1FZCC

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 92
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcC02
1JY2N 1LTJA 2J3OA 2J61B 2HLOB 2J1GA 2XNXA 1FZCC 2J0YA 2Z4EC 2J3GA 2H43B 1FZEA 2OYHB 1FZCA 1JC9A 2HODB 2Z4EA 2HPCA 1LWUB 4R9JA 2JHHC 2Q9IB 1FZAB 2J61A 2HLOA 1FZDA 3HUSC 1N86B 4M7FA 2OYIB 2OYHC 1FZBB 1RE3B 2HODC 3H32C 2WNPF 1N73B 1T3UA 2Q9IC 1FZAC 2JHIF 2OYHA 1JY2O 2HODA 1FZFB 1N86C 1W2EA 1RF0B 1LWUA 2OYIC 1FZBC 1RE3C 3GHGB 1JY3O 2Q9IA 1FZAA 3HUSB 1N73C 1RE4B 1RF1C 4R9TA 3BVHB 1N86A 2A45I 1FZBA 3H32B 2OYIA 1RE3A 1FZFC 2GY7A 1RF0C 3FIBA 4JZCA 2A45H 1N73A 3GHGC 1RE4C 1JY2P 1FZFA 3BVHC 1RF0A 3GHGA 1JY3P 2J64A 1FICA 2FFDB 1M1JB 1RF1B 3HUSA 1RE4A 2FIBA 3BVHA 3E1IB 3H32A 1FIBA 2A45G 4JYOX 2D39A 2FFDC 1M1JC 2J5ZA 4EPUA 4NYTA 2J3FD 3E1IC 2J0GA 1Z3UA 2FFDA 1M1JA 2JHKF 1RF1A 2J2PA 2J60A 3E1IA 1LT9C 1FZEC 1JY3N 1FZGB 1FIDA 2HPCC 4M7HA 1LT9A 2J0HA 1LTJB 2J3FA 2HLOC 2J3UA 2XNXB 2JHMF 1FZGC 2JHLF 2H43C 1LT9B 1FZEB 1LTJC 1FZGA 1FZCB 1Z3SA 4ZFGA 2Z4EB 2HPCB 2XNXC 2H43A 1LWUC
chains in the Genus database with same CATH superfamily
1JCDA 2E75D 1NTKE 2E75B 2V7QH 1FAVA 1X9VA 2J0YA 3W68A 2IBZD 1HBWA 1URQD 2KI7B 1URQB 1G2CA 3KXDA 2HYNA 4KJMA 2HR3A 4AYCA 3H1HE 1HGVA 2KP8A 1NTMJ 3L75G 1VF5D 1DEBA 1VF5B 5GTHH 2OTJP 1FZAC 3L70E 3AEEC 2BASA 2IBZG 1FZAA 2WSCH 1RE4B 4M3LA 1DEEG 2C0XA 3UIAA 1XTGB 3MUDC 2E76D 2W6BA 1FICA 2FFDB 2E76B 1L0NK 2IZ0A 3MUDA 2A45G 1L0NE 2KSEA 1L2PA 2I1JA 3T97A 1M1JC 2K37A 3B8EB 4PJ0H 4I7ZB 4NYTA 4HYTB 1L4AD 3CCVP 1HJ0A 1L4AB 3KHUA 4D6TJ 1M1JA 2H7HA 3L71D 1S5LE 2KS1B 4ZMDA 1IO4A 4M7HA 1KB9I 5K5GB 2YKOA 2E5YA 1RQVA 2E42A 1FS0E 1PGOA 1GL2B 1LTJC 1LTIC 3TDKA 2LR2A 1FOSF 3L71G 2E74D 1LTJA 2E74B 1NTZD 2HLOB 1USDA 1FZCC 1RH5B 3F5HA 4AQRD 2OYHB 1FZCA 3KQGA 2Q9IB 1KQLA 2V7QJ 2J61A 5CHXA 2P2UA 4OWFA 3SFDC 1N86B 2W27A 3CCEP 2XDJA 3MZWB 4Y99B 1S9KE 1NTZG 2JHIF 1EZVD 3N4XA 1JY3O 4H13C 1IZNB 5KLVK 1VL2A 3C8VA 2BCCE 3GG2A 3LW5H 5CJ4A 1JTHA 3O6QB 4IOIH 2FXPA 5KLVE 1SQXK 2E43A 1YJNP 3GF7A 1EDLA 1KFMA 1SQXE 3VOPA 2WSCJ 4BWNA 3K5BA 2J58A 3PTZA 3G9RA 3G3ZA 1EZVG 5AW6B 4H0LB 4WY4D 4WY4B 3FWLA 3E1IC 3P8CD 2J0GA 5H2FH 1Z56A 2FKWB 3E1IA 3JCUH 2GM4A 2WT7B 3L75E 2FYNB 4GODA 2OGUA 4XFJA 3IN6A 2J3UA 1NHLA 2P10A 3S9OA 2QJKC 3CCRP 2IBZE 2HPCB 1CI6B 2PGDA 5AVSB 3N7NA 1HTLC 1JC9A 5CCGC 3O8ZA 1OMIA 1HJBA 3H1KD 1M1KQ 5CCGA 1MKMA 1YJ9P 1N7LA 1SQQJ 3AE9C 4RO0A 2IDBA 2JO1A 2OYIC 3VP9A 1RE3C 3GHGB 2HG5D 3CCLP 3SWFA 3RL0B 2OYIA 1RE3A 3H1JD 2PP6A 3H1KG 1PGPA 1N2DC 3AEFC 2G8YA 1ZR4A 2ZXEB 5APSA 3L72D 3H6PA 4JYOX 2PFXA 3L71E 4UB8E 5AVUB 2WPRA 5TISE 3TK1A 1OVUA 3H1JG 2K9YA 3A0BH 4BXLA 4PV1D 3V4WA 4OGQD 1HH0A 3VMXA 4OGQB 2DW3A 4W7ZA 3L72G 2J0HA 3L4FA 1NTZK 1HGZA 5GTIE 4PD4H 1ZN5A 1NTZE 2H43C 4UB6H 1Z3SA 3H1LJ 2XNXC 2H43A 2KXPB 2GUVA 4YXDC 5APTA 2J1GA 2XNXA 2Z4EC 2JJLA 1FZEA 1LTSC 1IFDA 2Z4EA 3M06A 1D7MA 4ASVA 2JHHC 3TNUA 1JMMA 1CW5A 2ZFCA 1YI2P 1EZVE 3V5BA 3L37A 1PV3A 5L8RJ 2ITAA 4K3AA 2WSEH 3AE5C 2HFED 3I5CA 3C9IA 5BVZA 4EYYQ 1RF1C 5APXA 2N9YB 1JEKA 2M5AA 3CMEP 1FDMA 1JY2P 2IYPA 4U3FJ 1PP9J 1X0TA 1JNMA 3P8CE 1SQPG 4XA4A 3Q3DA 5KJ7A 3IR9A 5KAIH 4NPDA 3OAKA 2NPSB 2JHKF 1QEXA 1BE3J 1H88A 3M0AA 2ZT9C 1FZGB 3PH0A 1KILC 1QLED 1ZR2A 1J1DB 4PD4I 1KILA 2OYOA 1JMBA 3D6YA 3U1CA 5APYA 1URQC 3V2RA 2ZJSE 3EQ2A 3WUVA 1URQA 3H1KE 2Q3IA 4ZKUA 2PAJA 1AVYA 4EDFA 2P7JA 1S4XA 2AXTE 4HH2A 4U7JA 1DD4A 2HODC 1M57D 1VQ9P 1QL1A 3HD7D 3H1JE 2HODA 2KIKA 3TSIA 3HD7B 1GK4A 2GUSA 1LWUA 3HE5B 1FZBC 3L36A 2E76C 2R5BA 1NU1J 2KSJA 1FZBA 3SWYA 1NH4A 2ZYDA 3L72E 1FOSE 1NYHA 3VMAA 4I7ZC 1Y9BA 4IFDK 2YMYA 5KKZB 1A02J 1JUNA 4XE5B 3H32A 1VDFA 1YIJP 5CBNA 3CD6P 2J60A 2BCCD 1VQKP 2Y0CA 2CPSA 1PL5A 3RK3B 2HLOC 1OFCX 3PRJA 1PZQA 3M9QA 1SFCD 2FBWC 4RESB 3L35A 2FYZA 2QJPB 3OW2O 3L74J 4RKUJ 2BCCG 3VMZA 1J2JB 4BRYB 4LC1A 1YTZT 1KB9H 1H0TB 2N1TB 4LLHA 3KPEA 4GOFA 5AW7B 1LTAC 4Z1MH 1YQ3C 3JSVC 4OH8B 3V2NA 1W2EA 2K88A 3HUSB 1N73C 2IFMA 1NTKJ 3VTPC 3AE4C 2C0WA 4LGDE 1N73A 1AQTA 4WY4C 5AVVB 2KZJA 3H1HJ 1EXIA 4JYBA 1LP1B 3TGUD 5B66E 1M8OB 4EI2A 2QVAA 3GW6A 1FU1A 3LIEA 3L70J 1BCCD 4YTPC 2B87B 2O01N 3B5ND 3W67A 1FIDA 2R3SA 3B5NB 2HPCC 3CLQA 2IYOA 3TGUG 1ZOYC 1FJKA 2YXRB 1LT9B 2KNCA 1BCCG 1L0NJ 1KV4A 2K1AA 1OVRA 3HE4B 3V2QA 1QGKB 1KYOD 2YKQA 1ZV8A 2M3BA 5CCHC 3QH9A 5CCHA 1VQ8P 1GL2D 1TU3F 1AV1A 2WNPF 4DZOA 2YXQB 