1FZCC

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRIN
total genus 92
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcC02
1M1JC 1RE4C 1LTJA 2Z4EA 1JY2P 1LT9A 2J61B 1FZAB 3GHGB 2OYHA 1FZCC 4M7FA 3FIBA 2Z4EB 4JYOX 3HUSB 1FZEA 1FZBA 1JC9A 4M7HA 1FIDA 4NYTA 2JHKF 2J60A 3BVHB 2H43C 2HPCC 2H43A 3GHGC 1FZAA 2OYIC 1FZBB 3E1IA 1RF1C 1Z3SA 2J3FD 3E1IC 2HODC 1W2EA 2XNXC 3E1IB 1JY2N 2FFDC 1LT9B 1N86A 2J0HA 2OYHC 1RF1B 2HLOC 4ZFGA 1FIBA 1N73A 1JY3O 1LT9C 1LWUB 2A45H 2OYHB 3BVHA 1LTJC 3H32A 1FICA 1Z3UA 1LTJB 2J5ZA 2J3OA 2Q9IB 1M1JB 1RE4B 4JZCA 3HUSC 1JY3P 1RE3B 2J64A 2D39A 2J61A 2FFDA 1N86B 3H32B 3BVHC 1RE3C 2HODA 2HPCB 2Q9IA 4EPUA 4R9TA 1FZDA 2JHIF 2J2PA 1FZEB 1RF0B 1FZAC 2FIBA 2J0GA 1N86C 2H43B 2HPCA 2HODB 2JHMF 1FZGC 1RF0C 2J3FA 2OYIB 1RF0A 2JHLF 1JY3N 1FZFA 2J0YA 2J1GA 1RF1A 2XNXA 1FZFC 1FZEC 3GHGA 1FZFB 2GY7A 2OYIA 2FFDB 1RE3A 1M1JA 1RE4A 1FZGA 2WNPF 2XNXB 2J3UA 2HLOB 1FZBC 2JHHC 3H32C 1FZCA 1T3UA 1LWUC 2A45I 1FZGB 2Q9IC 1LWUA 1JY2O 1N73B 2Z4EC 1FZCB 2HLOA 1N73C 2A45G 2J3GA 3HUSA 4R9JA
chains in the Genus database with same CATH superfamily
3VMZA 3M0AA 2BCCJ 4WY4A 4HJGH 4R4MA 2QJYC 5CCGA 4L73A 4JYOX 2KOGA 1FS0E 1WRGA 4K3AA 4EOTA 1ZOYC 1VQKP 1Y9BA 4W7ZA 3L36A 3M9HA 3E1IB 3HD7A 1BE3J 2L5GB 4M3LA 5KLVD 1N73A 1JCDA 1L0LE 2A45H 3AEFC 2E5YA 3SFDC 5AW1B 1MKMA 4I6MC 4D6TG 1VPCA 3T97A 2WSEH 2D39A 1N86B 1S4XA 1GMJA 1OX3A 1L0LJ 3O6QA 3H1JG 3CMAP 4IL6X 2J59M 3CWBJ 1T3JA 2J3FA 2R32A 3CWBG 1SQPJ 3RK2C 3L75J 2WPSA 1GD2E 3GHGA 2YO3A 5B5EH 4Y99B 2FYUJ 2E76B 1L0LK 1SQPE 3M0DA 2JO1A 1R5LA 1SFCD 3II6A 5APYA 1K04A 1N73B 1USEA 1T8ZA 1CI6A 2IFNA 4PV1C 4H13B 3OA7A 2KSJA 5KLVG 4M7FA 3L72G 2AEMA 1JB0J 2W6AA 3KQGA 1FE6A 2FYNB 3H1LG 1NTME 3BVHB 2P10A 4H44D 1MV8A 3K5BA 2RKLA 2YIUB 3L73D 1X0TA 2PFXA 1Q81Q 2HLOC 3AE6C 3L70D 1Q82Q 2O01J 2AEJA 3M9QA 2J58A 4PV1B 5B5EE 2OARA 3MD0A 1L4AC 1RQVA 3AECC 2E75C 2A06G 3PRJA 2IYOA 1HGVA 3C8VA 2R3CA 4EIJA 4OGQB 5M1BA 3GMAA 1AA0A 2JWAA 1N7SD 1RF0B 1FZAC 1LTGC 2YIUC 2JHLF 1JY3N 3TNUA 2QEXP 1RF1A 1KB9I 2WQYC 3HD7D 4WY4D 1DIPA 3V4WA 3CCVP 2UWJE 1RE3A 1R8EA 2KXPB 2J3UA 1PGOA 4H13C 2IBZG 4OWFA 3H1HG 3L71G 1LWUA 4OVNF 2GUVA 3FWLA 1KQGB 2QIWA 3KPEA 1GL2C 2OQQA 4WWIA 1NTMD 2E76C 1KORA 2K9YA 3VP8A 3HUSB 1FZEA 1GU4A 2E42A 1U7MA 2FYZA 3PJSK 3D6YA 1NOHA 1FZAA 3VMAA 2D2CC 1VQPP 4W7YA 3HE4B 1RF1C 1Z3SA 2NPSA 1BE3G 3BCCJ 2IPPA 1DEBA 1IFDA 5CCHA 3BCCG 2D2CB 3CC7P 3CWBE 1EZVG 1GZLA 3KYQA 4DT0A 2AXCA 4GODA 3WMM0 3CMEP 3I5CA 1FDIA 2OYHB 2E76D 2E74C 1G2CA 5CBNA 2C9NY 1AV1A 2PP6A 3R4YA 5KJ7D 2FFDA 5KLVK 1L2PA 2WT7B 2HPCB 3BATA 3RL0D 1KB9H 1J1EB 1E79H 1PP9J 1N7LA 2JEEA 1FZEB 3L72E 1BCCD 1NTMG 4N78E 4UB6E 1OVRA 3NMDA 5B66E 1SFCC 2MKVA 1NTMJ 3V5BA 3GG2A 4ASVA 1OVUA 2Y0DA 2O1JA 2YKPA 3RK3E 1FZCB 2E74B 2OYOA 1GU5A 1JTHA 1QGKB 1PGJA 2OYHA 1FZCC 3WU2H 5KAFH 1KB9D 1L4AB 4JYBA 1FZBA 1FIDA 1S2EA 2H43C 2BCCE 3B4SA 