FIB A;  3AEE C;  1KFM A;  1NO4 A;  4WWI A;  1SQP D;  1YIT P;  3I5C A;  3BVH A;  1LTJ C;  2ZXE B;  1L4A A;  2V7Q J;  1USD A;  1SQP K;  4OGQ D;  3L73 D;  2KNC B;  3L70 J;  1BDD A;  3WUV A;  4I2L C;  2OYH B;  1NGM B;  2V7Q H;  1NVO A;  3AEG C;  3A0H E;  1URQ D;  3M91 A;  1USE A;  1GK6 A;  3RL0 C;  2OYI B;  1RF0 A;  3D6Y A;  1KQG B;  4JPZ B;  1LT9 B;  1SQB D;  2YKO A;  1KIL C;  1FZC A;  2H43 C;  1BCC E;  3FWL A;  2J0Y A;  4WY4 D;  1SQB K;  1JM0 A;  3D70 A;  3L72 D;  1ZRT D;  2QA4 P;  3CC7 P;  1SQQ E;  2UWJ E;  1Z3S A;  2YMY A;  1QLE D;  3H1K E;  5GTH H;  2A06 D;  4L74 A;  4TLF A;  5CCG C;  2VRS A;  3H1H J;  3M0D A;  5AW3 B;  1LWU C;  1M1J B;  2ZAE B;  2P2U A;  4GOF A;  1FIC A;  5CJ0 A;  3HUS A;  1GMJ A;  1FJK A;  1LTB C;  5AW7 B;  3R4Y A;  1FC2 C;  2YIU C;  3AE9 C;  1FBM A;  2FYN C;  2Y0E A;  1FZG A;  3JCU E;  3AE1 C;  5AW2 B;  1AFO A;  4I6M C;  3KXD A;  3N4X A;  1NTM D;  3M06 A;  4C7N A;  2J0G A;  3AE5 C;  2N1T B;  1IJD B;  1H0T B;  1N86 A;  2Q9I C;  3F89 A;  1OW6 A;  1FZA A;  5KLV E;  2IBZ G;  4H13 D;  2K9J A;  4LGD E;  5APS A;  3D71 A;  2J3U A;  2IYP A;  2E75 C;  5AVZ B;  2Z4E B;  3LIE A;  1FDM A;  4EI2 A;  4PJ0 E;  2DW3 A;  2LKM A;  2WT7 B;  3CC4 P;  2OYH C;  3EWK A;  1G2C B;  3HE4 B;  4IOI H;  3E1I A;  4U3F E;  3ZDM A;  3H6P A;  1QL2 A;  1GW3 A;  1M56 D;  5M1B A;  1FZE C;  3IAO A;  3VTP C;  3PP5 A;  2HPC C;  1EDI A;  5CCH A;  1T8Z A;  3NFQ A;  1RHZ B;  2HOD A;  2L5G B;  3EFG A;  4PD4 E;  2WTY A;  2M8R A;  2FFD B;  1MZ9 A;  4WY4 B;  4K35 A;  1SQB E;  2O3J A;  5AW9 B;  3H25 A;  5APW A;  1GDT A;  3H1J G;  1WMK A;  2KSJ A;  4KT0 J;  3BCC G;  1JOC A;  1L0N G;  2QRX A;  3V2N A;  3L72 E;  1ZRT E;  1ZN5 A;  1NYH A;  1XTC C;  4WB4 A;  2E5T A;  1E5W A;  2C0W A;  1P84 H;  1NTK D;  4GKG A;  1RQU A;  3L70 D;  1DH3 A;  2GA1 A;  2XNX A;  2B87 A;  1DD3 A;  5AVQ B;  2B9B A;  2N1T C;  4PV1 B;  1BE3 G;  3L73 G;  3P8M C;  1PP9 E;  4UB6 E;  2Q7C A;  2Z5H A;  3FGA D;  2FYU E;  2YNY A;  4OGQ C;  1R8E A;  3CXH I;  1J1D B;  