1PGQA 1RF0B 2O01J 5AVTB 2FXOA 3AE1C 2I8DA 3BRVB 2Y9ZA 1U7MA 1CZQA 1VPCA 2A45H 3LIDA 4GIFA 3H1LD 1A02F 1J1EB 1S3JA 1S1CX 4NPFX 2KUBA 4WVZA 5KTBA 2D2CD 3P32A 3TF5A 2D2CB 1X79B 3WU2E 5APQA 2WSSH 4PV1C 2KK7A 1OIPA 1NOHA 2XNDH 5C39A 2IPPA 1W5CE 2J2PA 5AW9B 1OZHA 3FXEA 3CCUP 5KLVJ 3MHVA 2FY8A 1SQXJ 4H0LD 1WMKA 3H1IJ 2FYUD 4H44C 4Y28J 1T6AA 2J59M 1G2CB 2N9BA 2J3OA 3VMYA 2AEMA 3CWBD 1HF9A 2WTYA 2IBZI 2FYUG 4PJ0E 1NWQA 2MJZA 5AVZB 1FZAB 3L75J 3MGNA 2AEJA 2QJYB 1LTTC 1ZRTD 3Q1MA 2M8RA 1PIXA 2SPZA 2E5TA 3CWBG 3G6EP 1HWTC 2K9JA 1OWAA 2A45I 1LTGC 1KZUB 1FZFC 2P1JA 2GY7A 1VQ4P 4A7PA 3T97B 3TGUE 1FZFA 1K04A 2A06D 1SLQA 3FX0A 3MTUE 3U1AA 4PD4D 1M1JB 3WMM0 2WMMA 4IL6X 1BCCE 3ITKA 1Q2NA 2BEZF 5B5EH 5APUA 2Y0EA 3RL0D 1YQ4C 4EPUA 1BGYD 2W6AA 1IFIA 1MUUA 4N78D 3IFMA 4DT0A 1SS1A 2A06G 4O9BA 3VYIA 4GOEA 1LTJB 4IL6H 2J3FA 2XV5A 1QX8A 3D6ZA 1KD1Q 1AVOA 1USEA 3HTKA 1BGYG 1YITP 3SWKA 3Q2YA 1KYOE 1FZCB 3A2AA 3BASA 3L71J 2L5GB 3CX5H 4M7FA 1SQVD 2J61B 1YYCA 1KQGB 1LNQA 4C7NA 1FDIA 4KHXA 3HD7C 3RK2C 2WITA 3AEAC 1IFPA 1P84D 1JTHB 1NTZJ 1SQVG 2WVRA 3L73D 1E79H 4GT1A 3CPWO 4L75A 4IFMA 1NO4A 3H1LE 2IFNA 1EZVI 4ZKPA 1T2KD 3CXHH 3BVHC 3TYYA 1N7SC 4N3YB 3AE2C 2J64A 3L73G 1SQBD 3BVHA 3E1IB 2M3EA 3ABVC 3NXSA 1N7SA 3VN0A 3BCCD 1NGMB 1YTZI 1VQNP 4HKZH 1N8RQ 1RF1A 2RH0A 2FYUK 3BRTB 3CCSP 1SFCC 5CMZA 3CC4P 4R4LA 2FYUE 1SQBG 1SFCA 2QIWA 1Q82Q 4U3FE 1T3JA 3Q5RA 1JCCA 3BCCG 1PFIA 1R5SA 2NPSD 3CX5I 1NTMD 3CWBE 1DX7A 5AVRB 4W80A 2ZAEB 1LT1A 2H88C 1ZP0C 3GLMA 3A7OA 4HB1A 1JB0J 2JEEA 3WUUA 2AXCA 3KZIE 1ZRTE 2E75C 1LJ2A 4R9JA 2WSFH 1Q90D 3HUSC 1NTMG 2OYIB 3A0BE 1YJWP 1RE3B 1T3UA 2W83C 1Q86Q 1JY2O 1VF5C 4R9TA 1LTBC 2A06E 3CXHI 4DCKA 1GU4A 4PD4E 1GTWA 3H1KJ 2G3AA 1WT6A 4UB6E 4D6TD 3SFEC 1SVFA 1RE4C 2V4HA 3KDPB 4NPEA 3B71A 2KB7P 3S1KA 1BGYE 1HUCA 1RE4A 3PP5A 3Q5PA 4N78E 1NKZB 1FIBA 2D39A 1EDKA 4WB4A 2FFDC 1DIPA 1AA0A 2XU6A 3H25A 2POHA 3H1JJ 5DJUB 2FFDA 2R44A 2QEXP 4D6TG 3KYQA 3NMDA 1GK6A 1LT9C 1K05A 1KB9D 1L4AC 3AECC 3L72J 1LT9A 1SQVK 5KLIB 1L4AA 2XNXB 3S4RA 1SQVE 2Q6QA 2JHLF 5KAFE 2KOGA 1FZEB 2KS1A 3EWKA 3MD0A 1S5LX 1VQ6P 1R8EA 2Z4EB 3WUTA 4DJGA 1L0LJ 3TNUB 5AW1B 3V4QA 1GL2C 3CC2P 2WPQA 1KORA 1RQUA 3U59A 3JC22 1GL2A 3RK3D 1MV8A 2E74C 1P84E 3L73E 2LXCB 5KAIE 1ZXGA 1PPJD 2HLOA 1FZDA 2JR8A 1S5LH 1KQFB 2OYHC 5E79E 5DJTB 2RKLA 2M5AB 2Q9IC 2OYHA 1J1EC 1N86C 3G4SP 2WSFJ 1R5LA 2M0BA 2Q9IA 4Y99C 1KFNA 3H1ID 1SQBK 1N86A 2N1TD 4JZCA 1SQBE 5KJ7D 3P7KA 1PPJG 2QG4A 2O01H 1FC2C 3BCCE 3D71A 4I2LC 1OX3A 3CCMP 1IFMA 1SQPJ 2R3CA 2NRGA 3O6QA 3M9BA 2PRRA 2C9LY 3A0HE 2ZT9D 1KILD 2ZT9B 1KILB 4H0LC 3G71P 3E1RA 1NTMK 3WU2H 4WY4A 4JF7A 1Q81Q 1NTME 3USSA 2QE7H 3RL0g 2FYNC 4ZNCA 4ZFGA 1KN7A 1SQQD 1VQMP 1GW4A 3AE7C 2WT7A 3AEGC 5BU5A 2QJYC 1IK9A 3IF4A 2WZ7A 4RJTA 4KT0J 4QMAA 2HODB 2HPCA 1LWUB 4TLFA 1H89A 1CI6A 3SSUA 1QL2A 4JYCA 4TT3H 1FZBB 3IAOA 2O3JA 1SQQG 3MP7B 3FXDA 4D6TE 1VQLP 3H32B 2Z5HA 2O1KA 3GHGC 2B9BA 2OTLP 2UWJE 4I6MC 3RL0C 2H89C 1JY3P 3GHGA 5AVYB 1GW3A 5AVWB 4EOTA 4L76A 3RBZA 1KB9E 3CC7P 1GMJA 1W2BO 1KTMA 5BU8B 3P8MC 3EFGA 3C1LA 1OW7A 4B86A 1UIIA 4OGQC 2YIUB 3II6A 3R4YA 4IFFA 5CBOA 3H1LG 1QVGO 3RK3E 1JY2N 3RBXA 1Y8AA 2BCCJ 5GTHE 1X22A 1PPJE 2YO2A 3M91A 4UB8H 5TISH 1AQ5A 3AE8C 1G1JA 1U7JA 1KYOH 3V6IA 3FGAD 2B89A 1GZLA 1MFTA 4K35A 4U3FD 1PP9D 3RGUA 1N73B 3H1IE 2Z5IA 1T2KC 1IFNA 4I1LA 3CL3D 5GTIH 2RMZA 3PLNA 4YPCA 2QA4P 2W6JH 4N6JA 2OARA 1BE3D 2CPBA 4U3FG 1PP9G 3EFFK 1DH3A 2JKVA 2FIBA 1KILE 1YBKA 3CI9A 1NVOA 5AW8B 4R4MA 3AE3C 3CX5D 2ZVNB 2J5ZA 1GD2E 5AVXB 5M1BA 1OXZA 3OJAB 1BE3G 2YMKA 5AW0B 2KNCB 1NKNA 1AJYA 2NPSC 4WBAA 1SQQK 2XKMA 3TGUJ 3CCJP 4CPGA 2NPSA 1SQQE 1XTCC 2JHMF 1FZGC 1KMIZ 1BCCJ 1J1DC 5CCHD 1FZGA 1LGHB 1AFOA 2BEQD 4JQ0D 1K8AQ 4C7RA 4GKGA 3B4SA 3CXHD 5AVQB 1KYOI 4JPZB 1NU1D 3FWNA 2KYVA 4HJGH 2ZYGA 1IK7A 3VP8A 4MN4C 3LW5J 5CJ0A 3KZIH 1NAFA 2JWAA 1ZLLA 2ZYAA 1EXJA 1NU1G 1HVVA 1BSNA 2Q7CA 1KC8Q 2W8ZA 1EDIA 1L0LD 3HD7A 1OVVA 4PV1B 3HE5A 1IFJA 4H13D 5H2FE 3OA7A 2R5DA 3AEBC 4H13B 3JCUE 1ZMEC 4OVNF 2QSIA 3F89A 1FDOA 1EDJA 3ZDMA 2P67A 2W90A 5KKZC 2AXTH 1JO5A 1FE6A 2XZRA 5KLIC 1DD3A 2OQQA 1Z3UA 2R32A 3I56P 2VRSA 1L0LG 1Q7YQ 1FZEC 1EQ7A 2Q3EA 1T8ZA 3L74D 2KZIA 5AW4B 4H44D 1VQ7P 4H44B 1M56D 3V2PA 1GDTA 1FBMA 2YO3A 3I55P 3RK3C 1EC5A 3CMAP 2YNYA 2RN0A 1ZW0A 3L74G 1SQPD 4L74A 2QM7A 2QJKB 2K3RA 2JDIH 