2Q6QA 5BVZA 2M5AB 1NTKK 1KFNA 1SQBE 3P7KA 1FOSE 2J0HA 5GTHE 5H2FH 2JKVA 5AW8B 4D6TE 2E43A 3HTKA 1P84H 4JPZB 2ITAA 1FICA 1Q90D 3F5HA 1YBKA 1NU1J 2OTLP 1L0NK 2R5BA 4EYYQ 1DX7A 1BDCA 4KJMA 4N6JA 2KNCA 3RK3C 3KXDA 1LTSC 4N3YB 5KAFE 4NPDA 3WU2E 2HPCA 2YXQB 2WT7A 2IFMA 1CW5A 2J0YA 2XNXA 2WSSH 1KQFB 1SQPG 1IFNA 3F89A 4PJ0H 2QM7A 5CJ4A 4YTPC 2O3JA 3U1CA 4MN4C 1GL2D 1H0TA 1X79B 3D71A 1PFIA 4H44C 1Y8AA 1P84I 4LGDE 1EZVE 1H0TB 3LIDA 5CCHC 3CC2P 4OGQD 1IC2A 1GDTA 3H1IE 1EQ7A 2QRXA 1NTMK 2KNCB 3E1IC 1YQ4C 3GLMA 2N9YB 3JSVC 2I1JA 1KILD 1BCCE 1EZVI 2KIKA 3H1LE 4OGQC 2GA1A 2KZIA 1DD4A 3Q5PA 2M8RA 3V2PA 4ZKUA 2H8PD 2QJPC 1EC5A 2E75D 2QVAA 2Y0CA 3A5TA 3VMYA 1G2CB 2V7QH 4H13D 2ZT9C 2WSFH 3I56P 1AFOA 1KD1Q 4WY4B 2WSEJ 4RESB 3LIEA 3LW5H 1X9VA 4DJGA 4AQRD 2AXTE 5KKZC 1OWAA 2J5UA 3S1KA 3TDKA 5AVRB 3PLNA 3CCJP 4DOJA 1VL2A 1Z56A 2BCCG 2HLOA 3HUSA 3O8ZA 2PGDA 3V2RA 3AE2C 3CD6P 4IOIH 3PHLA 1KQLA 1FDOA 2ZFCA 4M7HA 2I1KA 1KYOD 3HTKB 1AVOA 4UB8E 1LTTC 3G3ZA 2FXMA 3GHGC 3I55P 4U3FE 1BGYG 3HD7B 2D2CD 1BGYJ 1PGPA 4ASWA 4TLFA 3CCLP 3FX0A 4HYTB 1RF1B 2PRRA 2QSIA 2WPVB 1JY3O 5AVQB 2R44A 1SQVD 5KLVE 2FXOA 1A02F 2O01H 3AEEC 1M90Q 1K73Q 2SPZA 4C46A 2J61A 1JTHB 5KAIH 5KJ7C 2HODA 2CPSA 1VQNP 3S9OA 3IF4A 5DJTB 3MHVA 1JMMA 1FJKA 1L4AD 1X22A 2BEQD 5AVXB 3H1KE 3L73G 4CPGA 3H1IJ 1GTWA 1A02J 1N7SC 5APTA 3U1AA 1LJ2A 4YXDC 2ZYGA 1NTKJ 2IZ0A 2WTYA 2A45G 1KV4A 1LNQA 2IBZD 3CCSP 3H1LJ 1RQUA 4Z1MH 2QJPB 3IAOA 5AVTB 2C0XA 3IR9A 1IO4A 3TGUJ 2POHA 5KLIB 1H8AA 1FZBB 1SLQA 5TISE 3H1HE 2WPRA 1S9KD 1NTZD 1NTZJ 3PH0A 3CX5D 4HKZH 3L70G 1JO5A 1SQXK 4C7RA 2J5ZA 2M0BA 3BCCD 1KILE 1ZXGA 1J1EC 4IFFA 3P8MC 1OMIA 3V2NA 2L91A 1IJDB 3Q2YA 1EDIA 3M06A 2ZAEB 1YHQP 1L0NE 1VQ8P 3GW6A 2FIBA 3A0BE 1SQXG 1HVVA 4XA4A 1D7MA 1VQ9P 3CC4P 1L0NJ 3L75G 2FFDB 4JQ0D 2LXCB 1CI6B 3KZIH 3Q3DA 1NTKD 3WUTA 3OJAB 2K9JB 2E74D 1WMKA 4U3FG 2XZRA 1PPJG 3GHGB 1QLED 3H1KJ 3A7OA 3EFFK 3SSUA 1IFIA 1IFJA 1KFMA 3W68A 3RBZA 1OW8A 3TGUD 3AE9C 2JDIH 2YXRB 1IZNB 3IFMA 1S9KE 4ZMDA 5KKZB 1LTIC 1BE3D 3MP7B 1N86A 3H1JE 1X8YA 3HE5A 2KI7B 1OXZA 1SP4A 1S5LX 3GF3A 1NAFA 3EQ2A 4BRYB 5E79E 3D70A 2Q9IB 2H88C 3AE3C 1GK4A 2XDJA 1UIXA 1YIJP 2JR8A 1NVOA 4EPUA 2BASA 1FZDA 3TNUB 1SQVK 2BEZF 2LKMA 3LW5J 1URQA 1PV3A 1CSBA 1RF0A 1J2JB 2K88A 1LP1A 1VQOP 1IFPA 1SQQG 1FZFC 1KYOI 3EWKA 2GY7A 3HE5B 4L76A 3PTZA 3AEBC 2KZJA 2WNPF 1ZRTD 3CL3D 4N78D 2IDBA 3SWFA 1K8AQ 1T3UA 1SFCB 2Z4EC 3RL0B 4UB8H 2ZVOB 2FBWC 3CLQA 5AVSB 3P32A 1NO4A 1U57A 4H0LB 1VF5B 1DEEG 1JC9A 2C0WA 1HF9A 4XFJA 2OYIC 2RH0A 3V2QA 1EDLA 5CCHD 1JY2N 3AEDC 4H44B 1W2BO 3V6IA 1QVFO 4I7ZB 5APSA 2Y9ZA 3H6PA 3KHUA 1T6AA 3RK2D 4BRYA 1S3JA 4O9BA 3RK2B 3B8EB 2K1AA 3H1HD 3H32A 1KZUB 2J3OA 1Q2NA 3HUSC 2J64A 1HGZA 3QH9A 3P8CE 1L0LD 2YMKA 1P84D 1YTZT 1PGQA 2R5DA 3L71E 1YQ3C 5EFWB 1YI2P 2W6JH 5C39A 2B89A 3B5NB 5AW0B 2R3SA 1N86C 1SFCA 2HODB 1YYCA 2M5AA 2YO2A 3A0HE 1BCCG 1JOCA 3T97B 