1FZCB

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
308
structure length
308
Chain Sequence
b'LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 93
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcB02
1N86B 1W2EA 1FZFB 3BVHA 1FZGB 2J3FA 3BVHC 1RF0A 4R9TA 1RF0C 2Q9IA 2OYHC 2Q9IC 2Z4EC 2FIBA 3BVHB 1JY2P 1JY2O 1RF1A 1RF1C 2J61A 1FZBC 1RE3A 1RE3C 2JHHC 2J61B 2A45H 3H32B 1RE3B 2JHLF 1Z3SA 1JY2N 1FIBA 2HODA 1FIDA 2HODC 3GHGA 3GHGC 2OYHA 2Z4EA 1N73A 1N73C 3HUSA 1FZEA 3HUSC 1FZEC 1RF0B 4EPUA 1FZBA 1FICA 1RE4A 3GHGB 1RE4C 2OYHB 2Q9IB 2Z4EB 1N73B 2HLOC 1FZCA 2A45G 1FZCC 2J3FD 1M1JA 1RF1B 3E1IC 1M1JC 1FZEB 2HPCC 2J64A 1FZBB 1RE4B 2H43A 2H43C 1FZCB 1JY3P 1M1JB 1JC9A 1LT9A 1LT9C 1LTJA 1LTJC 3FIBA 2XNXC 2J3GA 2H43B 2OYIA 2OYIC 4ZFGA 1T3UA 2D39A 2JHMF 2OYIB 2HODB 2JHKF 1FZGA 1FZGC 2HLOA 4M7HA 2J5ZA 2J0GA 4JYOX 3E1IA 2GY7A 3HUSB 2J0HA 2HPCA 1FZAA 1FZAC 2JHIF 1FZDA 4M7FA 2WNPF 2HLOB 2J1GA 1JY3O 3E1IB 4R9JA 4JZCA 2HPCB 1FZAB 2XNXA 2J2PA 1LWUA 1LWUC 2J3UA 1LT9B 2A45I 3H32A 2FFDA 1LTJB 2FFDC 3H32C 1Z3UA 2XNXB 1LWUB 1N86A 1FZFA 1N86C 1FZFC 1JY3N 2FFDB 2J0YA 2J60A 2J3OA 4NYTA
chains in the Genus database with same CATH superfamily
1J1EC 1ZMEC 3BVHC 3PLNA 1BE3G 1SQQK 1QLED 2FYUJ 2WT7A 5AVYB 3A2AA 1J2JB 1ZRTD 1EDIA 1K05A 5B66H 2IFMA 2M5AB 1OZHA 1BE3D 5BVZA 1FU1A 3Q1MA 4AQRD 1LJ2A 3AE5C 2G8YA 3L4FA 3TSIA 1BGYE 1HJ0A 2OYHA 2IBZI 2CK3H 1LTIC 3HUSA 3V6IA 1HBWA 3NMDA 1X9VA 4BRYB 3L75E 2WVRA 1JTHA 1NU1J 1E79H 2WPQA 5KLVJ 1M57D 4U7JA 1YQ4C 3IF4A 2NPSD 1CSBA 1L4AB 1OX3A 1KC8Q 1H0TA 4M7FA 2JR8A 1SQPG 4OH8B 1NJIQ 5AW4B 2CPBA 1GU5A 1Z56A 2W27A 1S4XA 2A06E 3L37A 2R5DA 1SQPD 2ZJSE 4DCKA 4N3YB 4TT3H 4RJTA 3V2PA 4YXWH 2OQQA 4PD4E 4PJ0E 4GIFA 2ZFCA 4D6TE 1QVGO 3M9BA 2Q9IA 3CCSP 3AE4C 2ZXEB 2K37A 4OWFA 1LGHB 1PPJG 1XTGB 2RMZA 4JQ0D 2NPSC 3AEAC 3G3ZA 1URQC 1Z3SA 1OVUA 1PPJD 4C7RA 4EYYQ 3S9OA 1N7SA 5AVZB 4B86A 1NTMJ 1FICA 1X22A 1N73B 2A45G 5KAFE 1M1JC 2JEEA 1PP9G 1IK9A 1VQMP 1G1IA 2ZVNB 2E43A 4OGQB 2N9BA 1LTSC 4OGQD 1PP9D 3VYIA 1NTKE 1M7LA 3I56P 1Y9BA 3CCLP 2WPRA 5GTIE 5AVSB 2W6JH 3CWBJ 2KNCB 2QSIA 3EFGA 3L36A 3P7KA 1IFJA 3GLMA 3H1HG 3H1LE 5E79E 1P84D 2KS1A 2PAJA 3A0HE 2FFDA 2W90A 4AUWA 1SQVK 1SQQE 4U3FG 2IPPA 4ZKUA 3H1HD 3CC4P 1U7JA 1EDKA 1W2EA 4ZKPA 1LP1B 4WWIA 2FYNC 2NRGA 4U3FD 2J58A 3KZIH 2FYUG 2XZRA 1CI6A 3P8CE 1LT1A 1EQ7A 4OGQC 3F5HA 3HE5A 2N1TB 5AW0B 1KZUB 2N1TD 2FYUD 1ZLLA 3AEBC 1FZEA 5TISE 3FWNA 3CX5I 1YYCA 1EDLA 1UIIA 2Z4EB 2RH0A 2E42A 1JUNA 3T97B 3ITKA 1RE4B 3CCJP 3BCCE 1FZCB 1QEXA 1FDOA 1NU1G 2H43B 2K3RA 2IBZG 2OYIB 3B71A 2ZXXA 4HJGH 1X8YA 2LKMA 1NU1D 3NXSA 3W67A 1AA0A 1QL1A 1AV1A 1DD4A 2K9JB 1YBKA 4JZCA 1YQ3C 2IBZD 5AW8B 5AVUB 2J59M 2ZT9B 1LT9B 5L8RJ 1SQXK 2N1TC 2ZT9D 3GW6A 1JB0J 1N86C 1XTCC 4EI2A 1Q90D 1AVYA 1R8EA 1LTBC 2J3OA 1R5LA 4XFJA 2QRXA 3BVHA 2J3FA 3AE9C 2KP8A 2Z4EC 2LXBA 5CBNA 3A5TA 5DJUB 4K35A 2PGDA 1JMMA 1FOSF 4DOJA 1GMJA 4KJMA 2WSEJ 2IYPA 3V2NA 2OTJP 1RE3B 1BE3J 3OAKA 3KXDA 1S72P 3L73G 3TYYA 3AE7C 1USEA 4UB8H 3H1IG 2JWAA 1IZNB 1E5WA 3L70G 2BEQD 3GHGB 2IYOA 2QJPC 1GDTA 1NTMG 1MFZA 1NAFA 1FZBB 3H1ID 1VL2A 1KMIZ 2ZT9C 1JC9A 4DJGA 3VP8A 1LT9C 3L70D 2R32A 4DT0A 3M06A 1IC2A 5APXA 2B87A 3SWYA 1NTMD 4GOFA 5AW5B 1X0TA 2H88C 5APUA 3BRVB 1VQ5P 3SWKA 1KQSO 2GUSA 2HODB 2QE7H 2HLOA 2ZAEB 1SFCB 2KZIA 1FE6A 2JHIF 3CWBG 3GF3A 1VQ8P 1SFCD 2YKOA 1SQVE 1K9MQ 2HR3A 2Y0EA 2AEMA 3CCUP 3CWBD 4GODA 3VN0A 1SQBJ 2J60A 3H25A 2IZ1A 1NKNA 5AW6B 3Q5RA 1YJNP 1NTZJ 2JWDA 2V7QJ 2POHA 1FZBC 3S4RA 5CMZA 3HTKB 1PGJA 4MN4C 2ITAA 3H32B 1YJ9P 1PP9E 2NPSA 1URQA 3PP5A 5B5EH 2HODC 1SFCC 2QJKC 2H8PD 2Z5HA 3C1LA 1YHQP 1JMBA 1K8AQ 1AVOA 3HD7B 1M1JA 1YTZT 3ZDMA 4C7NA 5AVQB 2Q3EA 2DW3A 1SVFA 2J3GA 1EZVE 3E1RA 3L71E 3B5NC 1OFCX 1GL2D 3FXDA 2E5TA 1L0NK 1S5LX 3S1KA 3M0DC 5GTIH 3E1IA 2AXTH 1GW4A 1GZLA 3CMEP 1OVVA 3UIAA 1NHLA 4IOIH 2O01J 4L74A 5E79H 3JSVC 4YXDC 4Z1MH 3CX5D 3Q2YA 4WY4A 3H32C 1Z3UA 3I5CA 2FYUE 2RKLA 3CPWO 2L91A 3P32A 3TNUA 3CXHI 3H1HJ 1FZGB 3VMAA 1NAYA 1JY2P 1HWTC 4IFDK 4U3FJ 1G2CA 3H1JJ 3KHUA 2E74B 2J61B 2P67A 1GL2C 1QX8A 3SFEC 1QVFO 1MUUA 2E74D 1IJDB 1FIBA 2P7JA 4H13B 5TISH 5TJHA 4KT0J 1RF0B 4W7YA 5KLVE 1RQVA 2KIKA 4M3LA 2Q6QA 3H1KG 4H13D 2KZJA 3IR9A 2P2UA 2GUVA 2K9YA 2WMMA 4UB8E 3H1KD 3AEEC 1L0LJ 2P10A 1TU3F 5CCHD 1VQNP 2BCCG 1FZGC 4M7HA 1Q2NA 1LP1A 2UWJE 3KDPB 2KSEA 2W83C 