2MKVA 1KQSO 2ZXXA 2QJPC 5B5EE 5KAFH 1NTKD 1PP9E 2FYUJ 3A5TA 3MIWA 2FXMA 2O1JA 4C46A 2ZVOB 1BDCA 2K9JB 4BRYA 1S72P 3H1HD 2N1TC 4YXWH 1IJDB 5CCGD 5KJ7C 1QVFO 1FZFB 1H0TA 1NJIQ 2GA1A 3CWBJ 2N1TA 1JM0A 1P84H 3PHLA 1BE3E 3GF3A 4IL6E 3A3YB 4JBZA 5AW5B 1NTKG 1GU5A 2H8PD 3L70D 3FIBA 5E79H 2YKPA 2Q5UA 3CX5E 3R2PA 2WWWA 3H1HG 3HUSA 4AUWA 3AE6C 1JOCA 1PGJA 1E5WA 5APWA 3GMAA 4EIJA 4GDOA 2Q1KA 2J3FD 2NZ2A 1YHQP 1NAYA 3AEDC 3L70G 1WRGA 1L0ND 1LP1A 3HTKB 1S2EA 2LKMA 1Y47A 1JY3N 2IX7C 2WPSA 2LXBA 5EFWB 3A0HH 1VQ5P 3QWOC 2OTKE 1VQOP 1BGYJ 3B5NC 4WWIA 1H8AA 2B87A 4C7NB 2C9NY 3CXHE 1L0NG 2Y9YA 1NU1K 2KLVA 3B5NA 1LWUC 3PJSK 1NU1E 1OW8A 5B66H 3HRNA 3D70A 1BSHA 2J3GA 2H43B 2IZ1A 3RK2D 3RK2B 1G1IA 1X8YA 5TJHA 1K9MQ 1BDDA 3CCQP 2WSEJ 3HE4A 3E7KA 1IC2A 3H32C 2WPVB 1SQVJ 2CK3H 4ASWA 1P84I 3NTNA 1L0LK 2WQYC 1CSBA 1UIXA 2I1KA 1L0LE 1S9KD 3BVHB 1N7SD 3BATA 5AW2B 1N7SB 1FJPA 1RF0C 2QRXA 1SP4A 1M7LA 1RY3A 4L73A 2B88A 2Y0DA 1RF0A 3NFQA 3L73J 1RF1B 5KLVD 4DOJA 2QM8A 5AW3B 1M90Q 1SQXD 1MZ9A 1RHZB 2D2CC 1OW6A 1SFCB 3L74E 2AEFA 2P58A 2JP3A 3M0DC 2YIUC 5APVA 3Q5SA 1U57A 3M0DA 1SQBJ 4W7YA 5KLVG 1K73Q 2JWDA 2L91A 1SQXG 3BCCJ 1SQPK 2J5UA 3H1IG 2KLUA 1SQPE 1MFZA 3L75D 3M9HA 1NTKK 1VQPP
chains in the Genus database with same CATH topology
1JY2N 1JCDA 2J61B 1URQA 1YYCA 1FAVA 1X9VA 2J0YA 2Q3IA 2YO2A 4ZKUA 1HBWA 1URQD 2PAJA 3M91A 1URQB 1G2CA 4C7NA 2HYNA 1AQ5A 4AYCA 1G1JA 4KHXA 3HD7C 1HGVA 1GZLA 2P7JA 2KP8A 4HH2A 3RK2C 2WITA 1DEBA 2HODC 1JTHB 1N73B 1QL1A 2Z5IA 1FZAC 1T2KC 3HD7D 1IFNA 4GT1A 2HODA 4I1LA 3HD7B 3TSIA 1GK4A 2GUSA 1LWUA 1NO4A 3HE5B 4IFMA 1FZBC 2BASA 3CL3D 3L36A 1FZAA 2WSCH 1RE4B 2R5BA 2IFNA 2KSJA 4M3LA 1FZBA 3SWYA 1NH4A 4ZKPA 4N6JA 1T2KD 2OARA 1FOSE 2C0XA 3UIAA 2CPBA 3BVHC 3TYYA 1XTGB 4IFDK 1N7SC 4N3YB 2W6BA 2J64A 1FICA 2YMYA 2FFDB 1DH3A 1L0NK 1A02J 2FIBA 1JUNA 3BVHA 3E1IB 3NXSA 3H32A 1N7SA 3CI9A 1VDFA 3MUDA 4XE5B 3VN0A 2A45G 5AW8B 2I1JA 3T97A 1M1JC 3B8EB 2J5ZA 4NYTA 4HYTB 1GD2E 1L4AD 1YTZI 1L4AB 5AVXB 1M1JA 1RF1A 2H7HA 1OXZA 3OJAB 2J60A 2FYUK 3BRTB 5AW0B 1SFCC 1NKNA 5CMZA 1IO4A 2NPSC 4WBAA 1SQQK 2XKMA 4M7HA 1SFCA 2CPSA 2YKOA 3RK3B 2HLOC 2NPSA 2E42A 1T3JA 1XTCC 1JCCA 2JHMF 1FZGC 3M9QA 1PFIA 1SFCD 1GL2B 4RESB 2NPSD 1LTJC 1LTIC 1J1DC 3L35A 2FYZA 5CCHD 1LGHB 1FZGA 1AFOA 1DX7A 5AVRB 4W80A 1FOSF 1LTJA 2HLOB 3A7OA 4C7RA 4GKGA 3VMZA 1J2JB 1FZCC 4LC1A 5AVQB 2JEEA 4AQRD 2OYHB 1YTZT 1FZCA 3KQGA 2N1TB 2KYVA 4R9JA 4LLHA 3KPEA 2Q9IB 1KQLA 2WSFH 2J61A 3HUSC 5CHXA 2P2UA 1N86B 2W27A 2OYIB 5AW7B 1LTAC 1RE3B 3VP8A 2XDJA 4Y99B 1S9KE 1T3UA 4OH8B 5CJ0A 2JHIF 3V2NA 1JY2O 1W2EA 1NAFA 3N4XA 1JY3O 3HUSB 1N73C 1ZLLA 2IFMA 3VTPC 5KLVK 1LTBC 4R9TA 1GU4A 3LW5H 5CJ4A 1GTWA 1JTHA 2C0WA 1HVVA 4LGDE 2Q7CA 1SQXK 2E43A 1N73A 1WT6A 1SVFA 1RE4C 4WY4C 3KDPB 5AVVB 1KFMA 3HD7A 3VOPA 3HE5A 1IFJA 3OA7A 4JYBA 2R5DA 2KB7P 1HUCA 1RE4A 2J58A 3PP5A 4N78E 1NKZB 1FIBA 3G3ZA 5AW6B 4WY4D 2D39A 1FU1A 4WB4A 2FFDC 2P67A 4WY4B 3LIEA 2XU6A 2POHA 3E1IC 1JO5A 3P8CD 2XZRA 2J0GA 1Z3UA 2FFDA 2R32A 1Z56A 3KYQA 2FKWB 2VRSA 3NMDA 3E1IA 1GK6A 1LT9C 1FZEC 1EQ7A 1T8ZA 1L4AC 3B5ND 5AW4B 1FIDA 3B5NB 2GM4A 2HPCC 3CLQA 1LT9A 2WT7B 1SQVK 1L4AA 1FJKA 2J3UA 2XNXB 1NHLA 3V2PA 1GDTA 1FBMA 2YO3A 2JHLF 1LT9B 1FZEB 2KOGA 3MD0A 3RK3C 2Z4EB 2HPCB 1CI6B 3TNUB 3HE4B 2YNYA 5AVSB 5AW1B 3V2QA 3V4QA 3N7NA 1GL2C 2WPQA 2YKQA 2QM7A 1ZV8A 2M3BA 3U59A 5CCHC 1GL2A 3RK3D 1MV8A 1HTLC 1JC9A 5CCGC 5CCHA 3A5TA 3BASA 3MIWA 3O8ZA 1HJBA 2FXMA 1GL2D 2O1JA 4C46A 2HLOA 1FZDA 5CCGA 1N7LA 2OYHC 2WNPF 2N1TC 4DZOA 1IJDB 2Q9IC 5CCGD 5KJ7C 2OYHA 1FZFB 1J1EC 1N86C 1RF0B 2N1TA 2OYIC 1RE3C 3VP9A 3GHGB 5AVTB 2HG5D 2Q9IA 3BRVB 3A3YB 4Y99C 1KFNA 1N86A 1SQBK 3SWFA 5AW5B 3RL0B 1CZQA 2N1TD 1GU5A 2H8PD 2OYIA 1RE3A 3FIBA 2PP6A 4JZCA 1VPCA 2A45H 5KJ7D 3P7KA 3LIDA 2YKPA 2O01H 4GIFA 1A02F 2Q5UA 1J1EB 1N2DC 1ZR4A 3R2PA 2WWWA 4I2LC 5KTBA 2ZXEB 5APSA 3HUSA 1IFMA 3P32A 4AUWA 1JOCA 2R3CA 1X79B 3H6PA 1E5WA 5APWA 5APQA 4JYOX 3M9BA 4EIJA 5AVUB 2C9LY 2WPRA 3TK1A 2J3FD 1KILD 1KILB 1WRGA 1NOHA 2IPPA 2J2PA 3HTKB 5AW9B 2LKMA 3V4WA 1JY3N 1HH0A 1NTMK 3VMXA 4WY4A 4W7ZA 4JF7A 2J0HA 3L4FA 2IX7C 2WPSA 1NTZK 1HGZA 1ZN5A 3B5NC 2H43C 1H8AA 2J59M 1G2CB 4C7NB 2C9NY 1Z3SA 4ZFGA 2N9BA 3B5NA 1NU1K 2KLVA 2XNXC 2H43A 1GW4A 1LWUC 2WT7A 2J3OA 5BU5A 2GUVA 5APTA 2J1GA 2XNXA 3HRNA 3VMYA 2Z4EC 2J3GA 2H43B 2JJLA 3RK2D 