1YJ9P 1EXJA 1KILC 3L73E 1FU1A 1KTMA 1ZR4A 4I2LC 2M3BA 2J3GA 1PP9E 5AVYB 3L75D 3AE8C 3L72J 2C9LY 1LT1A 2V4HA 3L4FA 1QL2A 2KYVA 3CPWO 1NTKE 1FOSF 5CJ0A 1MFZA 2JWDA 2FY8A 2NZ2A 2E75B 2WSCJ 2IX7C 1QEXA 3ITKA 1N8RQ 1NYHA 3IN6A 2Y0EA 1NJIQ 2KP8A 1SQQE 3Q1MA 1VQLP 1AQ5A 2WITA 4PD4I 1R5SA 3RL0C 2Z5HA 3A0HH 3G9RA 2P58A 2ZJSE 2MJZA 5AW4B 1SQXE 3BVHC 1RE3C 4R9TA 1RHZB 1IK7A 1XTCC 4XE5B 3P8CD 4IL6H 1P84E 1MZ9A 3E7KA 1FZGC 2QJKB 1YITP 1M1KQ 1SQXJ 5KLIC 2KS1A 3L70E 1NH4A 3CI9A 1BGYD 3HE4A 1FC2C 3SFEC 5CCGC 3NFQA 1FZGA 4PD4E 1S5LH 3H32C 2A45I 2GUSA 2P7JA 1KC8Q 1TU3F 3G6EP 4RJTA 1SQBG 2RMZA 1SQVG 2YMYA 3SWYA 4GOEA 3TSIA 1LT9A 4U3FJ 3HRNA 3L75E 1ZV8A 2NPSC 4EDFA 3H1KG 2J60A 2HG5D 1OW7A 5CMZA 3B5NC 3U59A 1OW6A 1NU1D 4IFDK 1VQMP 3M9BA 1S1CX 3ZDMA 4UB6H 4YXWH 1FIBA 1SQQK 3KDPB 1SQQD 4TT3H 3N7NA 5TISH 4JF7A 1LTJB 2M3EA 2Q1KA 2NPSB 1DD3A 1BSNA 3L72D 1EXIA 5APWA 3FWNA 1VF5D 2XNDH 4NPFX 2JHIF 1W5CE 2W6BA 3B5ND 3AE1C 1JCCA 3CWBD 2H43B 1T2KD 1SQQJ 5CHXA 2OYIB 4B86A 3TF5A 4GOFA 1M56D 1GW3A 5KJ7A 3A2AA 2OYIA 1DH3A 3QWOC 3C9IA 2HLOB 2W27A 2ZYAA 2QJKC 3OW2O 1FZGB 3MGNA 2LR2A 1M1JC 1RE4C 1LTJA 2B87A 2BCCD 5AW6B 1YJWP 2J61B 3FIBA 1MFTA 2Z4EB 2DW3A 1XTGB 1HBWA 4BXLA 1PP9D 4L75A 2QM8A 3RGUA 1H88A 2JHKF 2IBZE 3CCMP 4GDOA 1EDJA 1J1DB 1SQPK 5H2FE 1W2EA 3RK3D 1FBMA 2KK7A 4RO0A 3G71P 3SWKA 3TK1A 1JM0A 3JCUE 3KZIE 4QMAA 1CZQA 1NU1E 3L70J 4ZFGA 4W80A 2Z5IA 3FXDA 1LT9C 3CXHH 3V4QA 2N1TA 2ZT9D 5AW5B 1NAYA 2RN0A 2KLVA 4D6TJ 3H32B 1PL5A 4IFMA 3BCCE 2J2PA 1BDDA 2FXPA 3G4SP 3MTUE 2Y9YA 3RK3B 1SQXD 4BWNA 2YKQA 1Q86Q 1GK6A 2Q3EA 2JJLA 3L35A 5K5GB 1FZEC 4KT0J 4YPCA 2KS1B 1VQ7P 1ZLLA 2YKOA 1EZVD 1HTLC 1JUNA 3NXSA 2HR3A 1G1IA 2FYUG 2IYPA 1BGYE 1SQVJ 3MIWA 4ZKPA 2NRGA 2FYUK 2NPSD 1NTKG 4PD4D 2N1TC 2ZXEB 1ZP0C 3GF7A 1L4AA 1KB9E 2Z4EA 2P1JA 3MZWB 3JC22 1FZAB 2H7HA 1SS1A 1PPJD 2P2UA 5KLVJ 1KILA 2ZT9B 1AQTA 2ZVNB 3H25A 1SQBD 3PP5A 1SVFA 4LLHA 1VQ5P 2VRSA 3R2PA 3TGUG 1SQBK 5CBOA 2J3FD 1QL1A 3AE7C 1LP1B 5BU8B 2N9BA 3CCQP 4D6TD 4A7PA 2K37A 1Y47A 5L8RJ 1NHLA 5AW2B 4AYCA 3H1JD 5APXA 1J1DC 3USSA 2XU6A 1NTZG 4I1LA 5AVUB 1LTJC 3A0BH 1M1JB 1RE4B 2Q3IA 1QVGO 3WUVA 1T2KC 3TYYA 3H1LD 1PIXA 3VOPA 1ZMEC 4GIFA 1S72P 1ZW0A 5KAIE 2JHMF 2O01N 1E5WA 2J1GA 3MUDC 1FJPA 3S4RA 5AW9B 3N4XA 3CXHE 1IFMA 1OVVA 1JEKA 2W90A 1M1JA 1RE4A 3H1KD 2XNXB 1S5LE 2JHHC 1FZCA 2GM4A 3JCUH 3L37A 1RY3A 1SQBJ 2WVRA 4H0LD 3H1HJ 1QX8A 2WPQA 1UIIA 1M8OB 1YTZI 1NKNA 5AVWB 1M57D 2QA4P 1HJBA 2N1TB 2K3RA 1LTAC 4Y28J 4NYTA 1JMBA 1KQSO 2H43A 2IBZI 3E1RA 2KSEA 1MUUA 1VQ4P 2P67A 1KILB 3E1IA 3AE4C 3NTNA 3MUDA 1NGMB 5APUA 3Q5SA 5AVZB 3VYIA 1SQVE 1USDA 1VF5C 4NPEA 3CCEP 4H0LC 3ABVC 1PZQA 3VTPC 2OGUA 2AXTH 5GTHH 3BRTB 2JP3A 2WSFJ 3FXEA 1KYOE 1Z3UA 1JY3P 2OTJP 4U3FD 3L74G 5APVA 3BRVB 1FAVA 5AW3B 1M7LA 1HH0A 3B5NA 3UIAA 3H1JJ 3O6QB 1RF0C 1H89A 2WSCH 4WBAA 1HUCA 1FZFA 1NKZB 3L73J 1BSHA 1BCCJ 1JNMA 1PPJE 2PAJA 