2FXM A;  1S9K D;  2ZJS E;  3SWK A;  3D6Z A;  1PV3 A;  4I7Z C;  1RE4 C;  3CCV P;  2SPZ A;  1ZW0 A;  1YTZ T;  1URQ C;  3TNU B;  5KJ7 D;  4H0L D;  1BGY E;  2A06 G;  4DCK A;  2M3B A;  1SQV J;  4WY4 C;  4R9J A;  1KMI Z;  2YKQ A;  3AE6 C;  1K8A Q;  4JF7 A;  1MFT A;  2WSC J;  2J59 M;  3FX0 A;  3V5B A;  1S5L H;  4C46 A;  3H1I G;  2BCC E;  1IO4 A;  5APV A;  2MJZ A;  3MHV A;  3W68 A;  2AXT H;  1YIJ P;  1EXI A;  1NTM G;  2Q5U A;  2O01 N;  2WSC H;  1RE3 A;  2D39 A;  1GTW A;  1EZV I;  1N8R Q;  3KZI E;  1FZB C;  2KS1 A;  1QEX A;  1SS1 A;  1FOS E;  1JTH B;  1VPC A;  3P7K A;  3H1J J;  5AW6 B;  2LXB A;  3BCC J;  1VQ8 P;  1M8O B;  1L0N J;  2M3E A;  3E7K A;  4EDF A;  1YJW P;  1OVU A;  5AW1 B;  1HVV A;  2POH A;  2FXP A;  1RF1 A;  4GDO A;  4H13 C;  2FY8 A;  1FZF C;  2E42 A;  2A45 I;  3T97 B;  2XDJ A;  1CI6 A;  3B71 A;  3GHG B;  3O6Q B;  4NPF X;  1OIP A;  1FZD A;  5BU8 B;  1BE3 J;  3L73 J;  4ZKU A;  1IFP A;  1PZQ A;  5KLI C;  1S9K E;  3H1H E;  2KNC A;  1KTM A;  1XTG B;  3A3Y B;  3VYI A;  4EYY Q;  3HE5 A;  1AQT A;  4H44 D;  2XZR A;  1BDC A;  2GM4 A;  1PPJ E;  2NRG A;  1JCD A;  3VP9 A;  1NTK G;  2OYI A;  1HGV A;  2WSE J;  2O1K A;  3TF5 A;  1LT9 A;  3IR9 A;  2FBW C;  1VQM P;  1NU1 G;  3KDP B;  1HBW A;  2YMK A;  3UIA A;  3C8V A;  3MUD A;  1YTZ I;  4Z1M H;  1OW8 A;  3Q3D A;  4TT3 H;  2WSE H;  4Y99 B;  3JC2 2;  1LTJ B;  3L4F A;  3B5N D;  3WMM 0;  3L75 E;  1M1J A;  1ZXG A;  4YXD C;  3L35 A;  3TGU G;  3H1I J;  2JHH C;  1HH0 A;  2WPV B;  4LLH A;  4OH8 B;  3V4Q A;  1KYO D;  3RK2 D;  1ZLL A;  1NTM J;  2J5Z A;  2OAR A;  1N73 C;  5H2F H;  1JY3 P;  1SFC D;  2H88 C;  1M7L A;  3RL0 B;  3CCE P;  1MFZ A;  1A02 J;  1KV4 A;  1KIL B;  1L0L E;  2H43 B;  2JHL F;  4YPC A;  3ITK A;  2C9L Y;  3MZW B;  2JR8 A;  1P84 E;  1KIL E;  4W7Z A;  3BAS A;  1OVR A;  2Z4E A;  2KLV A;  3I56 P;  2NPS D;  1OWA A;  2H89 C;  5KJ7 C;  1VQ7 P;  4H0L C;  1SQX G;  3HE4 A;  1LWU B;  2W6J H;  4WVZ A;  5KKZ C;  1X22 A;  1U7J A;  1IK7 A;  3L37 A;  2AEM A;  3H1J D;  2HYN A;  