1FZEA 2WTYA 1IK9A 1G1IA 1X8YA 3RK2B 2WZ7A 1LTSC 1IFDA 2HODB 2Z4EA 3M06A 2HPCA 1LWUB 1H89A 2JHHC 1NWQA 1CI6A 2MJZA 5AVZB 3TNUA 1QL2A 3HE4A 4JYCA 1FZAB 1JMMA 1CW5A 2ZFCA 1IC2A 3MGNA 1FZBB 3V5BA 1LTTC 3H32C 3L37A 2M8RA 2WSEH 3NTNA 1L0LK 1CSBA 2HFED 2I1KA 3I5CA 3C9IA 5BVZA 1HWTC 1RF1C 1S9KD 3BVHB 1N7SD 1OWAA 2A45I 1LTGC 3BATA 5AW2B 3H32B 1N7SB 5APXA 1KZUB 1FZFC 2P1JA 1FJPA 2GY7A 1RF0C 2Z5HA 1SP4A 2O1KA 1M7LA 3GHGC 1RY3A 1FDMA 1JY2P 1FZFA 4I6MC 1RF0A 3NFQA 3RL0C 1SLQA 3GHGA 1JY3P 3MTUE 5AVYB 3U1AA 1M1JB 3WMM0 1RF1B 1GW3A 1JNMA 4DOJA 2QM8A 3P8CE 5AVWB 4EOTA 5AW3B 4XA4A 5APUA 1MZ9A 5KJ7A 3IR9A 3RL0D 4EPUA 2W6AA 1SFCB 3OAKA 1IFIA 1MUUA 2NPSB 4N78D 2JHKF 3M0DC 3IFMA 1H88A 3M0AA 5APVA 4O9BA 1FZGB 3VYIA 1KILC 3M0DA 5BU8B 4W7YA 1ZR2A 3P8MC 1LTJB 2J3FA 2XV5A 1J1DB 3EFGA 1KILA 4B86A 1SQPK 3U1CA 5APYA 3HTKA 3II6A 1MFZA 4IFFA 1URQC 1FZCB 3V2RA 3M9HA 3A2AA 3EQ2A 1NTKK 2L5GB 4M7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  1LTJ A;  2J3O A;  2J61 B;  2HLO B;  2J1G A;  2XNX A;  1FZC C;  2J0Y A;  2Z4E C;  2J3G A;  2H43 B;  1FZE A;  2OYH B;  1FZC A;  1JC9 A;  2HOD B;  2Z4E A;  2HPC A;  1LWU B;  4R9J A;  2JHH C;  2Q9I B;  1FZA B;  2J61 A;  2HLO A;  1FZD A;  3HUS C;  1N86 B;  4M7F A;  2OYI B;  2OYH C;  1FZB B;  1RE3 B;  2HOD C;  3H32 C;  2WNP F;  1N73 B;  1T3U A;  2Q9I C;  1FZA C;  2JHI F;  2OYH A;  1JY2 O;  2HOD A;  1FZF B;  1N86 C;  1W2E A;  1RF0 B;  1LWU A;  2OYI C;  1FZB C;  1RE3 C;  3GHG B;  1JY3 O;  2Q9I A;  1FZA A;  3HUS B;  1N73 C;  1RE4 B;  1RF1 C;  4R9T A;  3BVH B;  1N86 A;  2A45 I;  1FZB A;  3H32 B;  2OYI A;  1RE3 A;  1FZF C;  2GY7 A;  1RF0 C;  3FIB A;  4JZC A;  2A45 H;  1N73 A;  3GHG C;  1RE4 C;  1JY2 P;  1FZF A;  3BVH C;  1RF0 A;  3GHG A;  1JY3 P;  2J64 A;  1FIC A;  2FFD B;  1M1J B;  1RF1 B;  3HUS A;  1RE4 A;  2FIB A;  3BVH A;  3E1I B;  3H32 A;  1FIB A;  2A45 G;  4JYO X;  2D39 A;  2FFD C;  1M1J C;  2J5Z A;  4EPU A;  4NYT A;  2J3F D;  3E1I C;  2J0G A;  1Z3U A;  2FFD A;  1M1J A;  2JHK F;  1RF1 A;  2J2P A;  2J60 A;  3E1I A;  1LT9 C;  1FZE C;  1JY3 N;  1FZG B;  1FID A;  2HPC C;  4M7H A;  1LT9 A;  2J0H A;  1LTJ B;  2J3F A;  2HLO C;  2J3U A;  2XNX B;  2JHM F;  1FZG C;  2JHL F;  2H43 C;  1LT9 B;  1FZE B;  1LTJ C;  1FZG A;  1FZC B;  1Z3S A;  4ZFG A;  2Z4E B;  2HPC B;  2XNX C;  2H43 A;  1LWU C; 
#chains in the Genus database with same CATH topology
 1JCD A;  2E75 D;  1NTK E;  2E75 B;  2V7Q H;  1FAV A;  1X9V A;  2J0Y A;  3W68 A;  2IBZ D;  1HBW A;  1URQ D;  2KI7 B;  1URQ B;  1G2C A;  3KXD A;  2HYN A;  4KJM A;  2HR3 A;  4AYC A;  3H1H E;  1HGV A;  2KP8 A;  1NTM J;  3L75 G;  1VF5 D;  1DEB A;  1VF5 B;  5GTH H;  2OTJ P;  1FZA C;  3L70 E;  3AEE C;  2BAS A;  2IBZ G;  1FZA A;  2WSC H;  1RE4 B;  4M3L A;  1DEE G;  2C0X A;  3UIA A;  1XTG B;  3MUD C;  2E76 D;  2W6B A;  1FIC A;  2FFD B;  2E76 B;  1L0N K;  2IZ0 A;  3MUD A;  2A45 G;  1L0N E;  2KSE A;  1L2P A;  2I1J A;  3T97 A;  1M1J C;  2K37 A;  3B8E B;  4PJ0 H;  4I7Z B;  4NYT A;  4HYT B;  1L4A D;  3CCV P;  1HJ0 A;  1L4A B;  3KHU A;  4D6T J;  1M1J A;  2H7H A;  3L71 D;  1S5L E;  2KS1 B;  4ZMD A;  1IO4 A;  4M7H A;  1KB9 I;  5K5G B;  2YKO A;  2E5Y A;  1RQV A;  2E42 A;  1FS0 E;  1PGO A;  1GL2 B;  1LTJ C;  1LTI C;  3TDK A;  2LR2 A;  1FOS F;  3L71 G;  2E74 D;  1LTJ A;  2E74 B;  1NTZ D;  2HLO B;  1USD A;  1FZC C;  1RH5 B;  3F5H A;  4AQR D;  2OYH B;  1FZC A;  3KQG A;  2Q9I B;  1KQL A;  2V7Q J;  2J61 A;  5CHX A;  2P2U A;  4OWF A;  3SFD C;  1N86 B;  2W27 A;  3CCE P;  2XDJ A;  3MZW B;  4Y99 B;  1S9K E;  1NTZ G;  2JHI F;  1EZV D;  3N4X A;  1JY3 O;  4H13 C;  1IZN B;  5KLV K;  1VL2 A;  3C8V A;  2BCC E;  3GG2 A;  3LW5 H;  5CJ4 A;  1JTH A;  3O6Q B;  4IOI H;  2FXP A;  5KLV E;  1SQX K;  2E43 A;  1YJN P;  3GF7 A;  1EDL A;  1KFM A;  1SQX E;  3VOP A;  2WSC J;  4BWN A;  3K5B A;  2J58 A;  3PTZ A;  3G9R A;  3G3Z A;  1EZV G;  5AW6 B;  4H0L B;  4WY4 D;  4WY4 B;  3FWL A;  3E1I C;  3P8C D;  2J0G A;  5H2F H;  1Z56 A;  2FKW B;  3E1I A;  3JCU H;  2GM4 A;  2WT7 B;  3L75 E;  2FYN B;  4GOD A;  2OGU A;  4XFJ A;  3IN6 A;  2J3U A;  1NHL A;  2P10 A;  3S9O A;  2QJK C;  3CCR P;  2IBZ E;  2HPC B;  1CI6 B;  2PGD A;  5AVS B;  3N7N A;  1HTL C;  1JC9 A;  5CCG C;  3O8Z A;  1OMI A;  1HJB A;  3H1K D;  1M1K Q;  5CCG A;  1MKM A;  1YJ9 P;  1N7L A;  