3BASA 3M91A 4EI2A 3AEAC 2B9BA 2AEFA 2CK3H 1K05A 2I8DA 1GL2A 5AVVB 4WB4A 2Q9IC 1JY2O 5KTBA 2ZYDA 5APQA 4RKUJ 4R9JA 1RH5B 4HH2A 5CCGD 1ZN5A 2HFED 2YNYA 2FYUD 1VQ6P 2KB7P 2HPCC 2Q7CA 1EDKA 2Q5UA 3AE5C 1NTZE 4WVZA 3VN0A 3L74D 1NU1K 2HODC 1U7JA 3CX5E 4PV1D 2HYNA 2W8ZA 4OH8B 2LXBA 2OYHC 2B87B 2ZXXA 1WT6A 2QE7H 1OFCX 5DJUB 4ZNCA 3AEGC 4PD4H 4DZOA 4U7JA 3B71A 4JYCA 3W67A 3CCRP 1NU1G 4R4LA 4Y99C 4C7NA 4JZCA 2K9JA 1AJYA 4KHXA 4IL6E 3VMXA 5AW7B 1L0LG 1N7SB 1NTZK 1G1JA 2N1TD 1HJ0A 1VDFA 3HD7C 4AUWA 1N2DC 2XKMA 2XV5A 3CXHI 3OAKA 1L0NG 2A06D 3CX5H 1GL2B 3Q5RA 3A3YB 3CCUP 1AVYA 1OZHA 1ZRTE 3CXHD 1BE3E 3L71J 1LGHB 1N73C 2KLUA 4C7NB 2O1KA 4HB1A 3EFGA 5BU5A 2KUBA 5TJHA 1JY2P 3FGAD 3H1ID 5GTIE 3WUUA 1KMIZ 2FYUE 2QG4A 2QJYB 4I7ZC 2IZ1A 1SQPD 1K9MQ 2B88A 5E79H 3D6ZA 2XNXC 2V7QJ 2FFDC 1LT9B 4PJ0E 3CX5I 3L74E 1NWQA 1Q7YQ 1LWUB 1URQB 3C1LA 4L74A 2OTKE 1URQD 5B66H 3M0DC 3BVHA 2FKWB 2G3AA 1KN7A 2WZ7A 3L74J 2E5TA 4DCKA 2G8YA 3TGUE 1RE3B 1L0ND 1FDMA 2W83C 5GTIH 2Q9IA 2WWWA 1N7SA 1GW4A 1HWTC 2FYNC 1KYOH 3RL0g 3RBXA 2J0GA 1PP9G 3VP9A 4GT1A 3L71D 3H1IG 4GKGA 1FZFB 4K35A 4JBZA 1URQC 2WMMA 4WY4C 1OIPA 1FZBC 2H89C 1IK9A 1LWUC 2A06E 1YJNP 1ZR2A 1LTBC 2CPBA 4LC1A
chains in the Genus database with same CATH topology
3VMZA 1L4AA 3M0AA 2Z4EA 4WY4A 2P1JA 5AVSB 5CCHC 1FZAB 5CCGA 3P32A 2H7HA 1NO4A 1IC2A 2P2UA 4JYOX 2KOGA 1WRGA 1KILA 2C0WA 1JC9A 1GDTA 4EOTA 1EQ7A 3PP5A 1SVFA 2OYIC 4LLHA 3V2QA 2VRSA 3R2PA 1SQBK 1NTMK 2J3FD 3E1IC 1QL1A 4W7ZA 3L36A 5CCHD 3M9HA 5BU8B 3E1IB 3HD7A 1JY2N 2N9BA 2L5GB 5APSA 4M3LA 3H6PA 2I1JA 1NHLA 1KILD 5AW2B 3RK2D 4AYCA 4O9BA 3RK2B 1N73A 1JCDA 5APXA 3B8EB 1J1DC 2A45H 2XU6A 4I1LA 5AVUB 1LTJC 3H32A 1KZUB 5AW1B 4I6MC 2M8RA 3V2PA 4ZKUA 2J3OA 1VPCA 2H8PD 1M1JB 1RE4B 3T97A 3HUSC 2Q3IA 2J64A 1HGZA 2WSEH 2D39A 1N86B 3P8CE 1T2KC 1YTZT 3TYYA 3VOPA 3VMYA 3A5TA 1G2CB 2R5DA 2WSFH 4GIFA 2J59M 3B5NB 5AW0B 1N86C 1SFCA 2HODB 1T3JA 2JHMF 1E5WA 1YYCA 2J3FA 2R32A 1AFOA 2J1GA 1FJPA 4WY4B 3RK2C 2WPSA 5AW9B 1GD2E 2YO2A 3N4XA 3GHGA 4RESB 2YO3A 3LIEA 3LW5H 1X9VA 4AQRD 1JOCA 1IFMA 1M1JA 1RE4A 4Y99B 2XNXB 1L0LK 1OWAA 1KILC 2JHHC 3M0DA 1FZCA 1SFCD 2GM4A 5AVRB 3II6A 5APYA 1FU1A 3L37A 1N73B 1RY3A 1ZR4A 4DOJA 1Z56A 4I2LC 2HLOA 2M3BA 1T8ZA 2J3GA 5AVYB 3HUSA 1CI6A 2WPQA 2IFNA 3OA7A 2C9LY 3O8ZA 2KSJA 3L4FA 1YTZI 1NKNA 5AVWB 4M7FA 1QL2A 2KYVA 3V2RA 1HJBA 1FOSF 2W6AA 2N1TB 1KQLA 2ZFCA 3KQGA 1LTAC 5CJ0A 1MFZA 4M7HA 2I1KA 4NYTA 3HTKB 3BVHB 1LTTC 1MV8A 3G3ZA 2H43A 2FXMA 3GHGC 2P67A 1MUUA 2IX7C 3HD7B 1KILB 3E1IA 3NTNA 3MUDA 5APUA 5AVZB 3VYIA 2KP8A 4HYTB 1AQ5A 2WITA 1RF1B 2HLOC 3VTPC 1JY3O 5AVQB 3M9QA 2J58A 3BRTB 3RL0C 2Z5HA 1A02F 2O01H 1Z3UA 2OARA 3MD0A 1L4AC 4C46A 1JY3P 2J61A 1HGVA 2MJZA 5AW4B 2R3CA 4EIJA 1JTHB 5APVA 3BRVB 5KJ7C 1RE3C 3BVHC 1FAVA 2HODA 5AW3B 1M7LA 1HH0A 3B5NA 2CPSA 4R9TA 3UIAA 1XTCC 4XE5B 1N7SD 3P8CD 1RF0B 1FZAC 1MZ9A 1LTGC 1FZGC 1RF0C 