4DOJ A;  3BCC D;  3S4R A;  2J60 A;  1JMB A;  4YTP C;  2WPR A;  2YIU B;  1ZP0 C;  3CME P;  4I1L A;  2FYN B;  2BEZ F;  2ZVO B;  1QVF O;  3USS A;  3SWF A;  2YXR B;  1NWQ A;  5AVY B;  3CPW O;  1IFI A;  3GMA A;  4U7J A;  1FOS F;  4Y99 C;  2K37 A;  2Q9I B;  3HTK B;  4PD4 I;  3HD7 D;  2W8Z A;  1QL1 A;  1IC2 A;  2IPP A;  1NTK J;  1AJY A;  1BE3 D;  1YHQ P;  3B5N B;  2D2C D;  2E75 B;  2QJP B;  3II6 A;  4C7R A;  3AEA C;  1NU1 J;  4ZKP A;  2J1G A;  5BU5 A;  1J1E C;  3CCL P;  1LT1 A;  4XA4 A;  2QJY C;  1FZE B;  2HPC B;  2IBZ E;  2IFM A;  5KAF H;  3QWO C;  4RJT A;  5AW0 B;  3G9R A;  1AVO A;  1S5L E;  4W80 A;  1SQV E;  1M57 D;  1EXJ A;  1JCC A;  4A7P A;  3TGU J;  2HLO C;  1JY2 O;  2AXT E;  2QJK C;  2Q3E A;  2KOG A;  1QX8 A;  3OA7 A;  1KOR A;  4BWN A;  2JKV A;  2BAS A;  2NPS B;  2O01 J;  2Q6Q A;  1L4A D;  4H44 C;  1W5C E;  3WU2 H;  3P8C D;  1LJ2 A;  3LID A;  1HWT C;  1GL2 A;  2W27 A;  3TNU A;  3CCS P;  1IFD A;  1NKN A;  3H1I D;  1S3J A;  1JEK A;  2J5U A;  3K5B A;  2CPS A;  1L0N E;  3H32 C;  5DJU B;  1NTM K;  1SQX J;  1JNM A;  1NH4 A;  1AV1 A;  1NHL A;  3B5N C;  2QEX P;  2QJP C;  5TJH A;  1NAY A;  1SQP E;  4OGQ B;  2CPB A;  1YJ9 P;  2Q3I A;  2J61 A;  1FE6 A;  1MV8 A;  2LR2 A;  5APU A;  4N3Y B;  2I1K A;  1BE3 E;  3L73 E;  1S72 P;  1PFI A;  4AUW A;  4EPU A;  3RK2 C;  4I7Z B;  1LTS C;  1RE4 B;  2W90 A;  1BCC G;  4BRY B;  3SFE C;  1URQ B;  4GT1 A;  1SFC C;  4DJG A;  2E5Y A;  1Q7Y Q;  3IFM A;  3H1K G;  3I55 P;  1X9V A;  4HKZ H;  1OZH A;  4AYC A;  1NKZ B;  1NAF A;  2KYV A;  3VN0 A;  4RO0 A;  2RMZ A;  1KFN A;  2GUV A;  2WZ7 A;  2B89 A;  3GW6 A;  4DT0 A;  3GHG A;  3PRJ A;  2E74 D;  5B66 H;  3S1K A;  3O6Q A;  2NPS C;  1YI2 P;  1H89 A;  5APX A;  1T2K D;  2A06 E;  3BAT A;  3N7N A;  2Q1K A;  2Y0C A;  3RL0 g;  2WQY C;  4L73 A;  2P67 A;  1NTK K;  3L71 D;  5C39 A;  1JY2 N;  1NU1 D;  1EDK A;  3NTN A;  1FZB B;  3P8C E;  1VDF A;  3VOP A;  1NU1 K;  3AE4 C;  2P1J A;  5H2F E;  5KLV G;  1KB9 H;  4DZO A;  1AVY A;  3H1I E;  1Y47 A;  5CCH D;  2PFX