1KILB 2J1GA 2FKWB 2HPCB 1FZAB 4ASVA 2KSJA 1KILD 2BCCD 2QJYB 4JYBA 1PL5A 2XNXA 3CC2P 2M3BA 3EWKA 1QGKB 3SFDC 2GA1A 1N86A 3AE1C 1MZ9A 3TGUJ 5AVWB 1VQ7P 3Q3DA 3N7NA 2M8RA 3EQ2A 2W8ZA 1SQBG 3LW5J 1L4AD 3JCUE 1R5SA 4R9TA 1RF0C 1JCCA 1T8ZA 2FIBA 3L72G 1NTZG 1EC5A 3OW2O 1MV8A 3HE4B 1JM0A 1SQBD 2Y0DA 5APSA 3V2QA 2WPVB 4NPEA 5CCHC 5BU5A 3O8ZA 1IO4A 3L72D 1M1KQ 1NTZD 2BASA 3A7OA 2WPSA 1ZXGA 1FIDA 2XDJA 5BU8B 3L75J 1KN7A 1U57A 1DIPA 1KILC 2W6BA 1Q86Q 1HGZA 3VMZA 2K9JA 2K1AA 2MKVA 1Q7YQ 2HPCC 1YTZI 3GMAA 2QJYC 1UIXA 4HB1A 2ZYDA 5AVTB 3L73J 1L0NE 3CWBE 3H1IJ 1LT9A 3OA7A 4W7ZA 5B5EE 5CBOA 3L70J 3MIWA 2O01N 1KYOD 1HH0A 4BWNA 2P58A 1L4AC 4PD4I 3RL0B 2D39A 2V7QH 1KQGB 3RL0D 5AVXB 2B9BA 3FWLA 2YO2A 2LR2A 1T3JA 3MTUE 1HVVA 4IL6E 3BRTB 4R4LA 1Y8AA 2YKPA 1S9KD 5AW3B 5KKZB 3RK2B 2XU6A 3CCQP 5GTHH 1Q82Q 2AXCA 1FOSE 1SQPK 3PRJA 1LWUB 1KB9D 3RK2D 2JDIH 2AXTE 1KQLA 2J0YA 1FZFB 3U59A 2YXQB 1LTAC 2G3AA 4EOTA 4I1LA 4UB6H 3RK3B 1KFNA 1LNQA 2XKMA 2J5UA 3A3YB 2WT7B 4O9BA 2A45H 3RK3D 4AYCA 3H1JG 2WSFH 4ZNCA 1VF5B 2KLVA 1DD3A 3RL0C 1VF5D 2YXRB 2KXPB 2C0XA 2HODA 1N73C 1SFCA 3NFQA 2O01H 3C8VA 3H1JD 2OYHB 1P84H 1RF1B 2PP6A 3CXHD 1SQXG 4Y28J 1CW5A 3RK2C 1NTKJ 2Z5IA 1YI2P 3WUUA 3B5NA 1JTHB 4LC1A 3MGNA 2B88A 1SQXD 2Q7CA 3TDKA 4GOEA 3M0DA 1L0LG 1T2KD 3IFMA 3V2RA 1PIXA 3H1LJ 2WSCJ 3MZWB 1FZDA 2W6AA 1VQPP 1VQ6P 3W68A 1X79B 1H0TB 3HTKA 3RK3C 2D2CB 3PH0A 1L0LD 1G1JA 2YMKA 3RBXA 2JKVA 3H32A 5KAIE 1LTJB 1VF5C 3FXEA 1U7MA 3TGUG 3L74J 1ZRTE 2OYHC 2YIUB 2O1JA 1BE3E 1RF1C 1LTGC 3HRNA 3MUDC 5APTA 2HYNA 3Q5SA 2YNYA 1DX7A 3TGUD 3L35A 1GL2A 2P1JA 3CCEP 3O6QA 1PV3A 2PRRA 1T2KC 1FDMA 3KPEA 2FYUK 5CJ0A 3IN6A 3AECC 5APYA 1RE4C 3L75G 3G4SP 1JO5A 1FZCC 3B4SA 5C39A 1N8RQ 4IFFA 2H43C 3LIEA 1IFPA 1LTJC 1PFIA 1NVOA 2WWWA 3L75D 2OARA 2OYIC 1S1CX 1Q81Q 1WRGA 3H1KJ 3MD0A 2YMYA 1GTWA 1T3UA 4CPGA 3CCVP 1FZGA 2GY7A 1OIPA 2E5YA 3L73D 1NU1K 3G6EP 2YIUC 4XE5B 1JY3O 1SQPE 1MFTA 1SQBE 3ABVC 1EXJA 2L5GB 5KLVK 1ZW0A 3CCMP 3CD6P 2A06G 2BCCJ 2K88A 1KFMA 1NTZE 2FFDB 2QIWA 3VMXA 1EDJA 5H2FE 1J1DB 1BCCJ 2A06D 2WITA 4D6TG 1KD1Q 1RF0A 1FDIA 2FXOA 3JCUH 1OWAA 1MKMA 5M1BA 4PD4D 4A7PA 2M5AA 1SS1A 3BATA 1M56D 5GTHE 1AJYA 4D6TD 1RE3C 1PPJE 1OMIA 1KYOE 5CCHA 4HYTB 3TF5A 3G9RA 3L72J 2KB7P 5CCGD 3GHGC 1A02J 1IFIA 4BRYA 2Q1KA 4UB6E 3C9IA 1M8OB 1KILA 1FZEB 2IZ0A 4I7ZB 1RY3A 4N6JA 1KB9E 1RQUA 1NTKG 4JBZA 1L4AA 1NTMK 1IFMA 1J1DC 2JHMF 4GKGA 1SQVJ 1P84E 1FAVA 3KQGA 2ZYGA 1NTKD 3HD7D 3H1LG 4IL6H 2SPZA 1AQTA 3RK3E 3H1HE 2J2PA 2XV5A 5EFWB 2A45I 2OGUA 1SQQG 5CCGC 3H1LD 4L73A 1JY3N 3H6PA 2Y0CA 4U3FE 3H1JE 3VTPC 1S2EA 3WU2E 4W80A 1DH3A 1SQQD 4DZOA 1J1EB 3L74G 3BVHB 2AEFA 1AFOA 3LIDA 2E76B 1NOHA 4RKUJ 1EZVI 3L74D 2KLUA 2E76D 3R4YA 1ZR4A 1FJPA 1YIJP 2KYVA 1N73A 3IAOA 3WUVA 3HD7C 2O1KA 1IFNA 2C9LY 1A02F 1L0LE 3D6YA 3CX5H 2WQYC 2I1JA 3BCCG 1JY3P 1HGVA 1NU1E 4L76A 2KNCA 1JOCA 2OTKE 4BXLA 3U1CA 1KTMA 3BCCD 1GK4A 1SQXJ 1ZP0C 4KHXA 2IBZE 2J5ZA 1RHZB 2ZVOB 1GD2E 4EIJA 4YTPC 2HLOB 5AVVB 3CC7P 3TGUE 1L2PA 4NPDA 1GW3A 2E76C 5CHXA 5KAIH 1ZV8A 4K3AA 2JJLA 2KI7B 3BASA 1ZN5A 1T6AA 4ZMDA 1VPCA 3E7KA 2WSEH 1BCCG 4JF7A 1RF1A 1QL2A 3MUDA 2E74C 3AE3C 3A0BE 2Y9YA 1AQ5A 2N1TA 1NYHA 2JHHC 2C9NY 2FXPA 3F89A 1BCCD 3TK1A 3G71P 4GDOA 1ZR2A 2I1KA 4H13C 2NPSB 3L73E 2Z4EA 1URQB 3H1IE 4GT1A 3MHVA 3T97A 4L75A 2I8DA 1RE4A 3L70E 1URQD 4R4MA 2HLOC 1FZCA 2XNDH 1KORA 3CI9A 2R44A 5AW7B 3K5BA 1NTME 1BGYJ 5APVA 2H43A 1LTTC 1M1JB 4EDFA 1LTJA 4C7NB 2OYIA 1OW7A 5AVRB 2H89C 2BEZF 3N4XA 1IK7A 2YO3A 1S5LE 2J0GA 4JYOX 3VP9A 2C0WA 2J0HA 1FZAC 4WVZA 1SQVG 3GG2A 3E1IB 4YPCA 1S3JA 2V4HA 2H7HA 3SWFA 2ZYAA 4N78D 4HH2A 1SQVD 2RN0A 4WY4B 5H2FH 4I2LC 1W2BO 1N2DC 1VQKP 4WY4D 1HUCA 3TNUB 3M0AA 4IFMA 3M9HA 4JPZB 5KJ7D 1JEKA 4JYCA 2FYNB 3FX0A 1RE3A 1SQBK 4D6TJ 2QG4A 1KYOH 1M90Q 1G2CB 4RESB 1W5CE 2R3CA 1HF9A 1NTZK 1H88A 4WB4A 3GHGA 1WMKA 3RL0g 4EPUA 1FZBA 1L0NJ 3CLQA 3E1IC 1Y47A 2FYZA 1RH5B 1EZVG 3L71G 4I6MC 1KB9H 3GF7A 3OJAB 1DEEG 4WY4C 3AEGC 2E75B 1EZVD 3L71D 5KJ7C 3HUSB 2QA4P 3CX5E 3V5BA 2M3EA 2WNPF 5AW1B 2E75D 1FC2C 5KKZC 2FY8A 3L74E 1LWUC 2XNXB 5CCGA 1FZFC 3RGUA 2R5BA 2Q3IA 3U1AA 2VRSA 3RBZA 4NYTA 1N86B 3WU2H 1OXZA 4XA4A 3CXHH 1SQQJ 2Y9ZA 2HG5D 2D2CD 5B66E 1IFDA 3PHLA 3AEDC 1N7LA 1YITP 1BSNA 1DEBA 3NTNA 2E75C 3HD7A 5KLVG 3HUSC 3EFFK 3VOPA 2Q9IB 3H1KE 4LGDE 1GK6A 3SSUA 5KTBA 2QJPB 3WUTA 2QM8A 