1SQQ J;  3AE9 C;  4RO0 A;  2IDB A;  2JO1 A;  2OYI C;  3VP9 A;  1RE3 C;  3GHG B;  2HG5 D;  3CCL P;  3SWF A;  3RL0 B;  2OYI A;  1RE3 A;  3H1J D;  2PP6 A;  3H1K G;  1PGP A;  1N2D C;  3AEF C;  2G8Y A;  1ZR4 A;  2ZXE B;  5APS A;  3L72 D;  3H6P A;  4JYO X;  2PFX A;  3L71 E;  4UB8 E;  5AVU B;  2WPR A;  5TIS E;  3TK1 A;  1OVU A;  3H1J G;  2K9Y A;  3A0B H;  4BXL A;  4PV1 D;  3V4W A;  4OGQ D;  1HH0 A;  3VMX A;  4OGQ B;  2DW3 A;  4W7Z A;  3L72 G;  2J0H A;  3L4F A;  1NTZ K;  1HGZ A;  5GTI E;  4PD4 H;  1ZN5 A;  1NTZ E;  2H43 C;  4UB6 H;  1Z3S A;  3H1L J;  2XNX C;  2H43 A;  2KXP B;  2GUV A;  4YXD C;  5APT A;  2J1G A;  2XNX A;  2Z4E C;  2JJL A;  1FZE A;  1LTS C;  1IFD A;  2Z4E A;  3M06 A;  1D7M A;  4ASV A;  2JHH C;  3TNU A;  1JMM A;  1CW5 A;  2ZFC A;  1YI2 P;  1EZV E;  3V5B A;  3L37 A;  1PV3 A;  5L8R J;  2ITA A;  4K3A A;  2WSE H;  3AE5 C;  2HFE D;  3I5C A;  3C9I A;  5BVZ A;  4EYY Q;  1RF1 C;  5APX A;  2N9Y B;  1JEK A;  2M5A A;  3CME P;  1FDM A;  1JY2 P;  2IYP A;  4U3F J;  1PP9 J;  1X0T A;  1JNM A;  3P8C E;  1SQP G;  4XA4 A;  3Q3D A;  5KJ7 A;  3IR9 A;  5KAI H;  4NPD A;  3OAK A;  2NPS B;  2JHK F;  1QEX A;  1BE3 J;  1H88 A;  3M0A A;  2ZT9 C;  1FZG B;  3PH0 A;  1KIL C;  1QLE D;  1ZR2 A;  1J1D B;  4PD4 I;  1KIL A;  2OYO A;  1JMB A;  3D6Y A;  3U1C A;  5APY A;  1URQ C;  3V2R A;  2ZJS E;  3EQ2 A;  3WUV A;  1URQ A;  3H1K E;  2Q3I A;  4ZKU A;  2PAJ A;  1AVY A;  4EDF A;  2P7J A;  1S4X A;  2AXT E;  4HH2 A;  4U7J A;  1DD4 A;  2HOD C;  1M57 D;  1VQ9 P;  1QL1 A;  3HD7 D;  3H1J E;  2HOD A;  2KIK A;  3TSI A;  3HD7 B;  1GK4 A;  2GUS A;  1LWU A;  3HE5 B;  1FZB C;  3L36 A;  2E76 C;  2R5B A;  1NU1 J;  2KSJ A;  1FZB A;  3SWY A;  1NH4 A;  2ZYD A;  3L72 E;  1FOS E;  1NYH A;  3VMA A;  4I7Z C;  1Y9B A;  4IFD K;  2YMY A;  5KKZ B;  1A02 J;  1JUN A;  4XE5 B;  3H32 A;  1VDF A;  1YIJ P;  5CBN A;  3CD6 P;  2J60 A;  2BCC D;  1VQK P;  2Y0C A;  2CPS A;  1PL5 A;  3RK3 B;  2HLO C;  1OFC X;  3PRJ A;  1PZQ A;  3M9Q A;  1SFC D;  2FBW C;  4RES B;  3L35 A;  2FYZ A;  2QJP B;  3OW2 O;  3L74 J;  4RKU J;  2BCC G;  3VMZ A;  1J2J B;  4BRY B;  4LC1 A;  1YTZ T;  1KB9 H;  1H0T B;  2N1T B;  4LLH A;  3KPE A;  4GOF A;  5AW7 B;  1LTA C;  4Z1M H;  1YQ3 C;  3JSV C;  4OH8 B;  3V2N A;  1W2E A;  2K88 A;  3HUS B;  1N73 C;  2IFM A;  1NTK J;  3VTP C;  3AE4 C;  2C0W A;  4LGD E;  1N73 A;  1AQT A;  4WY4 C;  5AVV B;  2KZJ A;  3H1H J;  1EXI A;  4JYB A;  1LP1 B;  3TGU D;  5B66 E;  1M8O B;  4EI2 A;  2QVA A;  3GW6 A;  1FU1 A;  3LIE A;  3L70 J;  1BCC D;  4YTP C;  2B87 B;  2O01 N;  3B5N D;  3W67 A;  1FID A;  2R3S A;  3B5N B;  2HPC C;  3CLQ A;  2IYO A;  3TGU G;  1ZOY C;  1FJK A;  2YXR B;  1LT9 B;  2KNC A;  1BCC G;  1L0N J;  1KV4 A;  2K1A A;  1OVR A;  3HE4 B;  3V2Q A;  1QGK B;  1KYO D;  2YKQ A;  1ZV8 A;  2M3B A;  5CCH C;  3QH9 A;  5CCH A;  1VQ8 P;  1GL2 D;  1TU3 F;  1AV1 A;  2WNP F;  4DZO A;  2YXQ B;  1PGQ A;  1RF0 B;  2O01 J;  5AVT B;  2FXO A;  3AE1 C;  2I8D A;  3BRV B;  2Y9Z A;  1U7M A;  1CZQ A;  1VPC A;  2A45 H;  3LID A;  4GIF A;  3H1L D;  1A02 F;  1J1E B;  1S3J A;  1S1C X;  4NPF X;  2KUB A;  4WVZ A;  5KTB A;  2D2C D;  3P32 A;  3TF5 A;  2D2C B;  1X79 B;  3WU2 E;  5APQ A;  2WSS H;  4PV1 C;  2KK7 A;  1OIP A;  1NOH A;  2XND H;  5C39 A;  2IPP A;  1W5C E;  2J2P A;  5AW9 B;  1OZH A;  3FXE A;  3CCU P;  5KLV J;  3MHV A;  2FY8 A;  1SQX J;  4H0L D;  1WMK A;  3H1I J;  2FYU D;  4H44 C;  4Y28 J;  1T6A A;  2J59 M;  1G2C B;  2N9B A;  2J3O A;  3VMY A;  2AEM A;  3CWB D;  1HF9 A;  2WTY A;  2IBZ I;  2FYU G;  4PJ0 E;  1NWQ A;  2MJZ A;  5AVZ B;  1FZA B;  3L75 J;  3MGN A;  2AEJ A;  2QJY B;  1LTT C;  1ZRT D;  3Q1M A;  2M8R A;  1PIX A;  2SPZ A;  2E5T A;  3CWB G;  3G6E P;  1HWT C;  2K9J A;  1OWA A;  2A45 I;  1LTG C;  1KZU B;  1FZF C;  2P1J A;  2GY7 A;  1VQ4 P;  4A7P A;  3T97 B;  3TGU E;  1FZF A;  1K04 A;  2A06 D;  1SLQ A;  3FX0 A;  3MTU E;  3U1A A;  4PD4 D;  1M1J B;  3WMM 0;  2WMM A;  4IL6 X;  1BCC E;  3ITK A;  1Q2N A;  2BEZ F;  5B5E H;  5APU A;  2Y0E A;  3RL0 D;  1YQ4 C;  4EPU A;  1BGY D;  2W6A A;  1IFI A;  1MUU A;  4N78 D;  3IFM A;  4DT0 A;  1SS1 A;  2A06 G;  4O9B A;  3VYI A;  4GOE A;  1LTJ B;  4IL6 H;  2J3F A;  2XV5 A;  1QX8 A;  3D6Z A;  1KD1 Q;  1AVO A;  1USE A;  3HTK A;  1BGY G;  1YIT P;  3SWK A;  3Q2Y A;  1KYO E;  1FZC B;  3A2A A;  