1H89A 2WSCH 2JHLF 1JMMA 4WBAA 1JY3N 3TNUA 1HUCA 1FZFA 1FJKA 1RF1A 1NKZB 1L4AD 3HD7D 4WY4D 5AVXB 3V4WA 1NH4A 3CI9A 1JNMA 3HE4A 2PAJA 3BASA 1GTWA 5CCGC 3M91A 1RE3A 3NFQA 1A02J 1FZGA 1N7SC 2J3UA 5APTA 3H32C 3U1AA 1GL2A 5AVVB 2A45I 4WB4A 2GUSA 2P7JA 2Q9IC 1JY2O 1LWUA 2GUVA 5KTBA 2WTYA 3KPEA 2A45G 1GL2C 5APQA 4R9JA 2YMYA 3SWYA 4HH2A 3TSIA 5CCGD 1ZN5A 1LT9A 2HFED 3HRNA 2YNYA 1ZV8A 2NPSC 3VP8A 3HUSB 1FZEA 1GU4A 2E42A 5AVTB 2C0XA 3IR9A 2J60A 1IO4A 2KB7P 2FYZA 2HPCC 1NOHA 2Q7CA 1FZAA 2POHA 2HG5D 1H8AA 4W7YA 2Q5UA 1FZBB 3HE4B 5CMZA 1RF1C 3VN0A 1Z3SA 2NPSA 3B5NC 3U59A 1SLQA 1NU1K 2HODC 2IPPA 4IFDK 2HYNA 4OH8B 1DEBA 1IFDA 3M9BA 5CCHA 2OYHC 2WPRA 1WT6A 3KYQA 1GZLA 1S9KD 3WMM0 1FIBA 1SQQK 4DZOA 3KDPB 3I5CA 3N7NA 4JYCA 2OYHB 1JO5A 1SQXK 4JF7A 4C7RA 1LTJB 4Y99C 2J5ZA 1G2CA 2C9NY 2NPSB 4C7NA 1J1EC 4IFFA 3P8MC 4JZCA 2PP6A 3V2NA 5KJ7D 2FFDA 5APWA 5KLVK 4KHXA 1IJDB 2WT7B 3VMXA 2HPCB 3BATA 5AW7B 3RL0D 3M06A 1J1EB 2W6BA 2JHIF 3B5ND 1JCCA 1N7LA 2JEEA 1FZEB 2FIBA 1N7SB 2H43B 1HVVA 4XA4A 1T2KD 1NTZK 1G1JA 5CHXA 2OYIB 4B86A 2N1TD 1VDFA 3HD7C 4AUWA 4N78E 3NMDA 1GW3A 1N2DC 5KJ7A 2XKMA 2XV5A 3A2AA 1SFCC 2OYIA 2FFDB 3OAKA 3V5BA 1DH3A 1GL2B 1CI6B 3C9IA 3A3YB 2HLOB 2W27A 1FZGB 2O1JA 2YKPA 3MGNA 3OJAB 1FZCB 1LGHB 1N73C 4C7NB 1GU5A 2O1KA 1M1JC 1RE4C 1LTJA 2XZRA 3EFGA 5AW6B 5BU5A 1JTHA 1JY2P 2J61B 3GHGB 2OYHA 1FZCC 3FIBA 2Z4EB 1L4AB 1XTGB 1HBWA 3A7OA 4JYBA 1IFIA 1IFJA 1FZBA 1KFMA 2QM8A 1H88A 1FIDA 2JHKF 2H43C 1J1DB 1SQPK 5BVZA 1NTKK 1KFNA 3IFMA 1S9KE 1LTIC 1W2EA 3RK3D 1FBMA 2XNXC 3P7KA 2FFDC 1LT9B 1N86A 1X8YA 3HE5A 3TK1A 1FOSE 2J0HA 1CZQA 1OXZA 5AW8B 4ZFGA 1SP4A 4W80A 1NWQA 2Z5IA 2E43A 1LT9C 1LWUB 1NAFA 1URQB 3EQ2A 3V4QA 1URQD 3HTKA 3M0DC 3BVHA 2FKWB 1FICA 2N1TA 5AW5B 2WZ7A 2Q9IB 1L0NK 1RE3B 2KLVA 1FDMA 2R5BA 3H32B 1DX7A 1GK4A 2XDJA 4IFMA 2Q9IA 4N6JA 2WWWA 4EPUA 1N7SA 2BASA 1GW4A 1HWTC 1FZDA 3TNUB 1SQVK 2J2PA 3RK3C 1LTSC 2LKMA 4N3YB 2J0GA 3MTUE 2WT7A 2HPCA 1URQA 3VP9A 3RK3B 4GT1A 1CSBA 1RF0A 2IFMA 1CW5A 1J2JB 2YKQA 2J0YA 2XNXA 1GK6A 1FZFC 2JJLA 3L35A 4GKGA 1FZEC 1IFNA 1FZFB 2GY7A 3HE5B 1ZLLA 2YKOA 2QM7A 1HTLC 5CJ4A 1JUNA 1URQC 3U1CA 2WNPF 3CL3D 1GL2D 4N78D 3NXSA 4WY4C 1G1IA 3SWFA 1FZBC 1X79B 1IK9A 1PFIA 1T3UA 1LWUC 1SFCB 3MIWA 1ZR2A 4LGDE 3RL0B 2Z4EC 4ZKPA 2FYUK 2NPSD 3CLQA 3LIDA 2N1TC 2ZXEB 1LTBC 2CPBA 4LC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J C;  1RE4 C;  1LTJ A;  2Z4E A;  1JY2 P;  1LT9 A;  2J61 B;  1FZA B;  3GHG B;  2OYH A;  1FZC C;  4M7F A;  3FIB A;  2Z4E B;  4JYO X;  3HUS B;  1FZE A;  1FZB A;  1JC9 A;  4M7H A;  1FID A;  4NYT A;  2JHK F;  2J60 A;  3BVH B;  2H43 C;  2HPC C;  2H43 A;  3GHG C;  1FZA A;  2OYI C;  1FZB B;  3E1I A;  1RF1 C;  1Z3S A;  2J3F D;  3E1I C;  2HOD C;  1W2E A;  2XNX C;  3E1I B;  1JY2 N;  2FFD C;  1LT9 B;  1N86 A;  2J0H A;  2OYH C;  1RF1 B;  2HLO C;  4ZFG A;  1FIB A;  1N73 A;  1JY3 O;  1LT9 