5KLVD 3PJSK 1BGYG 3FIBA 2XNXC 1SP4A 4ZFGA 5K5GB 1NWQA 3BCCJ 1KILE 2BCCE 2HFED 1N7SB 5KLIB 2GM4A 1BGYD 2WZ7A 2D2CC 1WT6A 2NZ2A 1SLQA 1N7SD 3AE6C 2LXCB 1BCCE 1NKZB 2IDBA 2KK7A 1L0LK 2M0BA 3LW5H 1HJBA 4WBAA 3B8EB 1NO4A 4C46A 1NH4A 1PGPA 2KOGA 1PGQA 4NPFX 2OTLP 4LLHA 1PGOA 1ZOYC 2FXMA 3II6A 2Q9IC 3CL3D 1JY2O 3CCRP 2J61A 3L72E 3A0BH 2JP3A 2KS1B 4Y99B 1JNMA 1BDDA 2IX7C 1OW6A 1OW8A 2YKQA 1N7SC 5KLIC 4H44B 2OYOA 4H0LB 3VMYA 2B89A 2QJKB 2KUBA 4H44D 1D7MA 1JCDA 4H0LD 1NGMB 1L0NG 1VDFA 3QWOC 1CI6B 4N78E 4HKZH 1EXIA 3HE5B 2MJZA 2FBWC 3USSA 3M9QA 1L0ND 3B5NB 1FBMA 4OVNF 2JHKF 1SQPJ 1S5LH 1S9KE 4PD4H 4PJ0H 3PTZA 3AEFC 2HPCA 1FZAA 3B5ND 3MP7B 4R9JA 4Y99C 3V4QA 1VQ4P 2J3UA 3AE2C 3P8MC 3WMM0 1KYOI 2IFNA 2FFDC 4QMAA 2QVAA 5AW2B 1HTLC 1K73Q 1FS0E 3D6ZA 4H44C 1FJKA 4H0LC 5CJ4A 1YJWP 3HE4A 1VQ9P 2WTYA 1VQOP 4PV1B 3KZIE 3M91A 1VQLP 4PV1D 3JC22 5KAFH 1H8AA 1CZQA 1KB9I 1BDCA 2CPSA 1USDA 2R3SA 3CMAP 2JHLF 1JY2N 4RO0A 2WSSH 1GL2B 3R2PA 3CXHE 1BSHA 1OVRA 3O6QB 2N9YB 1P84I 1FZEC 3Q5PA 2WSFJ 1PP9J 4TLFA 2PFXA 3FGAD 4I7ZC 2J3FD 2O3JA 3V4WA 2J64A 4ASWA 1SQXE 5DJTB 1PZQA 2WSCH 1KQFB 3KYQA 3P8CD 1KV4A 3D70A 3D71A 3A0HH 1K04A 2QM7A 5KJ7A 5AW9B 3I55P 3L71J 2Q5UA 4IL6X 4PV1C 5APWA 1NTKK 1GU4A 3QH9A 3AE8C 1LWUA 2QEXP 5APQA 2AEJA 1FZFA 2B87B 2JO1A 1H89A
chains in the Genus database with same CATH topology
1J1EC 1NKNA 5AW6B 3BVHC 4WY4D 1HUCA 3TNUB 1SQQK 2OYHC 3M0AA 4IFMA 2O1JA 3M9HA 1RF1C 5KJ7D 1LTGC 2POHA 3HRNA 2WT7A 5APTA 4JYCA 2HYNA 5AVYB 3A2AA 1FZBC 1J2JB 5CMZA 3HTKB 1RE3A 2YNYA 1DX7A 2IFMA 1SQBK 3L35A 1GL2A 3H32B 1G2CB 2P1JA 2NPSA 4RESB 5BVZA 1FU1A 2R3CA 1URQA 3PP5A 4AQRD 1T2KC 1NTZK 1H88A 3L4FA 4WB4A 1FDMA 3TSIA 3KPEA 2HODC 3GHGA 2FYUK 2OYHA 1SFCC 5CJ0A 1LTIC 3HUSA 4EPUA 2H8PD 2Z5HA 1HBWA 1FZBA 5APYA 3NMDA 1RE4C 3CLQA 1X9VA 1JO5A 1FZCC 3HD7B 1M1JA 3E1IC 2FYZA 4IFFA 1YTZT 4C7NA 1JTHA 2H43C 5AVQB 3LIEA 4I6MC 1LTJC 1PFIA 1SVFA 2WPQA 2WWWA 2J3GA 2OARA 3B5NC 2OYIC 3OJAB 1WRGA 4WY4C 1GL2D 3MD0A 2YMYA 1L0NK 1GTWA 1T3UA 2NPSD 1FZGA 3M0DC 1CSBA 3E1IA 1L4AB 5KJ7C 2GY7A 1GW4A 3HUSB 1GZLA 3V5BA 1NU1K 3UIAA 4M7FA 1NHLA 2WNPF 4OH8B 5AW1B 4XE5B 1JY3O 5AW4B 2L5GB 5KLVK 2CPBA 1GU5A 1Z56A 1LWUC 2W27A 4WY4A 3H32C 1KFMA 3L37A 1Z3UA 3I5CA 2R5DA 2XNXB 5CCGA 4N3YB 1FZFC 3P32A 3V2PA 2FFDB 3VMXA 2R5BA 2Q3IA 3TNUA 3U1AA 2VRSA 1J1DB 4NYTA 2WITA 1N86B 4GIFA 2ZFCA 1FZGB 1RF0A 1OWAA 1OXZA 4XA4A 3M9BA 2Q9IA 1JY2P 1HWTC 2ZXEB 3BATA 4IFDK 2HG5D 1LGHB 1XTGB 1G2CA 1IFDA 1RE3C 2J61B 2P67A 1N7LA 1GL2C 5CCHA 2NPSC 4HYTB 1MUUA 3G3ZA 1URQC 1Z3SA 1IJDB 1FIBA 1DEBA 4C7RA 2KB7P 3NTNA 5CCGD 3GHGC 1A02J 1IFIA 3HD7A 1N7SA 2P7JA 3HUSC 5AVZB 4B86A 1RF0B 3C9IA 4W7YA 1KILA 3VOPA 1FICA 2Q9IB 4M3LA 1N73B 2A45G 1M1JC 2JEEA 1FZEB 1IK9A 4LGDE 1GK6A 1G1IA 5KTBA 3IR9A 2E43A 2QM8A 1RY3A 2P2UA 2GUVA 4N6JA 3FIBA 2XNXC 1SP4A 2N9BA 1LTSC 4ZFGA 1L4AA 3VYIA 1NTMK 5CCHD 1IFMA 1M7LA 1NWQA 1J1DC 2JHMF 2WPRA 1FZGC 4GKGA 5AVSB 4M7HA 2HFED 3EFGA 1N7SB 2GM4A 3KDPB 1FAVA 3L36A 2WZ7A 3KQGA 1KILB 1WT6A 3P7KA 1IFJA 2J1GA 3HD7D 1SLQA 1N7SD 2FKWB 2HPCB 1FZAB 2KSJA 1KILD 4JYBA 2XNXA 2J2PA 2M3BA 2PAJA 1NKZB 2XV5A 1L0LK 3LW5H 2A45I 2FFDA 1HJBA 4AUWA 4WBAA 3B8EB 1NO4A 5CCGC 4C46A 1SQVK 1N86A 2IPPA 4ZKUA 1JY3N 1MZ9A 1NH4A 5AVWB 3H6PA 3N7NA 2KOGA 2M8RA 3EQ2A 4LLHA 2FXMA 1W2EA 3VTPC 4ZKPA 1L4AD 4W80A 4R9TA 1RF0C 3II6A 1DH3A 1JCCA 4DZOA 2Q9IC 3CL3D 1J1EB 1T8ZA 2FIBA 3BVHB 1JY2O 2J61A 2J58A 1MV8A 2XZRA 3HE4B 1AFOA 1CI6A 3LIDA 3P8CE 4Y99B 1EQ7A 5APSA 1JNMA 1NOHA 3V2QA 3HE5A 5CCHC 1IO4A 2IX7C 3O8ZA 2N1TB 5BU5A 5AW0B 1ZR4A 1FJPA 1KZUB 2BASA 3A7OA 2N1TD 2WPSA 2KYVA 2YKQA 1FIDA 1N73A 2XDJA 5BU8B 1ZLLA 3HD7C 1FZEA 1N7SC 2O1KA 1IFNA 1KILC 2W6BA 1YYCA 1HGZA 2Z4EB 3VMZA 2C9LY 1A02F 3VMYA 2E42A 1JCDA 1JUNA 2HPCC 1YTZI 2I1JA 1VDFA 1RE4B 5AVTB 1JY3P 1FZCB 1CI6B 4N78E 1HGVA 1LT9A 3OA7A 4W7ZA 3HE5B 2H43B 2MJZA 3MIWA 1HH0A 3M9QA 1JOCA 3U1CA 1L4AC 3RL0B 1GK4A 3B5NB 2D39A 4KHXA 1FBMA 2OYIB 2JHKF 2J5ZA 1X8YA 1S9KE 3RL0D 5AVXB 2LKMA 2HPCA 1FZAA 3B5ND 3NXSA 1GD2E 4EIJA 1QL1A 2YO2A 1T3JA 2HLOB 3MTUE 1HVVA 5AVVB 4R9JA 4JZCA 3BRTB 5AW8B 2YKPA 1S9KD 5AW3B 4Y99C 2J59M 5AVUB 3V4QA 1GW3A 2J3UA 3P8MC 1LT9B 5CHXA 3RK2B 2XU6A 3WMM0 2IFNA 2FFDC 1SQXK 1ZV8A 1FOSE 2N1TC 1SQPK 1LWUB 1N86C 1XTCC 3RK2D 5AW2B 1HTLC 2JJLA 1KQLA 2J0YA 3BASA 1ZN5A 1LTBC 2J3OA 1FZFB 1VPCA 3BVHA 2J3FA 3U59A 1FJKA 