3BAS A;  3L71 J;  2L5G B;  3CX5 H;  4M7F A;  1SQV D;  2J61 B;  1YYC A;  1KQG B;  1LNQ A;  4C7N A;  1FDI A;  4KHX A;  3HD7 C;  3RK2 C;  2WIT A;  3AEA C;  1IFP A;  1P84 D;  1JTH B;  1NTZ J;  1SQV G;  2WVR A;  3L73 D;  1E79 H;  4GT1 A;  3CPW O;  4L75 A;  4IFM A;  1NO4 A;  3H1L E;  2IFN A;  1EZV I;  4ZKP A;  1T2K D;  3CXH H;  3BVH C;  3TYY A;  1N7S C;  4N3Y B;  3AE2 C;  2J64 A;  3L73 G;  1SQB D;  3BVH A;  3E1I B;  2M3E A;  3ABV C;  3NXS A;  1N7S A;  3VN0 A;  3BCC D;  1NGM B;  1YTZ I;  1VQN P;  4HKZ H;  1N8R Q;  1RF1 A;  2RH0 A;  2FYU K;  3BRT B;  3CCS P;  1SFC C;  5CMZ A;  3CC4 P;  4R4L A;  2FYU E;  1SQB G;  1SFC A;  2QIW A;  1Q82 Q;  4U3F E;  1T3J A;  3Q5R A;  1JCC A;  3BCC G;  1PFI A;  1R5S A;  2NPS D;  3CX5 I;  1NTM D;  3CWB E;  1DX7 A;  5AVR B;  4W80 A;  2ZAE B;  1LT1 A;  2H88 C;  1ZP0 C;  3GLM A;  3A7O A;  4HB1 A;  1JB0 J;  2JEE A;  3WUU A;  2AXC A;  3KZI E;  1ZRT E;  2E75 C;  1LJ2 A;  4R9J A;  2WSF H;  1Q90 D;  3HUS C;  1NTM G;  2OYI B;  3A0B E;  1YJW P;  1RE3 B;  1T3U A;  2W83 C;  1Q86 Q;  1JY2 O;  1VF5 C;  4R9T A;  1LTB C;  2A06 E;  3CXH I;  4DCK A;  1GU4 A;  4PD4 E;  1GTW A;  3H1K J;  2G3A A;  1WT6 A;  4UB6 E;  4D6T D;  3SFE C;  1SVF A;  1RE4 C;  2V4H A;  3KDP B;  4NPE A;  3B71 A;  2KB7 P;  3S1K A;  1BGY E;  1HUC A;  1RE4 A;  3PP5 A;  3Q5P A;  4N78 E;  1NKZ B;  1FIB A;  2D39 A;  1EDK A;  4WB4 A;  2FFD C;  1DIP A;  1AA0 A;  2XU6 A;  3H25 A;  2POH A;  3H1J J;  5DJU B;  2FFD A;  2R44 A;  2QEX P;  4D6T G;  3KYQ A;  3NMD A;  1GK6 A;  1LT9 C;  1K05 A;  1KB9 D;  1L4A C;  3AEC C;  3L72 J;  1LT9 A;  1SQV K;  5KLI B;  1L4A A;  2XNX B;  3S4R A;  1SQV E;  2Q6Q A;  2JHL F;  5KAF E;  2KOG A;  1FZE B;  2KS1 A;  3EWK A;  3MD0 A;  1S5L X;  1VQ6 P;  1R8E A;  2Z4E B;  3WUT A;  4DJG A;  1L0L J;  3TNU B;  5AW1 B;  3V4Q A;  1GL2 C;  3CC2 P;  2WPQ A;  1KOR A;  1RQU A;  3U59 A;  3JC2 2;  1GL2 A;  3RK3 D;  1MV8 A;  2E74 C;  1P84 E;  3L73 E;  2LXC B;  5KAI E;  1ZXG A;  1PPJ D;  2HLO A;  1FZD A;  2JR8 A;  1S5L H;  1KQF B;  2OYH C;  5E79 E;  5DJT B;  2RKL A;  2M5A B;  2Q9I C;  2OYH A;  1J1E C;  1N86 C;  3G4S P;  2WSF J;  1R5L A;  2M0B A;  2Q9I A;  4Y99 C;  1KFN A;  3H1I D;  1SQB K;  1N86 A;  2N1T D;  4JZC A;  1SQB E;  5KJ7 D;  3P7K A;  1PPJ G;  2QG4 A;  2O01 H;  1FC2 C;  3BCC E;  3D71 A;  4I2L C;  1OX3 A;  3CCM P;  1IFM A;  1SQP J;  2R3C A;  2NRG A;  3O6Q A;  3M9B A;  2PRR A;  2C9L Y;  3A0H E;  2ZT9 D;  1KIL D;  2ZT9 B;  1KIL B;  4H0L C;  3G71 P;  3E1R A;  1NTM K;  3WU2 H;  4WY4 A;  4JF7 A;  1Q81 Q;  1NTM E;  3USS A;  2QE7 H;  3RL0 g;  2FYN C;  4ZNC A;  4ZFG A;  1KN7 A;  1SQQ D;  1VQM P;  1GW4 A;  3AE7 C;  2WT7 A;  3AEG C;  5BU5 A;  2QJY C;  1IK9 A;  3IF4 A;  2WZ7 A;  4RJT A;  4KT0 J;  4QMA A;  2HOD B;  2HPC A;  1LWU B;  4TLF A;  1H89 A;  1CI6 A;  3SSU A;  1QL2 A;  4JYC A;  4TT3 H;  1FZB B;  3IAO A;  2O3J A;  1SQQ G;  3MP7 B;  3FXD A;  4D6T E;  1VQL P;  3H32 B;  2Z5H A;  2O1K A;  3GHG C;  2B9B A;  2OTL P;  2UWJ E;  4I6M C;  3RL0 C;  2H89 C;  1JY3 P;  3GHG A;  5AVY B;  1GW3 A;  5AVW B;  4EOT A;  4L76 A;  3RBZ A;  1KB9 E;  3CC7 P;  1GMJ A;  1W2B O;  1KTM A;  5BU8 B;  3P8M C;  3EFG A;  3C1L A;  1OW7 A;  4B86 A;  1UII A;  4OGQ C;  2YIU B;  3II6 A;  3R4Y A;  4IFF A;  5CBO A;  3H1L G;  1QVG O;  3RK3 E;  1JY2 N;  3RBX A;  1Y8A A;  2BCC J;  5GTH E;  1X22 A;  1PPJ E;  2YO2 A;  3M91 A;  4UB8 H;  5TIS H;  1AQ5 A;  3AE8 C;  1G1J A;  1U7J A;  1KYO H;  3V6I A;  3FGA D;  2B89 A;  1GZL A;  1MFT A;  4K35 A;  4U3F D;  1PP9 D;  3RGU A;  1N73 B;  3H1I E;  2Z5I A;  1T2K C;  1IFN A;  4I1L A;  3CL3 D;  5GTI H;  2RMZ A;  3PLN A;  4YPC A;  2QA4 P;  2W6J H;  4N6J A;  2OAR A;  1BE3 D;  2CPB A;  4U3F G;  1PP9 G;  3EFF K;  1DH3 A;  2JKV A;  2FIB A;  1KIL E;  1YBK A;  3CI9 A;  1NVO A;  5AW8 B;  4R4M A;  3AE3 C;  3CX5 D;  2ZVN B;  2J5Z A;  1GD2 E;  5AVX B;  5M1B A;  1OXZ A;  3OJA B;  1BE3 G;  2YMK A;  5AW0 B;  2KNC B;  1NKN A;  1AJY A;  2NPS C;  4WBA A;  1SQQ K;  2XKM A;  3TGU J;  3CCJ P;  4CPG A;  2NPS A;  1SQQ E;  1XTC C;  2JHM F;  1FZG C;  1KMI Z;  1BCC J;  1J1D C;  5CCH D;  1FZG A;  1LGH B;  1AFO A;  2BEQ D;  4JQ0 D;  1K8A Q;  4C7R A;  4GKG A;  3B4S A;  3CXH D;  5AVQ B;  1KYO I;  4JPZ B;  1NU1 D;  3FWN A;  2KYV A;  4HJG H;  2ZYG A;  1IK7 A;  3VP8 A;  4MN4 C;  3LW5 J;  5CJ0 