A;  4RES B;  3RBX A;  2P10 A;  3PTZ A;  1NTM E;  3HD7 C;  4NYT A;  2L91 A;  3H1L D;  4H13 B;  4U3F G;  4EOT A;  3TGU D;  1FZF B;  2JJL A;  3NMD A;  2D2C C;  1DIP A;  2YKP A;  1VL2 A;  4GIF A;  4ASW A;  2WMM A;  5B5E H;  1LTJ A;  3QH9 A;  4D6T D;  2KI7 B;  1U7M A;  1DD4 A;  5KLI B;  1SP4 A;  2HG5 D;  2JWD A;  4L76 A;  2N9B A;  3HUS B;  1LTI C;  2JWA A;  1N7S A;  1SLQ A;  5BVZ A;  3CX5 H;  2W6A A;  1FZG B;  2LXC B;  4ZNC A;  1KYO H;  5GTI H;  3TDK A;  5AW5 B;  1SQX D;  5K5G B;  3V6I A;  2BEQ D;  1CW5 A;  1RH5 B;  1BCC J;  2WPQ A;  1SQX K;  2J2P A;  1GW4 A;  1KIL A;  3GF3 A;  2H43 A;  3BVH C;  1L4A C;  3H1K J;  1MUU A;  1OMI A;  2JHI F;  3KYQ A;  1VQ5 P;  2B88 A;  2R3C A;  1DEB A;  3MTU E;  1UIX A;  2KK7 A;  1P84 I;  3Q5S A;  5CCG A;  1VF5 D;  1NTK E;  3VMA A;  4XFJ A;  3L70 E;  4JBZ A;  1N2D C;  3A0B H;  5KAF E;  1IFM A;  2IDB A;  1NU1 E;  2XU6 A;  3TSI A;  2K88 A;  3GLM A;  4IL6 H;  2WWW A;  2R5D A;  2OGU A;  1RF0 C;  1X0T A;  4B86 A;  3AE7 C;  1VQO P;  1J2J B;  1FZC C;  1N73 B;  5GTH E;  2HOD B;  1N7S D;  3M9H A;  3AE2 C;  2KZJ A;  5KAI H;  2J3F A;  3JCU H;  3JSV C;  2Q9I A;  3HTK A;  5APY A;  3TGU E;  2ZFC A;  2ZYD A;  2KZI A;  1LP1 B;  1IFJ A;  1EZV D;  1BGY G;  3WUT A;  3WU2 E;  2OTK E;  3MGN A;  3M0D C;  4JYC A;  1T3J A;  1LTG C;  3WUU A;  1KB9 D;  1LGH B;  2YXQ B;  3U1C A;  3HUS C;  2OYH A;  4KJM A;  4U3F J;  2RKL A;  3MP7 B;  4H0L B;  2WSF J;  3L74 D;  2O1J A;  3L36 A;  5DJT B;  3A2A A;  5KKZ B;  1FZG C;  1GU4 A;  1FZE A;  4ZMD A;  2ZT9 D;  3CL3 D;  2HPC A;  3BRV B;  4GOD A;  3G71 P;  1H8A A;  4M7F A;  4AQR D;  3L71 G;  4N78 D;  2WSF H;  2E74 C;  3LW5 J;  2I1J A;  2IBZ I;  1N86 C;  1PGP A;  1FZA C;  1T2K C;  2R3S A;  1ZR2 A;  4OVN F;  2KXP B;  3V4W A;  3LW5 H;  5TIS H;  5CBO A;  3ABV C;  2QE7 H;  3SFD C;  3E1I C;  3H1L G;  2YO2 A;  4IFF A;  2JP3 A;  3S9O A;  3PHL A;  1Z56 A;  3CX5 D;  1IK9 A;  1Y9B A;  5CCH C;  3C1L A;  1FDI A;  1A02 F;  3B4S A;  3GG2 A;  1J1E B;  2HOD C;  2QJY B;  4D6T G;  3CCQ P;  1Q2N A;  1Q82 Q;  2N1T A;  1H0T A;  3CWB G;  5B66 E; 