2WSEH 2KP8A 5CJ4A 4JF7A 2Z4EC 3HE4A 2WTYA 3A5TA 1RF1A 1LTAC 4EOTA 1QL2A 3MUDA 4I1LA 3RK3B 1AQ5A 3M91A 1JMMA 1KFNA 2N1TA 1FOSF 4DOJA 2XKMA 1H8AA 2JHHC 3A3YB 2WT7B 2C9NY 4O9BA 2A45H 3RK3D 1CZQA 4AYCA 3TK1A 3V2NA 2WSFH 1RE3B 2KLVA 2CPSA 2JHLF 1ZR2A 1JY2N 2I1KA 3OAKA 1GL2B 3RL0C 3TYYA 3R2PA 2NPSB 2C0XA 2HODA 2Z4EA 1E5WA 1URQB 1N73C 1SFCA 4GT1A 3NFQA 1FZEC 3T97A 2O01H 1RE4A 3GHGB 2OYHB 1URQD 2HLOC 1FZCA 2J3FD 1RF1B 3CI9A 1GDTA 2PP6A 3V4WA 2J64A 1MFZA 5AW7B 1NAFA 1FZBB 5APVA 2H43A 1LTTC 1CW5A 1M1JB 1JC9A 3VP8A 1LT9C 1LTJA 3RK2C 2WSCH 2Z5IA 2R32A 3KYQA 3M06A 3B5NA 1JTHB 3P8CD 1IC2A 4LC1A 4C7NB 2OYIA 3MGNA 5APXA 3SWYA 2Q7CA 5AW5B 5APUA 3BRVB 5AVRB 3N4XA 2GUSA 2HODB 2YO3A 3M0DA 2HLOA 3IFMA 1SFCB 2QM7A 5KJ7A 5AW9B 3V2RA 3VP9A 1T2KD 2J0GA 4JYOX 2C0WA 2J0HA 1FZAC 2JHIF 1FZDA 2W6AA 2Q5UA 1SFCD 2YKOA 5APWA 3E1IB 1NTKK 1X79B 3HTKA 3RK3C 1GU4A 1G1JA 1LWUA 3H32A 1LTJB 5APQA 2H7HA 3SWFA 4N78D 4HH2A 3VN0A 1FZFA 4WY4B 1H89A 2J60A 4I2LC 1N2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 B;  1W2E A;  1FZF B;  3BVH A;  1FZG B;  2J3F A;  3BVH C;  1RF0 A;  4R9T A;  1RF0 C;  2Q9I A;  2OYH C;  2Q9I C;  2Z4E C;  2FIB A;  3BVH B;  1JY2 P;  1JY2 O;  1RF1 A;  1RF1 C;  2J61 A;  1FZB C;  1RE3 A;  1RE3 C;  2JHH C;  2J61 B;  2A45 H;  3H32 B;  1RE3 B;  2JHL F;  1Z3S A;  1JY2 N;  1FIB A;  2HOD A;  1FID A;  2HOD C;  3GHG A;  3GHG C;  2OYH A;  2Z4E A;  1N73 A;  1N73 C;  3HUS A;  1FZE A;  3HUS C;  1FZE C;  1RF0 B;  4EPU A;  1FZB A;  1FIC A;  1RE4 A;  3GHG B;  1RE4 C;  2OYH B;  2Q9I B;  2Z4E B;  1N73 B;  2HLO C;  1FZC A;  2A45 G;  1FZC C;  2J3F D;  1M1J A;  1RF1 B;  3E1I C;  1M1J C;  1FZE B;  2HPC C;  2J64 A;  1FZB B;  1RE4 B;  2H43 A;  2H43 C;  1FZC B;  1JY3 P;  1M1J B;  1JC9 A;  1LT9 A;  1LT9 C;  1LTJ A;  1LTJ C;  3FIB A;  2XNX C;  2J3G A;  2H43 B;  2OYI A;  2OYI C;  4ZFG A;  1T3U A;  2D39 A;  2JHM F;  2OYI B;  2HOD B;  2JHK F;  1FZG A;  1FZG C;  2HLO A;  4M7H A;  2J5Z A;  2J0G A;  4JYO X;  3E1I A;  2GY7 A;  3HUS B;  2J0H A;  2HPC A;  1FZA A;  1FZA C;  2JHI F;  1FZD A;  4M7F A;  2WNP F;  2HLO B;  2J1G A;  1JY3 O;  3E1I B;  4R9J A;  4JZC A;  2HPC B;  1FZA B;  2XNX A;  2J2P A;  1LWU A;  1LWU C;  2J3U A;  1LT9 B;  2A45 I;  3H32 A;  2FFD A;  1LTJ B;  2FFD C;  3H32 C;  1Z3U A;  2XNX B;  1LWU B;  1N86 A;  1FZF A;  1N86 C;  1FZF C;  1JY3 N;  2FFD B;  2J0Y A;  2J60 A;  2J3O A;  4NYT A; 
#chains in the Genus database with same CATH topology
 1J1E C;  1ZME C;  3BVH C;  3PLN A;  1BE3 G;  1SQQ K;  1QLE D;  2FYU J;  2WT7 A;  5AVY B;  3A2A A;  1J2J B;  1ZRT D;  1EDI A;  1K05 A;  5B66 H;  2IFM A;  2M5A B;  1OZH A;  1BE3 D;  5BVZ A;  1FU1 A;  3Q1M A;  4AQR D;  1LJ2 A;  3AE5 C;  2G8Y A;  3L4F A;  3TSI A;  1BGY E;  1HJ0 A;  2OYH A;  2IBZ I;  2CK3 H;  1LTI C;  3HUS A;  3V6I A;  1HBW A;  3NMD A;  1X9V A;  4BRY B;  3L75 E;  2WVR A;  1JTH A;  1NU1 J;  1E79 H;  2WPQ A;  5KLV J;  1M57 D;  4U7J A;  1YQ4 C;  3IF4 A;  2NPS D;  1CSB A;  1L4A B;  1OX3 A;  1KC8 Q;  1H0T A;  4M7F A;  2JR8 A;  1SQP G;  4OH8 B;  1NJI Q;  5AW4 B;  2CPB A;  1GU5 A;  1Z56 A;  2W27 A;  1S4X A;  2A06 E;  3L37 A;  2R5D A;  1SQP D;  2ZJS E;  4DCK A;  4N3Y B;  4TT3 H;  4RJT A;  3V2P A;  4YXW H;  2OQQ A;  4PD4 E;  4PJ0 E;  4GIF A;  2ZFC A;  4D6T E;  1QVG O;  3M9B A;  2Q9I A;  3CCS P;  3AE4 C;  2ZXE B;  2K37 A;  4OWF A;  1LGH B;  1PPJ G;  1XTG B;  2RMZ A;  4JQ0 D;  2NPS C;  3AEA C;  3G3Z A;  1URQ C;  1Z3S A;  1OVU A;  1PPJ D;  4C7R A;  4EYY Q;  3S9O A;  1N7S A;  5AVZ B;  4B86 A;  1NTM J;  1FIC A;  1X22 A;  1N73 B;  2A45 G;  5KAF E;  1M1J C;  2JEE A;  1PP9 G;  1IK9 A;  1VQM P;  1G1I A;  2ZVN B;  2E43 A;  4OGQ B;  2N9B A;  1LTS C;  4OGQ D;  1PP9 D;  3VYI A;  1NTK E;  1M7L A;  3I56 P;  1Y9B A;  3CCL P;  2WPR A;  5GTI E;  5AVS B;  2W6J H;  3CWB J;  2KNC B;  2QSI A;  3EFG A;  3L36 A;  3P7K A;  1IFJ A;  3GLM A;  3H1H G;  3H1L E;  5E79 E;  1P84 D;  2KS1 A;  2PAJ A;  3A0H E;  2FFD A;  2W90 A;  4AUW A;  1SQV K;  1SQQ E;  4U3F G;  2IPP A;  4ZKU A;  3H1H D;  3CC4 P;  1U7J A;  1EDK A;  1W2E A;  4ZKP A;  1LP1 B;  4WWI A;  2FYN C;  2NRG A;  4U3F D;  2J58 A;  3KZI H;  2FYU G;  2XZR A;  1CI6 A;  3P8C E;  1LT1 A;  1EQ7 A;  4OGQ C;  3F5H A;  3HE5 A;  2N1T B;  5AW0 B;  1KZU B;  2N1T D;  2FYU D;  1ZLL A;  3AEB C;  1FZE A;  5TIS E;  3FWN A;  3CX5 