C;  1LWU B;  2A45 H;  2OYH B;  3BVH A;  1LTJ C;  3H32 A;  1FIC A;  1Z3U A;  1LTJ B;  2J5Z A;  2J3O A;  2Q9I B;  1M1J B;  1RE4 B;  4JZC A;  3HUS C;  1JY3 P;  1RE3 B;  2J64 A;  2D39 A;  2J61 A;  2FFD A;  1N86 B;  3H32 B;  3BVH C;  1RE3 C;  2HOD A;  2HPC B;  2Q9I A;  4EPU A;  4R9T A;  1FZD A;  2JHI F;  2J2P A;  1FZE B;  1RF0 B;  1FZA C;  2FIB A;  2J0G A;  1N86 C;  2H43 B;  2HPC A;  2HOD B;  2JHM F;  1FZG C;  1RF0 C;  2J3F A;  2OYI B;  1RF0 A;  2JHL F;  1JY3 N;  1FZF A;  2J0Y A;  2J1G A;  1RF1 A;  2XNX A;  1FZF C;  1FZE C;  3GHG A;  1FZF B;  2GY7 A;  2OYI A;  2FFD B;  1RE3 A;  1M1J A;  1RE4 A;  1FZG A;  2WNP F;  2XNX B;  2J3U A;  2HLO B;  1FZB C;  2JHH C;  3H32 C;  1FZC A;  1T3U A;  1LWU C;  2A45 I;  1FZG B;  2Q9I C;  1LWU A;  1JY2 O;  1N73 B;  2Z4E C;  1FZC B;  2HLO A;  1N73 C;  2A45 G;  2J3G A;  3HUS A;  4R9J A; 
#chains in the Genus database with same CATH topology
 3VMZ A;  3M0A A;  2BCC J;  4WY4 A;  4HJG H;  4R4M A;  2QJY C;  5CCG A;  4L73 A;  4JYO X;  2KOG A;  1FS0 E;  1WRG A;  4K3A A;  4EOT A;  1ZOY C;  1VQK P;  1Y9B A;  4W7Z A;  3L36 A;  3M9H A;  3E1I B;  3HD7 A;  1BE3 J;  2L5G B;  4M3L A;  5KLV D;  1N73 A;  1JCD A;  1L0L E;  2A45 H;  3AEF C;  2E5Y A;  3SFD C;  5AW1 B;  1MKM A;  4I6M C;  4D6T G;  1VPC A;  3T97 A;  2WSE H;  2D39 A;  1N86 B;  1S4X A;  1GMJ A;  1OX3 A;  1L0L J;  3O6Q A;  3H1J G;  3CMA P;  4IL6 X;  2J59 M;  3CWB J;  1T3J A;  2J3F A;  2R32 A;  3CWB G;  1SQP J;  3RK2 C;  3L75 J;  2WPS A;  1GD2 E;  3GHG A;  2YO3 A;  5B5E H;  4Y99 B;  2FYU J;  2E76 B;  1L0L K;  1SQP E;  3M0D A;  2JO1 A;  1R5L A;  1SFC D;  3II6 A;  5APY A;  1K04 A;  1N73 B;  1USE A;  1T8Z A;  1CI6 A;  2IFN A;  4PV1 C;  4H13 B;  3OA7 A;  2KSJ A;  5KLV G;  4M7F A;  3L72 G;  2AEM A;  1JB0 J;  2W6A A;  3KQG A;  1FE6 A;  2FYN B;  3H1L G;  1NTM E;  3BVH B;  2P10 A;  4H44 D;  1MV8 A;  3K5B A;  2RKL A;  2YIU B;  3L73 D;  1X0T A;  2PFX A;  1Q81 Q;  2HLO C;  3AE6 C;  3L70 D;  1Q82 Q;  2O01 J;  2AEJ A;  3M9Q A;  2J58 A;  4PV1 B;  5B5E E;  2OAR A;  3MD0 A;  1L4A C;  1RQV A;  3AEC C;  2E75 C;  2A06 G;  3PRJ A;  2IYO A;  1HGV A;  3C8V A;  2R3C A;  4EIJ A;  4OGQ B;  5M1B A;  3GMA A;  1AA0 A;  2JWA A;  1N7S D;  1RF0 B;  1FZA C;  1LTG C;  2YIU C;  2JHL F;  1JY3 N;  3TNU A;  2QEX P;  1RF1 A;  1KB9 I;  2WQY C;  3HD7 D;  4WY4 D;  1DIP A;  3V4W A;  3CCV P;  2UWJ E;  1RE3 A;  1R8E A;  2KXP B;  2J3U A;  1PGO A;  4H13 C;  2IBZ G;  4OWF A;  3H1H G;  3L71 G;  1LWU A;  4OVN F;  2GUV A;  3FWL A;  1KQG B;  2QIW A;  3KPE A;  1GL2 C;  2OQQ A;  4WWI A;  1NTM D;  2E76 C;  1KOR A;  2K9Y A;  3VP8 A;  3HUS B;  1FZE A;  1GU4 A;  2E42 A;  1U7M A;  2FYZ A;  3PJS K;  3D6Y A;  1NOH A;  1FZA A;  3VMA A;  2D2C C;  1VQP P;  4W7Y A;  3HE4 B;  1RF1 C;  1Z3S A;  2NPS A;  1BE3 G;  3BCC J;  2IPP A;  1DEB A;  1IFD A;  5CCH A;  3BCC G;  2D2C B;  3CC7 P;  3CWB E;  1EZV