#chains in the Genus database with same CATH homology
 3OA7 A;  1SVF A;  1DH3 A;  2BAS A;  2XNX A;  2NPS B;  2HLO B;  3BRT B;  1NOH A;  1L4A D;  1GD2 E;  3M9Q A;  3P8C D;  5CMZ A;  3LID A;  1HWT C;  1GL2 A;  3H32 A;  1KQL A;  5AVQ B;  3CI9 A;  2W27 A;  2WT7 A;  2N1T C;  3TNU A;  1G2C A;  3RL0 D;  1J1D C;  1IFD A;  3P8M C;  5APT A;  1NKN A;  4KHX A;  1EQ7 A;  1IFN A;  3NXS A;  1NTZ K;  3B5N A;  1KIL D;  1L0L K;  2XNX C;  2Q7C A;  1GU5 A;  2Z5H A;  1RE4 A;  3RK3 C;  2CPS A;  3U1A A;  2YNY A;  3CLQ A;  1GL2 C;  1URQ A;  3H32 C;  1NTM K;  1J1D B;  5CJ4 A;  1JNM A;  1HUC A;  4IFD K;  3A5T A;  1NH4 A;  2FXM A;  2R32 A;  5CCG D;  1NHL A;  1S9K D;  2XNX B;  2FFD A;  3B5N C;  3OAK A;  1WT6 A;  1RE4 C;  4WY4 A;  3H32 B;  1ZR4 A;  1JMM A;  1SFC A;  2JHM F;  2CPB A;  1JY3 O;  3V2R A;  2C0X A;  2J0H A;  1LTT C;  1YTZ T;  1URQ C;  3TNU B;  2W6B A;  2Q3I A;  2GY7 A;  2J61 A;  1MV8 A;  5APU A;  5AVV B;  1CI6 B;  4N3Y B;  5KJ7 D;  2I1K A;  4ZFG A;  4AUW A;  1PFI A;  1FJP A;  2J64 A;  4EPU A;  3RK2 C;  3KPE A;  2KB7 P;  5KLV K;  1LTS C;  2M3B A;  3A7O A;  1RE4 B;  4LC1 A;  3VP8 A;  1HTL C;  4O9B A;  2WNP F;  4WY4 C;  1URQ B;  4GT1 A;  4R9J A;  1SFC C;  2YKQ A;  4JYB A;  3VMX A;  4JF7 A;  2J3F D;  2GUS A;  2NPS A;  3IFM A;  2J59 M;  2QM7 A;  1FZB A;  1WRG A;  1X9V A;  3RK2 B;  1FID A;  3V5B A;  4M3L A;  4C46 A;  5AW4 B;  4AYC A;  1NKZ B;  1NAF A;  2KYV A;  3VN0 A;  1SFC B;  5AVT B;  3HE5 B;  1IO4 A;  1N7S C;  5APV A;  2MJZ A;  1KFN A;  2GUV A;  2WZ7 A;  2Q5U A;  1YYC A;  2D39 A;  2WSC H;  1RE3 A;  1G1I A;  3GHG A;  1GTW A;  1CZQ A;  2C9N Y;  2QM8 A;  2NPS C;  1W2E A;  5KTB A;  1H89 A;  5APX A;  1FZB C;  1ZV8 A;  1T2K D;  3BAT A;  1FZF A;  1FOS E;  1JTH B;  1N7S B;  1VPC A;  3P7K A;  3MIW A;  3N7N A;  4HH2 A;  1AQ5 A;  5AW6 B;  3TK1 A;  4JYO X;  1T3U A;  2P67 A;  1NTK K;  1JY2 N;  1RE3 C;  2A45 G;  3HD7 A;  2P7J A;  3GHG C;  3NTN A;  1FZB B;  2PAJ A;  3MD0 A;  1VDF