I;  1YYC A;  1EDL A;  1UII A;  2Z4E B;  2RH0 A;  2E42 A;  1JUN A;  3T97 B;  3ITK A;  1RE4 B;  3CCJ P;  3BCC E;  1FZC B;  1QEX A;  1FDO A;  1NU1 G;  2H43 B;  2K3R A;  2IBZ G;  2OYI B;  3B71 A;  2ZXX A;  4HJG H;  1X8Y A;  2LKM A;  1NU1 D;  3NXS A;  3W67 A;  1AA0 A;  1QL1 A;  1AV1 A;  1DD4 A;  2K9J B;  1YBK A;  4JZC A;  1YQ3 C;  2IBZ D;  5AW8 B;  5AVU B;  2J59 M;  2ZT9 B;  1LT9 B;  5L8R J;  1SQX K;  2N1T C;  2ZT9 D;  3GW6 A;  1JB0 J;  1N86 C;  1XTC C;  4EI2 A;  1Q90 D;  1AVY A;  1R8E A;  1LTB C;  2J3O A;  1R5L A;  4XFJ A;  2QRX A;  3BVH A;  2J3F A;  3AE9 C;  2KP8 A;  2Z4E C;  2LXB A;  5CBN A;  3A5T A;  5DJU B;  4K35 A;  2PGD A;  1JMM A;  1FOS F;  4DOJ A;  1GMJ A;  4KJM A;  2WSE J;  2IYP A;  3V2N A;  2OTJ P;  1RE3 B;  1BE3 J;  3OAK A;  3KXD A;  1S72 P;  3L73 G;  3TYY A;  3AE7 C;  1USE A;  4UB8 H;  3H1I G;  2JWA A;  1IZN B;  1E5W A;  3L70 G;  2BEQ D;  3GHG B;  2IYO A;  2QJP C;  1GDT A;  1NTM G;  1MFZ A;  1NAF A;  1FZB B;  3H1I D;  1VL2 A;  1KMI Z;  2ZT9 C;  1JC9 A;  4DJG A;  3VP8 A;  1LT9 C;  3L70 D;  2R32 A;  4DT0 A;  3M06 A;  1IC2 A;  5APX A;  2B87 A;  3SWY A;  1NTM D;  4GOF A;  5AW5 B;  1X0T A;  2H88 C;  5APU A;  3BRV B;  1VQ5 P;  3SWK A;  1KQS O;  2GUS A;  2HOD B;  2QE7 H;  2HLO A;  2ZAE B;  1SFC B;  2KZI A;  1FE6 A;  2JHI F;  3CWB G;  3GF3 A;  1VQ8 P;  1SFC D;  2YKO A;  1SQV E;  1K9M Q;  2HR3 A;  2Y0E A;  2AEM A;  3CCU P;  3CWB D;  4GOD A;  3VN0 A;  1SQB J;  2J60 A;  3H25 A;  2IZ1 A;  1NKN A;  5AW6 B;  3Q5R A;  1YJN P;  1NTZ J;  2JWD A;  2V7Q J;  2POH A;  1FZB C;  3S4R A;  5CMZ A;  3HTK B;  1PGJ A;  4MN4 C;  2ITA A;  3H32 B;  1YJ9 P;  1PP9 E;  2NPS A;  1URQ A;  3PP5 A;  5B5E H;  2HOD C;  1SFC C;  2QJK C;  2H8P D;  2Z5H A;  3C1L A;  1YHQ P;  1JMB A;  1K8A Q;  1AVO A;  3HD7 B;  1M1J A;  1YTZ T;  3ZDM A;  4C7N A;  5AVQ B;  2Q3E A;  2DW3 A;  1SVF A;  2J3G A;  1EZV E;  3E1R A;  3L71 E;  3B5N C;  1OFC X;  1GL2 D;  3FXD A;  2E5T A;  1L0N K;  1S5L X;  3S1K A;  3M0D C;  5GTI H;  3E1I A;  2AXT H;  1GW4 A;  1GZL A;  3CME P;  1OVV A;  3UIA A;  1NHL A;  4IOI H;  2O01 J;  4L74 A;  5E79 H;  3JSV C;  4YXD C;  4Z1M H;  3CX5 D;  3Q2Y A;  4WY4 A;  3H32 C;  1Z3U A;  3I5C A;  2FYU E;  2RKL A;  3CPW O;  2L91 A;  3P32 A;  3TNU A;  3CXH I;  3H1H J;  1FZG B;  3VMA A;  1NAY A;  1JY2 P;  1HWT C;  4IFD K;  4U3F J;  1G2C A;  3H1J J;  3KHU A;  2E74 B;  2J61 B;  2P67 A;  1GL2 C;  1QX8 A;  3SFE C;  1QVF O;  1MUU A;  2E74 D;  1IJD B;  1FIB A;  2P7J A;  4H13 B;  5TIS H;  5TJH A;  4KT0 J;  1RF0 B;  4W7Y A;  5KLV E;  1RQV A;  2KIK A;  4M3L A;  2Q6Q A;  3H1K G;  4H13 D;  2KZJ A;  3IR9 A;  2P2U A;  2GUV A;  2K9Y A;  2WMM A;  4UB8 E;  3H1K D;  3AEE C;  1L0L J;  2P10 A;  1TU3 F;  5CCH D;  1VQN P;  2BCC G;  1FZG C;  4M7H A;  1Q2N A;  1LP1 A;  2UWJ E;  3KDP B;  2KSE A;  2W83 C;  1KIL B;  2J1G A;  2FKW B;  2HPC B;  1FZA B;  4ASV A;  2KSJ A;  1KIL D;  2BCC D;  2QJY B;  4JYB A;  1PL5 A;  2XNX A;  3CC2 P;  2M3B A;  3EWK A;  1QGK B;  3SFD C;  2GA1 A;  1N86 A;  3AE1 C;  1MZ9 A;  3TGU J;  5AVW B;  1VQ7 P;  3Q3D A;  3N7N A;  2M8R A;  3EQ2 A;  2W8Z A;  1SQB G;  3LW5 J;  1L4A D;  3JCU E;  1R5S A;  4R9T A;  1RF0 C;  1JCC A;  1T8Z A;  2FIB A;  3L72 G;  1NTZ G;  1EC5 A;  3OW2 O;  1MV8 A;  3HE4 B;  1JM0 A;  1SQB D;  2Y0D A;  5APS A;  3V2Q A;  2WPV B;  4NPE A;  5CCH C;  5BU5 A;  3O8Z A;  1IO4 A;  3L72 D;  1M1K Q;  1NTZ D;  2BAS A;  3A7O A;  2WPS A;  1ZXG A;  1FID A;  2XDJ A;  5BU8 B;  3L75 J;  1KN7 A;  1U57 A;  1DIP A;  1KIL C;  2W6B A;  1Q86 Q;  1HGZ A;  3VMZ A;  2K9J A;  2K1A A;  2MKV A;  1Q7Y Q;  2HPC C;  1YTZ I;  3GMA A;  2QJY C;  1UIX A;  4HB1 A;  2ZYD A;  5AVT B;  3L73 J;  1L0N E;  3CWB E;  3H1I J;  1LT9 A;  3OA7 A;  4W7Z A;  5B5E E;  5CBO A;  3L70 J;  3MIW A;  2O01 N;  1KYO D;  1HH0 A;  4BWN A;  2P58 A;  1L4A C;  4PD4 I;  3RL0 B;  2D39 A;  2V7Q H;  1KQG B;  3RL0 D;  5AVX B;  2B9B A;  3FWL A;  2YO2 A;  2LR2 A;  1T3J A;  3MTU E;  1HVV A;  4IL6 E;  3BRT B;  4R4L A;  1Y8A A;  2YKP A;  1S9K D;  5AW3 B;  5KKZ B;  3RK2 B;  2XU6 A;  3CCQ P;  5GTH H;  1Q82 Q;  2AXC A;  1FOS E;  1SQP K;  3PRJ A;  1LWU B;  1KB9 D;  3RK2 D;  2JDI H;  2AXT E;  1KQL A;  2J0Y A;  1FZF B;  3U59 A;  2YXQ B;  1LTA C;  2G3A A;  4EOT A;  4I1L A;  4UB6 H;  3RK3 B;  1KFN A;  1LNQ A;  2XKM A;  2J5U A;  3A3Y B;  2WT7 B;  4O9B