G;  1GZL A;  3KYQ A;  4DT0 A;  2AXC A;  4GOD A;  3WMM 0;  3CME P;  3I5C A;  1FDI A;  2OYH B;  2E76 D;  2E74 C;  1G2C A;  5CBN A;  2C9N Y;  1AV1 A;  2PP6 A;  3R4Y A;  5KJ7 D;  2FFD A;  5KLV K;  1L2P A;  2WT7 B;  2HPC B;  3BAT A;  3RL0 D;  1KB9 H;  1J1E B;  1E79 H;  1PP9 J;  1N7L A;  2JEE A;  1FZE B;  3L72 E;  1BCC D;  1NTM G;  4N78 E;  4UB6 E;  1OVR A;  3NMD A;  5B66 E;  1SFC C;  2MKV A;  1NTM J;  3V5B A;  3GG2 A;  4ASV A;  1OVU A;  2Y0D A;  2O1J A;  2YKP A;  3RK3 E;  1FZC B;  2E74 B;  2OYO A;  1GU5 A;  1JTH A;  1QGK B;  1PGJ A;  2OYH A;  1FZC C;  3WU2 H;  5KAF H;  1KB9 D;  1L4A B;  4JYB A;  1FZB A;  1FID A;  1S2E A;  2H43 C;  2BCC E;  3B4S A;  2Q6Q A;  5BVZ A;  2M5A B;  1NTK K;  1KFN A;  1SQB E;  3P7K A;  1FOS E;  2J0H A;  5GTH E;  5H2F H;  2JKV A;  5AW8 B;  4D6T E;  2E43 A;  3HTK A;  1P84 H;  4JPZ B;  2ITA A;  1FIC A;  1Q90 D;  3F5H A;  1YBK A;  1NU1 J;  2OTL P;  1L0N K;  2R5B A;  4EYY Q;  1DX7 A;  1BDC A;  4KJM A;  4N6J A;  2KNC A;  3RK3 C;  3KXD A;  1LTS C;  4N3Y B;  5KAF E;  4NPD A;  3WU2 E;  2HPC A;  2YXQ B;  2WT7 A;  2IFM A;  1CW5 A;  2J0Y A;  2XNX A;  2WSS H;  1KQF B;  1SQP G;  1IFN A;  3F89 A;  4PJ0 H;  2QM7 A;  5CJ4 A;  4YTP C;  2O3J A;  3U1C A;  4MN4 C;  1GL2 D;  1H0T A;  1X79 B;  3D71 A;  1PFI A;  4H44 C;  1Y8A A;  1P84 I;  4LGD E;  1EZV E;  1H0T B;  3LID A;  5CCH C;  3CC2 P;  4OGQ D;  1IC2 A;  1GDT A;  3H1I E;  1EQ7 A;  2QRX A;  1NTM K;  2KNC B;  3E1I C;  1YQ4 C;  3GLM A;  2N9Y B;  3JSV C;  2I1J A;  1KIL D;  1BCC E;  1EZV I;  2KIK A;  3H1L E;  4OGQ C;  2GA1 A;  2KZI A;  1DD4 A;  3Q5P A;  2M8R A;  3V2P A;  4ZKU A;  2H8P D;  2QJP C;  1EC5 A;  2E75 D;  2QVA A;  2Y0C A;  3A5T A;  3VMY A;  1G2C B;  2V7Q H;  4H13 D;  2ZT9 C;  2WSF H;  3I56 P;  1AFO A;  1KD1 Q;  4WY4 B;  2WSE J;  4RES B;  3LIE A;  3LW5 H;  1X9V A;  4DJG A;  4AQR D;  2AXT E;  5KKZ C;  1OWA A;  2J5U A;  3S1K A;  3TDK A;  5AVR B;  3PLN A;  3CCJ P;  4DOJ A;  1VL2 A;  1Z56 A;  2BCC G;  2HLO A;  3HUS A;  3O8Z A;  2PGD A;  3V2R A;  3AE2 C;  3CD6 P;  4IOI H;  3PHL A;  1KQL A;  1FDO A;  2ZFC A;  4M7H A;  2I1K A;  1KYO D;  3HTK B;  1AVO A;  4UB8 E;  1LTT C;  3G3Z A;  2FXM A;  3GHG C;  3I55 P;  4U3F E;  1BGY G;  3HD7 B;  2D2C D;  1BGY J;  1PGP A;  4ASW A;  4TLF A;  3CCL P;  3FX0 A;  4HYT B;  1RF1 B;  2PRR A;  2QSI A;  2WPV B;  1JY3 O;  5AVQ B;  2R44 A;  1SQV D;  5KLV E;  2FXO A;  1A02 F;  2O01 H;  3AEE C;  1M90 Q;  1K73 Q;  2SPZ A;  4C46 A;  2J61 A;  1JTH B;  5KAI H;  5KJ7 C;  2HOD A;  2CPS A;  1VQN P;  3S9O A;  3IF4 A;  5DJT B;  3MHV A;  1JMM A;  1FJK A;  1L4A D;  1X22 A;  2BEQ D;  5AVX B;  3H1K E;  3L73 G;  4CPG A;  3H1I J;  1GTW A;  1A02 J;  1N7S C;  5APT A;  3U1A A;  1LJ2 A;  4YXD C;  2ZYG A;  1NTK J;  2IZ0 A;  2WTY A;  2A45 G;  1KV4 A;  1LNQ A;  2IBZ D;  3CCS P;  3H1L J;  1RQU A;  4Z1M H;  2QJP B;  3IAO A;  5AVT B;  2C0X A;  3IR9 