A;  3P8C E;  1SQV K;  4XE5 B;  5AW1 B;  1HJB A;  5AVX B;  3VOP A;  1HVV A;  1NU1 K;  3M9B A;  2POH A;  1RF1 A;  2P1J A;  1JUN A;  4DZO A;  3FIB A;  1SQQ K;  2FIB A;  1FZF C;  4EIJ A;  2E42 A;  2A45 I;  1FU1 A;  2XDJ A;  1CI6 A;  2KP8 A;  5CHX A;  2Z5I A;  5CCH D;  1LTA C;  1N7L A;  1RE3 B;  4RES B;  1FAV A;  2O01 H;  3GHG B;  2XV5 A;  3HD7 C;  4NYT A;  5AVS B;  3SWY A;  1FZD A;  5BU8 B;  4EOT A;  1RF1 C;  1FZF B;  4ZKU A;  2JJL A;  2FYZ A;  4WBA A;  3NMD A;  1CSB A;  1DX7 A;  2YKP A;  1S9K E;  3HD7 B;  4GIF A;  1HGZ A;  1JC9 A;  1XTG B;  4HYT B;  3A3Y B;  3V2Q A;  3VYI A;  4R9T A;  1LTJ A;  4N78 E;  3HE5 A;  1RF1 B;  3V2P A;  1JY2 P;  2FYU K;  2XZR A;  3U59 A;  1L0N K;  2GM4 A;  1SP4 A;  2N1T D;  2HG5 D;  5AVW B;  2IFN A;  3C9I A;  1JCD A;  3VP9 A;  1FIB A;  2OYI A;  2N9B A;  1HGV A;  3HUS B;  1LTI C;  1JY3 N;  1KFM A;  1NO4 A;  2O1K A;  1LT9 A;  1JTH A;  1N7S A;  3IR9 A;  3I5C A;  3BVH A;  1LTJ C;  2ZXE B;  1L4A A;  3RK3 D;  3KDP B;  1HBW A;  3M0A A;  1SLQ A;  4IFM A;  5BVZ A;  3UIA A;  1SQP K;  2W6A A;  1GL2 D;  1FZG B;  3MUD A;  1YTZ I;  5AW5 B;  1CW5 A;  4N6J A;  2WSE H;  4Y99 B;  2OYI C;  2WPQ A;  1SQX K;  2HFE D;  3R2P A;  4I2L C;  2J2P A;  1GW4 A;  2OYH B;  1KIL A;  1LTJ B;  3L4F A;  2H43 A;  1LT9 C;  3B5N D;  3WMM 0;  3T97 A;  3BVH C;  1L4A C;  1M1J A;  1N73 A;  1G1J A;  1MUU A;  1URQ D;  2JHI F;  3KYQ A;  3L35 A;  3M91 A;  2E43 A;  3G3Z A;  1GK6 A;  2R3C A;  1DEB A;  3RL0 C;  1HH0 A;  1RF0 A;  2OYI B;  2JHH C;  3MTU E;  4LLH A;  4OH8 B;  5CCG A;  3V4Q A;  1LT9 B;  3RK2 D;  1ZLL A;  2YKO A;  2J5Z A;  3BVH B;  1KIL C;  1FZC A;  1L4A B;  1N2D C;  2H43 C;  2OAR A;  1IFM A;  2J0Y A;  1M1J C;  1N73 C;  4WY4 D;  1JY3 P;  1SQB K;  2XU6 A;  3EQ2 A;  3TSI A;  1SFC D;  1M7L A;  2WWW A;  3RL0 B;  2R5D A;  1Z3S A;  2YMY A;  1MFZ A;  3B8E B;  1RF0 C;  2WPS A;  5KJ7 A;  3VMZ A;  2J3G A;  4B86 A;  1A02 J;  5CCG C;  2VRS A;  2JHK F;  4JZC A;  1KIL B;  3M0D A;  2H43 B;  5AW3 B;  1LWU C;  1J2J B;  2J58 A;  2JHL