A;  2A45 H;  3RK3 D;  4AYC A;  3H1J G;  2WSF H;  4ZNC A;  1VF5 B;  2KLV A;  1DD3 A;  3RL0 C;  1VF5 D;  2YXR B;  2KXP B;  2C0X A;  2HOD A;  1N73 C;  1SFC A;  3NFQ A;  2O01 H;  3C8V A;  3H1J D;  2OYH B;  1P84 H;  1RF1 B;  2PP6 A;  3CXH D;  1SQX G;  4Y28 J;  1CW5 A;  3RK2 C;  1NTK J;  2Z5I A;  1YI2 P;  3WUU A;  3B5N A;  1JTH B;  4LC1 A;  3MGN A;  2B88 A;  1SQX D;  2Q7C A;  3TDK A;  4GOE A;  3M0D A;  1L0L G;  1T2K D;  3IFM A;  3V2R A;  1PIX A;  3H1L J;  2WSC J;  3MZW B;  1FZD A;  2W6A A;  1VQP P;  1VQ6 P;  3W68 A;  1X79 B;  1H0T B;  3HTK A;  3RK3 C;  2D2C B;  3PH0 A;  1L0L D;  1G1J A;  2YMK A;  3RBX A;  2JKV A;  3H32 A;  5KAI E;  1LTJ B;  1VF5 C;  3FXE A;  1U7M A;  3TGU G;  3L74 J;  1ZRT E;  2OYH C;  2YIU B;  2O1J A;  1BE3 E;  1RF1 C;  1LTG C;  3HRN A;  3MUD C;  5APT A;  2HYN A;  3Q5S A;  2YNY A;  1DX7 A;  3TGU D;  3L35 A;  1GL2 A;  2P1J A;  3CCE P;  3O6Q A;  1PV3 A;  2PRR A;  1T2K C;  1FDM A;  3KPE A;  2FYU K;  5CJ0 A;  3IN6 A;  3AEC C;  5APY A;  1RE4 C;  3L75 G;  3G4S P;  1JO5 A;  1FZC C;  3B4S A;  5C39 A;  1N8R Q;  4IFF A;  2H43 C;  3LIE A;  1IFP A;  1LTJ C;  1PFI A;  1NVO A;  2WWW A;  3L75 D;  2OAR A;  2OYI C;  1S1C X;  1Q81 Q;  1WRG A;  3H1K J;  3MD0 A;  2YMY A;  1GTW A;  1T3U A;  4CPG A;  3CCV P;  1FZG A;  2GY7 A;  1OIP A;  2E5Y A;  3L73 D;  1NU1 K;  3G6E P;  2YIU C;  4XE5 B;  1JY3 O;  1SQP E;  1MFT A;  1SQB E;  3ABV C;  1EXJ A;  2L5G B;  5KLV K;  1ZW0 A;  3CCM P;  3CD6 P;  2A06 G;  2BCC J;  2K88 A;  1KFM A;  1NTZ E;  2FFD B;  2QIW A;  3VMX A;  1EDJ A;  5H2F E;  1J1D B;  1BCC J;  2A06 D;  2WIT A;  4D6T G;  1KD1 Q;  1RF0 A;  1FDI A;  2FXO A;  3JCU H;  1OWA A;  1MKM A;  5M1B A;  4PD4 D;  4A7P A;  2M5A A;  1SS1 A;  3BAT A;  1M56 D;  5GTH E;  1AJY A;  4D6T D;  1RE3 C;  1PPJ E;  1OMI A;  1KYO E;  5CCH A;  4HYT B;  3TF5 A;  3G9R A;  3L72 J;  2KB7 P;  5CCG D;  3GHG C;  1A02 J;  1IFI A;  4BRY A;  2Q1K A;  4UB6 E;  3C9I A;  1M8O B;  1KIL A;  1FZE B;  2IZ0 A;  4I7Z B;  1RY3 A;  4N6J A;  1KB9 E;  1RQU A;  1NTK G;  4JBZ A;  1L4A A;  1NTM K;  1IFM A;  1J1D C;  2JHM F;  4GKG A;  1SQV J;  1P84 E;  1FAV A;  3KQG A;  2ZYG A;  1NTK D;  3HD7 D;  3H1L G;  4IL6 H;  2SPZ A;  1AQT A;  3RK3 E;  3H1H E;  2J2P A;  2XV5 A;  5EFW B;  2A45 I;  2OGU A;  1SQQ G;  5CCG C;  3H1L D;  4L73 A;  1JY3 N;  3H6P A;  2Y0C A;  4U3F E;  3H1J E;  3VTP C;  1S2E A;  3WU2 E;  4W80 A;  1DH3 A;  1SQQ D;  4DZO A;  1J1E B;  3L74 G;  3BVH B;  2AEF A;  1AFO A;  3LID A;  2E76 B;  1NOH A;  4RKU J;  1EZV I;  3L74 D;  2KLU A;  2E76 D;  3R4Y A;  1ZR4 A;  1FJP A;  1YIJ P;  2KYV A;  1N73 A;  3IAO A;  3WUV A;  3HD7 C;  2O1K A;  1IFN A;  2C9L Y;  1A02 F;  1L0L E;  3D6Y A;  3CX5 H;  2WQY C;  2I1J A;  3BCC G;  1JY3 P;  1HGV A;  1NU1 E;  4L76 A;  2KNC A;  1JOC A;  2OTK E;  4BXL A;  3U1C A;  1KTM A;  3BCC D;  1GK4 A;  1SQX J;  1ZP0 C;  4KHX A;  2IBZ E;  2J5Z A;  1RHZ B;  2ZVO B;  1GD2 E;  4EIJ A;  4YTP C;  2HLO B;  5AVV B;  3CC7 P;  3TGU E;  1L2P A;  4NPD A;  1GW3 A;  2E76 C;  5CHX A;  5KAI H;  1ZV8 A;  4K3A A;  2JJL A;  2KI7 B;  3BAS A;  1ZN5 A;  1T6A A;  4ZMD A;  1VPC A;  3E7K A;  2WSE H;  1BCC G;  4JF7 A;  1RF1 A;  1QL2 A;  3MUD A;  2E74 C;  3AE3 C;  3A0B E;  2Y9Y A;  1AQ5 A;  2N1T A;  1NYH A;  2JHH C;  2C9N Y;  2FXP A;  3F89 A;  1BCC D;  3TK1 A;  3G71 P;  4GDO A;  1ZR2 A;  2I1K A;  4H13 C;  2NPS B;  3L73 E;  2Z4E A;  1URQ B;  3H1I E;  4GT1 A;  3MHV A;  3T97 A;  4L75 A;  2I8D A;  1RE4 A;  3L70 E;  1URQ D;  4R4M A;  2HLO C;  1FZC A;  2XND H;  1KOR A;  3CI9 A;  2R44 A;  5AW7 B;  3K5B A;  1NTM E;  1BGY J;  5APV A;  2H43 A;  1LTT C;  1M1J B;  4EDF A;  1LTJ A;  4C7N B;  2OYI A;  1OW7 A;  5AVR B;  2H89 C;  2BEZ F;  3N4X A;  1IK7 A;  2YO3 A;  1S5L E;  2J0G A;  4JYO X;  3VP9 A;  2C0W A;  2J0H A;  1FZA C;  4WVZ A;  1SQV G;  3GG2 A;  3E1I B;  4YPC A;  1S3J A;  2V4H A;  2H7H A;  3SWF A;  2ZYA A;  4N78 D;  4HH2 A;  1SQV D;  2RN0 A;  4WY4 B;  5H2F H;  4I2L C;  1W2B O;  1N2D C;  1VQK P;  4WY4 D;  1HUC A;  3TNU B;  3M0A A;  4IFM A;  3M9H A;  4JPZ B;  5KJ7 D;  1JEK A;  4JYC A;  2FYN B;  3FX0 A;  1RE3 A;  1SQB K;  4D6T J;  2QG4 A;  1KYO H;  1M90 Q;  1G2C B;  4RES B;  1W5C E;  2R3C A;  1HF9 A;  1NTZ K;  1H88 A;  4WB4 A;  3GHG A;  1WMK A;  3RL0 g;  4EPU A;  1FZB A;  1L0N J;  3CLQ A;  3E1I C;  1Y47 A;  2FYZ A;  1RH5 