A;  3KZI H;  1NAF A;  2JWA A;  1ZLL A;  2ZYA A;  1EXJ A;  1NU1 G;  1HVV A;  1BSN A;  2Q7C A;  1KC8 Q;  2W8Z A;  1EDI A;  1L0L D;  3HD7 A;  1OVV A;  4PV1 B;  3HE5 A;  1IFJ A;  4H13 D;  5H2F E;  3OA7 A;  2R5D A;  3AEB C;  4H13 B;  3JCU E;  1ZME C;  4OVN F;  2QSI A;  3F89 A;  1FDO A;  1EDJ A;  3ZDM A;  2P67 A;  2W90 A;  5KKZ C;  2AXT H;  1JO5 A;  1FE6 A;  2XZR A;  5KLI C;  1DD3 A;  2OQQ A;  1Z3U A;  2R32 A;  3I56 P;  2VRS A;  1L0L G;  1Q7Y Q;  1FZE C;  1EQ7 A;  2Q3E A;  1T8Z A;  3L74 D;  2KZI A;  5AW4 B;  4H44 D;  1VQ7 P;  4H44 B;  1M56 D;  3V2P A;  1GDT A;  1FBM A;  2YO3 A;  3I55 P;  3RK3 C;  1EC5 A;  3CMA P;  2YNY A;  2RN0 A;  1ZW0 A;  3L74 G;  1SQP D;  4L74 A;  2QM7 A;  2QJK B;  2K3R A;  2JDI H;  2MKV A;  1KQS O;  2ZXX A;  2QJP C;  5B5E E;  5KAF H;  1NTK D;  1PP9 E;  2FYU J;  3A5T A;  3MIW A;  2FXM A;  2O1J A;  4C46 A;  2ZVO B;  1BDC A;  2K9J B;  4BRY A;  1S72 P;  3H1H D;  2N1T C;  4YXW H;  1IJD B;  5CCG D;  5KJ7 C;  1QVF O;  1FZF B;  1H0T A;  1NJI Q;  2GA1 A;  3CWB J;  2N1T A;  1JM0 A;  1P84 H;  3PHL A;  1BE3 E;  3GF3 A;  4IL6 E;  3A3Y B;  4JBZ A;  5AW5 B;  1NTK G;  1GU5 A;  2H8P D;  3L70 D;  3FIB A;  5E79 H;  2YKP A;  2Q5U A;  3CX5 E;  3R2P A;  2WWW A;  3H1H G;  3HUS A;  4AUW A;  3AE6 C;  1JOC A;  1PGJ A;  1E5W A;  5APW A;  3GMA A;  4EIJ A;  4GDO A;  2Q1K A;  2J3F D;  2NZ2 A;  1YHQ P;  1NAY A;  3AED C;  3L70 G;  1WRG A;  1L0N D;  1LP1 A;  3HTK B;  1S2E A;  2LKM A;  1Y47 A;  1JY3 N;  2IX7 C;  2WPS A;  2LXB A;  5EFW B;  3A0H H;  1VQ5 P;  3QWO C;  2OTK E;  1VQO P;  1BGY J;  3B5N C;  4WWI A;  1H8A A;  2B87 A;  4C7N B;  2C9N Y;  3CXH E;  1L0N G;  2Y9Y A;  1NU1 K;  2KLV A;  3B5N A;  1LWU C;  3PJS K;  1NU1 E;  1OW8 A;  5B66 H;  3HRN A;  3D70 A;  1BSH A;  2J3G A;  2H43 B;  2IZ1 A;  3RK2 D;  3RK2 B;  1G1I A;  1X8Y A;  5TJH A;  1K9M Q;  1BDD A;  3CCQ P;  2WSE J;  3HE4 A;  3E7K A;  1IC2 A;  3H32 C;  2WPV B;  1SQV J;  2CK3 H;  4ASW A;  1P84 I;  3NTN A;  1L0L K;  2WQY C;  1CSB A;  1UIX A;  2I1K A;  1L0L E;  1S9K D;  3BVH B;  1N7S D;  3BAT A;  5AW2 B;  1N7S B;  1FJP A;  1RF0 C;  2QRX A;  1SP4 A;  1M7L A;  1RY3 A;  4L73 A;  2B88 A;  2Y0D A;  1RF0 A;  3NFQ A;  3L73 J;  1RF1 B;  5KLV D;  4DOJ A;  2QM8 A;  5AW3 B;  1M90 Q;  1SQX D;  1MZ9 A;  1RHZ B;  2D2C C;  1OW6 A;  1SFC B;  3L74 E;  2AEF A;  2P58 A;  2JP3 A;  3M0D C;  2YIU C;  5APV A;  3Q5S A;  1U57 A;  3M0D A;  1SQB J;  4W7Y A;  5KLV G;  1K73 Q;  2JWD A;  2L91 A;  1SQX G;  3BCC J;  1SQP K;  2J5U A;  3H1I G;  2KLU A;  1SQP E;  1MFZ A;  3L75 D;  3M9H A;  1NTK K;  1VQP P; 
#chains in the Genus database with same CATH homology
 1JY2 N;  1JCD A;  2J61 B;  1URQ A;  1YYC A;  1FAV A;  1X9V A;  2J0Y A;  2Q3I A;  2YO2 A;  4ZKU A;  1HBW A;  1URQ D;  2PAJ A;  3M91 A;  1URQ B;  1G2C A;  4C7N A;  2HYN A;  1AQ5 A;  4AYC A;  1G1J A;  4KHX A;  3HD7 C;  1HGV A;  1GZL A;  2P7J A;  2KP8 A;  4HH2 A;  3RK2 C;  2WIT A;  1DEB A;  2HOD C;  1JTH B;  1N73 B;  1QL1 A;  2Z5I A;  1FZA C;  1T2K C;  3HD7 D;  1IFN A;  4GT1 A;  2HOD A;  4I1L A;  3HD7 B;  3TSI A;  1GK4 A;  2GUS A;  1LWU A;  1NO4 A;  3HE5 B;  4IFM A;  1FZB C;  2BAS A;  3CL3 D;  3L36 A;  1FZA A;  2WSC H;  1RE4 B;  2R5B A;  2IFN A;  2KSJ A;  4M3L A;  1FZB A;  3SWY A;  1NH4 A;  4ZKP A;  4N6J A;  1T2K D;  2OAR A;  1FOS E;  2C0X A;  3UIA A;  2CPB A;  3BVH C;  3TYY A;  1XTG B;  4IFD K;  1N7S C;  4N3Y B;  2W6B A;  2J64 A;  1FIC A;  2YMY A;  2FFD B;  1DH3 A;  1L0N K;  1A02 J;  2FIB A;  1JUN A;  3BVH A;  3E1I B;  3NXS A;  3H32 A;  1N7S A;  3CI9 A;  1VDF A;  3MUD A;  4XE5 B;  3VN0 A;  2A45 G;  5AW8 B;  2I1J A;  3T97 A;  1M1J C;  3B8E B;  2J5Z A;  4NYT A;  4HYT B;  1GD2 E;  1L4A D;  1YTZ I;  1L4A B;  5AVX B;  1M1J A;  1RF1 A;  2H7H A;  1OXZ A;  3OJA B;  2J60 A;  2FYU K;  3BRT B;  5AW0 B;  1SFC C;  1NKN A;  5CMZ A;  1IO4 A;  2NPS C;  4WBA A;  1SQQ K;  2XKM A;  4M7H A;  1SFC A;  2CPS A;  2YKO A;  3RK3 B;  2HLO C;  2NPS A;  2E42 A;  1T3J A;  1XTC C;  1JCC A;  2JHM F;  1FZG C;  3M9Q A;  1PFI A;  1SFC D;  1GL2 B;  4RES B;  2NPS D;  1LTJ C;  1LTI C;  1J1D C;  3L35 A;  2FYZ A;  5CCH D;  1LGH B;  1FZG A;  1AFO A;  1DX7 A;  5AVR B;  4W80 A;  1FOS F;  1LTJ A;  2HLO B;  3A7O A;  4C7R A;  4GKG A;  3VMZ A;  1J2J B;  1FZC C;  4LC1 A;  5AVQ B;  2JEE A;  4AQR D;  2OYH B;  1YTZ T;  