F;  1FZC C;  1M1J B;  1N73 B;  2C9L Y;  2HOD B;  2P2U A;  3OJA B;  1N7S D;  1FIC A;  4M7H A;  4W7Z A;  3M9H A;  5CJ0 A;  3BAS A;  3HUS A;  2Z4E A;  5AW7 B;  1FJK A;  1LTB C;  2KLV A;  1RF0 B;  2J3F A;  1KZU B;  2Q9I A;  3HTK A;  4W7Y A;  5APY A;  1JO5 A;  2NPS D;  1OWA A;  3HRN A;  2ZFC A;  5KJ7 C;  1FBM A;  1IFJ A;  3HE4 A;  3KQG A;  2JEE A;  1LWU B;  5AW8 B;  1FZG A;  1FZC B;  3MGN A;  3M0D C;  2R5B A;  4JYC A;  2A45 H;  1T3J A;  5AW2 B;  1LTG C;  1AFO A;  2IX7 C;  4I6M C;  1LGH B;  3L37 A;  3U1C A;  3N4X A;  3TYY A;  2HYN A;  3M06 A;  4DOJ A;  3HUS C;  2J60 A;  2Z4E C;  4C7N A;  2OYH A;  2J0G A;  2WPR A;  2N1T B;  2PP6 A;  1IJD B;  1N86 A;  4I1L A;  2Q9I C;  1FZA A;  2O1J A;  3L36 A;  3A2A A;  3SWF A;  1GK4 A;  1FZG C;  1GU4 A;  4LGD E;  5APS A;  1NWQ A;  1FZE A;  5AVY B;  3CL3 D;  3RK3 B;  2HPC A;  2J3U A;  1IFI A;  3BRV B;  1H8A A;  3P32 A;  5AVZ B;  2Z4E B;  4M7F A;  1FOS F;  1H88 A;  4Y99 C;  1GL2 B;  4AQR D;  3LIE A;  1FDM A;  1X79 B;  2LKM A;  3HTK B;  4N78 D;  2WT7 B;  2Q9I B;  2OYH C;  2WSF H;  3HD7 D;  1G2C B;  2I1J A;  1N86 C;  3HE4 B;  3E1I A;  1QL1 A;  2FKW B;  1X8Y A;  3H6P A;  1FZA C;  1T2K C;  1QL2 A;  1IC2 A;  2IPP A;  1GW3 A;  2H7H A;  3B5N B;  1GZL A;  1FZE C;  3VTP C;  3II6 A;  3PP5 A;  2HPC C;  2FFD C;  4C7R A;  1ZR2 A;  5CCH A;  1T8Z A;  3V4W A;  4C7N B;  2WIT A;  3LW5 H;  3NFQ A;  1N86 B;  4ZKP A;  2XKM A;  2J1G A;  3VMY A;  2HOD A;  2H8P D;  5BU5 A;  1FZA B;  2HLO A;  3E1I C;  1OXZ A;  1J1E C;  4XA4 A;  2L5G B;  2YO3 A;  2YO2 A;  3EFG A;  4IFF A;  1FZE B;  1Z56 A;  2WTY A;  2M8R A;  2HPC B;  5AVU B;  2FFD B;  2IFM A;  1MZ9 A;  1IK9 A;  5AW0 B;  4WY4 B;  5CCH C;  1LWU A;  5APQ A;  5AW9 B;  1A02 F;  3O8Z A;  5APW A;  4W80 A;  2J61 B;  1GDT A;  2KSJ A;  3E1I B;  1J1E B;  1JOC A;  1JCC A;  5AVR B;  2HOD C;  1RY3 A;  3V2N A;  2HLO C;  1ZN5 A;  1JY2 O;  1XTC C;  4WB4 A;  1E5W A;  2N1T A;  1Z3U A;  2C0W A;  2J3O A;  2KOG A;  4GKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...