B;  1EZV G;  3L71 G;  4I6M C;  1KB9 H;  3GF7 A;  3OJA B;  1DEE G;  4WY4 C;  3AEG C;  2E75 B;  1EZV D;  3L71 D;  5KJ7 C;  3HUS B;  2QA4 P;  3CX5 E;  3V5B A;  2M3E A;  2WNP F;  5AW1 B;  2E75 D;  1FC2 C;  5KKZ C;  2FY8 A;  3L74 E;  1LWU C;  2XNX B;  5CCG A;  1FZF C;  3RGU A;  2R5B A;  2Q3I A;  3U1A A;  2VRS A;  3RBZ A;  4NYT A;  1N86 B;  3WU2 H;  1OXZ A;  4XA4 A;  3CXH H;  1SQQ J;  2Y9Z A;  2HG5 D;  2D2C D;  5B66 E;  1IFD A;  3PHL A;  3AED C;  1N7L A;  1YIT P;  1BSN A;  1DEB A;  3NTN A;  2E75 C;  3HD7 A;  5KLV G;  3HUS C;  3EFF K;  3VOP A;  2Q9I B;  3H1K E;  4LGD E;  1GK6 A;  3SSU A;  5KTB A;  2QJP B;  3WUT A;  2QM8 A;  5KLV D;  3PJS K;  1BGY G;  3FIB A;  2XNX C;  1SP4 A;  4ZFG A;  5K5G B;  1NWQ A;  3BCC J;  1KIL E;  2BCC E;  2HFE D;  1N7S B;  5KLI B;  2GM4 A;  1BGY D;  2WZ7 A;  2D2C C;  1WT6 A;  2NZ2 A;  1SLQ A;  1N7S D;  3AE6 C;  2LXC B;  1BCC E;  1NKZ B;  2IDB A;  2KK7 A;  1L0L K;  2M0B A;  3LW5 H;  1HJB A;  4WBA A;  3B8E B;  1NO4 A;  4C46 A;  1NH4 A;  1PGP A;  2KOG A;  1PGQ A;  4NPF X;  2OTL P;  4LLH A;  1PGO A;  1ZOY C;  2FXM A;  3II6 A;  2Q9I C;  3CL3 D;  1JY2 O;  3CCR P;  2J61 A;  3L72 E;  3A0B H;  2JP3 A;  2KS1 B;  4Y99 B;  1JNM A;  1BDD A;  2IX7 C;  1OW6 A;  1OW8 A;  2YKQ A;  1N7S C;  5KLI C;  4H44 B;  2OYO A;  4H0L B;  3VMY A;  2B89 A;  2QJK B;  2KUB A;  4H44 D;  1D7M A;  1JCD A;  4H0L D;  1NGM B;  1L0N G;  1VDF A;  3QWO C;  1CI6 B;  4N78 E;  4HKZ H;  1EXI A;  3HE5 B;  2MJZ A;  2FBW C;  3USS A;  3M9Q A;  1L0N D;  3B5N B;  1FBM A;  4OVN F;  2JHK F;  1SQP J;  1S5L H;  1S9K E;  4PD4 H;  4PJ0 H;  3PTZ A;  3AEF C;  2HPC A;  1FZA A;  3B5N D;  3MP7 B;  4R9J A;  4Y99 C;  3V4Q A;  1VQ4 P;  2J3U A;  3AE2 C;  3P8M C;  3WMM 0;  1KYO I;  2IFN A;  2FFD C;  4QMA A;  2QVA A;  5AW2 B;  1HTL C;  1K73 Q;  1FS0 E;  3D6Z A;  4H44 C;  1FJK A;  4H0L C;  5CJ4 A;  1YJW P;  3HE4 A;  1VQ9 P;  2WTY A;  1VQO P;  4PV1 B;  3KZI E;  3M91 A;  1VQL P;  4PV1 D;  3JC2 2;  5KAF H;  1H8A A;  1CZQ A;  1KB9 I;  1BDC A;  2CPS A;  1USD A;  2R3S A;  3CMA P;  2JHL F;  1JY2 N;  4RO0 A;  2WSS H;  1GL2 B;  3R2P A;  3CXH E;  1BSH A;  1OVR A;  3O6Q B;  2N9Y B;  1P84 I;  1FZE C;  3Q5P A;  2WSF J;  1PP9 J;  4TLF A;  2PFX A;  3FGA D;  4I7Z C;  2J3F D;  2O3J A;  3V4W A;  2J64 A;  4ASW A;  1SQX E;  5DJT B;  1PZQ A;  2WSC H;  1KQF B;  3KYQ A;  3P8C D;  1KV4 A;  3D70 A;  3D71 A;  3A0H H;  1K04 A;  2QM7 A;  5KJ7 A;  5AW9 B;  3I55 P;  3L71 J;  2Q5U A;  4IL6 X;  4PV1 C;  5APW A;  1NTK K;  1GU4 A;  3QH9 A;  3AE8 C;  1LWU A;  2QEX P;  5APQ A;  2AEJ A;  1FZF A;  2B87 B;  2JO1 A;  1H89 A; 
#chains in the Genus database with same CATH homology
 1J1E C;  1NKN A;  5AW6 B;  3BVH C;  4WY4 D;  1HUC A;  3TNU B;  1SQQ K;  2OYH C;  3M0A A;  4IFM A;  2O1J A;  3M9H A;  1RF1 C;  5KJ7 D;  1LTG C;  2POH A;  3HRN A;  2WT7 A;  5APT A;  4JYC A;  2HYN A;  5AVY B;  3A2A A;  1FZB C;  1J2J B;  5CMZ A;  3HTK B;  1RE3 A;  2YNY A;  1DX7 A;  2IFM A;  1SQB K;  3L35 A;  1GL2 A;  3H32 B;  1G2C B;  2P1J A;  2NPS A;  4RES B;  5BVZ A;  1FU1 A;  2R3C A;  1URQ A;  3PP5 A;  4AQR D;  1T2K C;  1NTZ K;  1H88 A;  3L4F A;  4WB4 A;  1FDM A;  3TSI A;  3KPE A;  2HOD C;  3GHG A;  2FYU K;  2OYH A;  1SFC C;  5CJ0 A;  1LTI C;  3HUS A;  4EPU A;  2H8P D;  2Z5H A;  1HBW A;  1FZB A;  5APY A;  3NMD A;  1RE4 C;  3CLQ A;  1X9V A;  1JO5 A;  1FZC C;  3HD7 B;  1M1J A;  3E1I C;  2FYZ A;  4IFF A;  1YTZ T;  4C7N A;  1JTH A;  2H43 C;  5AVQ B;  3LIE A;  4I6M C;  1LTJ C;  1PFI A;  1SVF A;  2WPQ A;  2WWW A;  2J3G A;  2OAR A;  3B5N C;  2OYI C;  3OJA B;  1WRG A;  4WY4 C;  1GL2 D;  3MD0 A;  2YMY A;  1L0N K;  1GTW A;  1T3U A;  2NPS D;  1FZG A;  3M0D C;  1CSB A;  3E1I A;  1L4A B;  5KJ7 C;  2GY7 A;  1GW4 A;  3HUS B;  1GZL A;  3V5B A;  1NU1 K;  3UIA A;  4M7F A;  1NHL A;  2WNP F;  4OH8 B;  5AW1 B;  4XE5 B;  1JY3 O;  5AW4 B;  2L5G B;  5KLV K;  2CPB A;  1GU5 A;  1Z56 A;  1LWU C;  2W27 A;  4WY4 A;  3H32 C;  1KFM A;  3L37 A;  1Z3U A;  3I5C A;  2R5D A;  2XNX B;  5CCG A;  4N3Y B;  1FZF C;  3P32 A;  3V2P A;  2FFD B;  3VMX A;  2R5B A;  2Q3I A;  3TNU A;  3U1A A;  2VRS A;  1J1D B;  4NYT A;  2WIT A;  1N86 B;  4GIF A;  2ZFC A;  1FZG B;  1RF0 A;  1OWA A;  1OXZ A;  4XA4 A;  3M9B A;  2Q9I A;  1JY2 P;  1HWT C;  2ZXE B;  3BAT A;  4IFD K;  2HG5 D;  1LGH B;  1XTG B;  1G2C A;  1IFD