1FZC A;  3KQG A;  2N1T B;  2KYV A;  4R9J A;  4LLH A;  3KPE A;  2Q9I B;  1KQL A;  2WSF H;  2J61 A;  3HUS C;  5CHX A;  2P2U A;  1N86 B;  2W27 A;  2OYI B;  5AW7 B;  1LTA C;  1RE3 B;  3VP8 A;  2XDJ A;  4Y99 B;  1S9K E;  1T3U A;  4OH8 B;  5CJ0 A;  2JHI F;  3V2N A;  1JY2 O;  1W2E A;  1NAF A;  3N4X A;  1JY3 O;  3HUS B;  1N73 C;  1ZLL A;  2IFM A;  3VTP C;  5KLV K;  1LTB C;  4R9T A;  1GU4 A;  3LW5 H;  5CJ4 A;  1GTW A;  1JTH A;  2C0W A;  1HVV A;  4LGD E;  2Q7C A;  1SQX K;  2E43 A;  1N73 A;  1WT6 A;  1SVF A;  1RE4 C;  4WY4 C;  3KDP B;  5AVV B;  1KFM A;  3HD7 A;  3VOP A;  3HE5 A;  1IFJ A;  3OA7 A;  4JYB A;  2R5D A;  2KB7 P;  1HUC A;  1RE4 A;  2J58 A;  3PP5 A;  4N78 E;  1NKZ B;  1FIB A;  3G3Z A;  5AW6 B;  4WY4 D;  2D39 A;  1FU1 A;  4WB4 A;  2FFD C;  2P67 A;  4WY4 B;  3LIE A;  2XU6 A;  2POH A;  3E1I C;  1JO5 A;  3P8C D;  2XZR A;  2J0G A;  1Z3U A;  2FFD A;  2R32 A;  1Z56 A;  3KYQ A;  2FKW B;  2VRS A;  3NMD A;  3E1I A;  1GK6 A;  1LT9 C;  1FZE C;  1EQ7 A;  1T8Z A;  1L4A C;  3B5N D;  5AW4 B;  1FID A;  3B5N B;  2GM4 A;  2HPC C;  3CLQ A;  1LT9 A;  2WT7 B;  1SQV K;  1L4A A;  1FJK A;  2J3U A;  2XNX B;  1NHL A;  3V2P A;  1GDT A;  1FBM A;  2YO3 A;  2JHL F;  1LT9 B;  1FZE B;  2KOG A;  3MD0 A;  3RK3 C;  2Z4E B;  2HPC B;  1CI6 B;  3TNU B;  3HE4 B;  2YNY A;  5AVS B;  5AW1 B;  3V2Q A;  3V4Q A;  3N7N A;  1GL2 C;  2WPQ A;  2YKQ A;  2QM7 A;  1ZV8 A;  2M3B A;  3U59 A;  5CCH C;  1GL2 A;  3RK3 D;  1MV8 A;  1HTL C;  1JC9 A;  5CCG C;  5CCH A;  3A5T A;  3BAS A;  3MIW A;  3O8Z A;  1HJB A;  2FXM A;  1GL2 D;  2O1J A;  4C46 A;  2HLO A;  1FZD A;  5CCG A;  1N7L A;  2OYH C;  2WNP F;  2N1T C;  4DZO A;  1IJD B;  2Q9I C;  5CCG D;  5KJ7 C;  2OYH A;  1FZF B;  1J1E C;  1N86 C;  1RF0 B;  2N1T A;  2OYI C;  1RE3 C;  3VP9 A;  3GHG B;  5AVT B;  2HG5 D;  2Q9I A;  3BRV B;  3A3Y B;  4Y99 C;  1KFN A;  1N86 A;  1SQB K;  3SWF A;  5AW5 B;  3RL0 B;  1CZQ A;  2N1T D;  1GU5 A;  2H8P D;  2OYI A;  1RE3 A;  3FIB A;  2PP6 A;  4JZC A;  1VPC A;  2A45 H;  5KJ7 D;  3P7K A;  3LID A;  2YKP A;  2O01 H;  4GIF A;  1A02 F;  2Q5U A;  1J1E B;  1N2D C;  1ZR4 A;  3R2P A;  2WWW A;  4I2L C;  5KTB A;  2ZXE B;  5APS A;  3HUS A;  1IFM A;  3P32 A;  4AUW A;  1JOC A;  2R3C A;  1X79 B;  3H6P A;  1E5W A;  5APW A;  5APQ A;  4JYO X;  3M9B A;  4EIJ A;  5AVU B;  2C9L Y;  2WPR A;  3TK1 A;  2J3F D;  1KIL D;  1KIL B;  1WRG A;  1NOH A;  2IPP A;  2J2P A;  3HTK B;  5AW9 B;  2LKM A;  3V4W A;  1JY3 N;  1HH0 A;  1NTM K;  3VMX A;  4WY4 A;  4W7Z A;  4JF7 A;  2J0H A;  3L4F A;  2IX7 C;  2WPS A;  1NTZ K;  1HGZ A;  1ZN5 A;  3B5N C;  2H43 C;  1H8A A;  2J59 M;  1G2C B;  4C7N B;  2C9N Y;  1Z3S A;  4ZFG A;  2N9B A;  3B5N A;  1NU1 K;  2KLV A;  2XNX C;  2H43 A;  1GW4 A;  1LWU C;  2WT7 A;  2J3O A;  5BU5 A;  2GUV A;  5APT A;  2J1G A;  2XNX A;  3HRN A;  3VMY A;  2Z4E C;  2J3G A;  2H43 B;  2JJL A;  3RK2 D;  1FZE A;  2WTY A;  1IK9 A;  1G1I A;  1X8Y A;  3RK2 B;  2WZ7 A;  1LTS C;  1IFD A;  2HOD B;  2Z4E A;  3M06 A;  2HPC A;  1LWU B;  1H89 A;  2JHH C;  1NWQ A;  1CI6 A;  2MJZ A;  5AVZ B;  3TNU A;  1QL2 A;  3HE4 A;  4JYC A;  1FZA B;  1JMM A;  1CW5 A;  2ZFC A;  1IC2 A;  3MGN A;  1FZB B;  3V5B A;  1LTT C;  3H32 C;  3L37 A;  2M8R A;  2WSE H;  3NTN A;  1L0L K;  1CSB A;  2HFE D;  2I1K A;  3I5C A;  3C9I A;  5BVZ A;  1HWT C;  1RF1 C;  1S9K D;  3BVH B;  1N7S D;  1OWA A;  2A45 I;  1LTG C;  3BAT A;  5AW2 B;  3H32 B;  1N7S B;  5APX A;  1KZU B;  1FZF C;  2P1J A;  1FJP A;  2GY7 A;  1RF0 C;  2Z5H A;  1SP4 A;  2O1K A;  1M7L A;  3GHG C;  1RY3 A;  1FDM A;  1JY2 P;  1FZF A;  4I6M C;  1RF0 A;  3NFQ A;  3RL0 C;  1SLQ A;  3GHG A;  1JY3 P;  3MTU E;  5AVY B;  3U1A A;  1M1J B;  3WMM 0;  1RF1 B;  1GW3 A;  1JNM A;  4DOJ A;  2QM8 A;  3P8C E;  5AVW B;  4EOT A;  5AW3 B;  4XA4 A;  5APU A;  1MZ9 A;  5KJ7 A;  3IR9 A;  3RL0 D;  4EPU A;  2W6A A;  1SFC B;  3OAK A;  1IFI A;  1MUU A;  2NPS B;  4N78 D;  2JHK F;  3M0D C;  3IFM A;  1H88 A;  3M0A A;  5APV A;  4O9B A;  1FZG B;  3VYI A;  1KIL C;  3M0D A;  5BU8 B;  4W7Y A;  1ZR2 A;  3P8M C;  1LTJ B;  2J3F A;  2XV5 A;  1J1D B;  3EFG A;  1KIL A;  4B86 A;  1SQP K;  3U1C A;  5APY A;  3HTK A;  3II6 A;  1MFZ A;  4IFF A;  1URQ C;  1FZC B;  3V2R A;  3M9H A;  3A2A A;  3EQ2 A;  1NTK K;  2L5G B;  4M7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...