A;  1RE3 C;  2J61 B;  2P67 A;  1N7L A;  1GL2 C;  5CCH A;  2NPS C;  4HYT B;  1MUU A;  3G3Z A;  1URQ C;  1Z3S A;  1IJD B;  1FIB A;  1DEB A;  4C7R A;  2KB7 P;  3NTN A;  5CCG D;  3GHG C;  1A02 J;  1IFI A;  3HD7 A;  1N7S A;  2P7J A;  3HUS C;  5AVZ B;  4B86 A;  1RF0 B;  3C9I A;  4W7Y A;  1KIL A;  3VOP A;  1FIC A;  2Q9I B;  4M3L A;  1N73 B;  2A45 G;  1M1J C;  2JEE A;  1FZE B;  1IK9 A;  4LGD E;  1GK6 A;  1G1I A;  5KTB A;  3IR9 A;  2E43 A;  2QM8 A;  1RY3 A;  2P2U A;  2GUV A;  4N6J A;  3FIB A;  2XNX C;  1SP4 A;  2N9B A;  1LTS C;  4ZFG A;  1L4A A;  3VYI A;  1NTM K;  5CCH D;  1IFM A;  1M7L A;  1NWQ A;  1J1D C;  2JHM F;  2WPR A;  1FZG C;  4GKG A;  5AVS B;  4M7H A;  2HFE D;  3EFG A;  1N7S B;  2GM4 A;  3KDP B;  1FAV A;  3L36 A;  2WZ7 A;  3KQG A;  1KIL B;  1WT6 A;  3P7K A;  1IFJ A;  2J1G A;  3HD7 D;  1SLQ A;  1N7S D;  2FKW B;  2HPC B;  1FZA B;  2KSJ A;  1KIL D;  4JYB A;  2XNX A;  2J2P A;  2M3B A;  2PAJ A;  1NKZ B;  2XV5 A;  1L0L K;  3LW5 H;  2A45 I;  2FFD A;  1HJB A;  4AUW A;  4WBA A;  3B8E B;  1NO4 A;  5CCG C;  4C46 A;  1SQV K;  1N86 A;  2IPP A;  4ZKU A;  1JY3 N;  1MZ9 A;  1NH4 A;  5AVW B;  3H6P A;  3N7N A;  2KOG A;  2M8R A;  3EQ2 A;  4LLH A;  2FXM A;  1W2E A;  3VTP C;  4ZKP A;  1L4A D;  4W80 A;  4R9T A;  1RF0 C;  3II6 A;  1DH3 A;  1JCC A;  4DZO A;  2Q9I C;  3CL3 D;  1J1E B;  1T8Z A;  2FIB A;  3BVH B;  1JY2 O;  2J61 A;  2J58 A;  1MV8 A;  2XZR A;  3HE4 B;  1AFO A;  1CI6 A;  3LID A;  3P8C E;  4Y99 B;  1EQ7 A;  5APS A;  1JNM A;  1NOH A;  3V2Q A;  3HE5 A;  5CCH C;  1IO4 A;  2IX7 C;  3O8Z A;  2N1T B;  5BU5 A;  5AW0 B;  1ZR4 A;  1FJP A;  1KZU B;  2BAS A;  3A7O A;  2N1T D;  2WPS A;  2KYV A;  2YKQ A;  1FID A;  1N73 A;  2XDJ A;  5BU8 B;  1ZLL A;  3HD7 C;  1FZE A;  1N7S C;  2O1K A;  1IFN A;  1KIL C;  2W6B A;  1YYC A;  1HGZ A;  2Z4E B;  3VMZ A;  2C9L Y;  1A02 F;  3VMY A;  2E42 A;  1JCD A;  1JUN A;  2HPC C;  1YTZ I;  2I1J A;  1VDF A;  1RE4 B;  5AVT B;  1JY3 P;  1FZC B;  1CI6 B;  4N78 E;  1HGV A;  1LT9 A;  3OA7 A;  4W7Z A;  3HE5 B;  2H43 B;  2MJZ A;  3MIW A;  1HH0 A;  3M9Q A;  1JOC A;  3U1C A;  1L4A C;  3RL0 B;  1GK4 A;  3B5N B;  2D39 A;  4KHX A;  1FBM A;  2OYI B;  2JHK F;  2J5Z A;  1X8Y A;  1S9K E;  3RL0 D;  5AVX B;  2LKM A;  2HPC A;  1FZA A;  3B5N D;  3NXS A;  1GD2 E;  4EIJ A;  1QL1 A;  2YO2 A;  1T3J A;  2HLO B;  3MTU E;  1HVV A;  5AVV B;  4R9J A;  4JZC A;  3BRT B;  5AW8 B;  2YKP A;  1S9K D;  5AW3 B;  4Y99 C;  2J59 M;  5AVU B;  3V4Q A;  1GW3 A;  2J3U A;  3P8M C;  1LT9 B;  5CHX A;  3RK2 B;  2XU6 A;  3WMM 0;  2IFN A;  2FFD C;  1SQX K;  1ZV8 A;  1FOS E;  2N1T C;  1SQP K;  1LWU B;  1N86 C;  1XTC C;  3RK2 D;  5AW2 B;  1HTL C;  2JJL A;  1KQL A;  2J0Y A;  3BAS A;  1ZN5 A;  1LTB C;  2J3O A;  1FZF B;  1VPC A;  3BVH A;  2J3F A;  3U59 A;  1FJK A;  2WSE H;  2KP8 A;  5CJ4 A;  4JF7 A;  2Z4E C;  3HE4 A;  2WTY A;  3A5T A;  1RF1 A;  1LTA C;  4EOT A;  1QL2 A;  3MUD A;  4I1L A;  3RK3 B;  1AQ5 A;  3M91 A;  1JMM A;  1KFN A;  2N1T A;  1FOS F;  4DOJ A;  2XKM A;  1H8A A;  2JHH C;  3A3Y B;  2WT7 B;  2C9N Y;  4O9B A;  2A45 H;  3RK3 D;  1CZQ A;  4AYC A;  3TK1 A;  3V2N A;  2WSF H;  1RE3 B;  2KLV A;  2CPS A;  2JHL F;  1ZR2 A;  1JY2 N;  2I1K A;  3OAK A;  1GL2 B;  3RL0 C;  3TYY A;  3R2P A;  2NPS B;  2C0X A;  2HOD A;  2Z4E A;  1E5W A;  1URQ B;  1N73 C;  1SFC A;  4GT1 A;  3NFQ A;  1FZE C;  3T97 A;  2O01 H;  1RE4 A;  3GHG B;  2OYH B;  1URQ D;  2HLO C;  1FZC A;  2J3F D;  1RF1 B;  3CI9 A;  1GDT A;  2PP6 A;  3V4W A;  2J64 A;  1MFZ A;  5AW7 B;  1NAF A;  1FZB B;  5APV A;  2H43 A;  1LTT C;  1CW5 A;  1M1J B;  1JC9 A;  3VP8 A;  1LT9 C;  1LTJ A;  3RK2 C;  2WSC H;  2Z5I A;  2R32 A;  3KYQ A;  3M06 A;  3B5N A;  1JTH B;  3P8C D;  1IC2 A;  4LC1 A;  4C7N B;  2OYI A;  3MGN A;  5APX A;  3SWY A;  2Q7C A;  5AW5 B;  5APU A;  3BRV B;  5AVR B;  3N4X A;  2GUS A;  2HOD B;  2YO3 A;  3M0D A;  2HLO A;  3IFM A;  1SFC B;  2QM7 A;  5KJ7 A;  5AW9 B;  3V2R A;  3VP9 A;  1T2K D;  2J0G A;  4JYO X;  2C0W A;  2J0H A;  1FZA C;  2JHI F;  1FZD A;  2W6A A;  2Q5U A;  1SFC D;  2YKO A;  5APW A;  3E1I B;  1NTK K;  1X79 B;  3HTK A;  3RK3 C;  1GU4 A;  1G1J A;  1LWU A;  3H32 A;  1LTJ B;  5APQ A;  2H7H A;  3SWF A;  4N78 D;  4HH2 A;  3VN0 A;  1FZF A;  4WY4 B;  1H89 A;  2J60 A;  4I2L C;  1N2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...