A;  1IO4 A;  3TGU J;  2POH A;  5KLI B;  1H8A A;  1FZB B;  1SLQ A;  5TIS E;  3H1H E;  2WPR A;  1S9K D;  1NTZ D;  1NTZ J;  3PH0 A;  3CX5 D;  4HKZ H;  3L70 G;  1JO5 A;  1SQX K;  4C7R A;  2J5Z A;  2M0B A;  3BCC D;  1KIL E;  1ZXG A;  1J1E C;  4IFF A;  3P8M C;  1OMI A;  3V2N A;  2L91 A;  1IJD B;  3Q2Y A;  1EDI A;  3M06 A;  2ZAE B;  1YHQ P;  1L0N E;  1VQ8 P;  3GW6 A;  2FIB A;  3A0B E;  1SQX G;  1HVV A;  4XA4 A;  1D7M A;  1VQ9 P;  3CC4 P;  1L0N J;  3L75 G;  2FFD B;  4JQ0 D;  2LXC B;  1CI6 B;  3KZI H;  3Q3D A;  1NTK D;  3WUT A;  3OJA B;  2K9J B;  2E74 D;  1WMK A;  4U3F G;  2XZR A;  1PPJ G;  3GHG B;  1QLE D;  3H1K J;  3A7O A;  3EFF K;  3SSU A;  1IFI A;  1IFJ A;  1KFM A;  3W68 A;  3RBZ A;  1OW8 A;  3TGU D;  3AE9 C;  2JDI H;  2YXR B;  1IZN B;  3IFM A;  1S9K E;  4ZMD A;  5KKZ B;  1LTI C;  1BE3 D;  3MP7 B;  1N86 A;  3H1J E;  1X8Y A;  3HE5 A;  2KI7 B;  1OXZ A;  1SP4 A;  1S5L X;  3GF3 A;  1NAF A;  3EQ2 A;  4BRY B;  5E79 E;  3D70 A;  2Q9I B;  2H88 C;  3AE3 C;  1GK4 A;  2XDJ A;  1UIX A;  1YIJ P;  2JR8 A;  1NVO A;  4EPU A;  2BAS A;  1FZD A;  3TNU B;  1SQV K;  2BEZ F;  2LKM A;  3LW5 J;  1URQ A;  1PV3 A;  1CSB A;  1RF0 A;  1J2J B;  2K88 A;  1LP1 A;  1VQO P;  1IFP A;  1SQQ G;  1FZF C;  1KYO I;  3EWK A;  2GY7 A;  3HE5 B;  4L76 A;  3PTZ A;  3AEB C;  2KZJ A;  2WNP F;  1ZRT D;  3CL3 D;  4N78 D;  2IDB A;  3SWF A;  1K8A Q;  1T3U A;  1SFC B;  2Z4E C;  3RL0 B;  4UB8 H;  2ZVO B;  2FBW C;  3CLQ A;  5AVS B;  3P32 A;  1NO4 A;  1U57 A;  4H0L B;  1VF5 B;  1DEE G;  1JC9 A;  2C0W A;  1HF9 A;  4XFJ A;  2OYI C;  2RH0 A;  3V2Q A;  1EDL A;  5CCH D;  1JY2 N;  3AED C;  4H44 B;  1W2B O;  3V6I A;  1QVF O;  4I7Z B;  5APS A;  2Y9Z A;  3H6P A;  3KHU A;  1T6A A;  3RK2 D;  4BRY A;  1S3J A;  4O9B A;  3RK2 B;  3B8E B;  2K1A A;  3H1H D;  3H32 A;  1KZU B;  2J3O A;  1Q2N A;  3HUS C;  2J64 A;  1HGZ A;  3QH9 A;  3P8C E;  1L0L D;  2YMK A;  1P84 D;  1YTZ T;  1PGQ A;  2R5D A;  3L71 E;  1YQ3 C;  5EFW B;  1YI2 P;  2W6J H;  5C39 A;  2B89 A;  3B5N B;  5AW0 B;  2R3S A;  1N86 C;  1SFC A;  2HOD B;  1YYC A;  2M5A A;  2YO2 A;  3A0H E;  1BCC G;  1JOC A;  3T97 B;  1YJ9 P;  1EXJ A;  1KIL C;  3L73 E;  1FU1 A;  1KTM A;  1ZR4 A;  4I2L C;  2M3B A;  2J3G A;  1PP9 E;  5AVY B;  3L75 D;  3AE8 C;  3L72 J;  2C9L Y;  1LT1 A;  2V4H A;  3L4F A;  1QL2 A;  2KYV A;  3CPW O;  1NTK E;  1FOS F;  5CJ0 A;  1MFZ A;  2JWD A;  2FY8 A;  2NZ2 A;  2E75 B;  2WSC J;  2IX7 C;  1QEX A;  3ITK A;  1N8R Q;  1NYH A;  3IN6 A;  2Y0E A;  1NJI Q;  2KP8 A;  1SQQ E;  3Q1M A;  1VQL P;  1AQ5 A;  2WIT A;  4PD4 I;  1R5S A;  3RL0 C;  2Z5H A;  3A0H H;  3G9R A;  2P58 A;  2ZJS E;  2MJZ A;  5AW4 B;  1SQX E;  3BVH C;  1RE3 C;  4R9T A;  1RHZ B;  1IK7 A;  1XTC C;  4XE5 B;  3P8C D;  4IL6 H;  1P84 E;  1MZ9 A;  3E7K A;  1FZG C;  2QJK B;  1YIT P;  1M1K Q;  1SQX J;  5KLI C;  2KS1 A;  3L70 E;  1NH4 A;  3CI9 A;  1BGY D;  3HE4 A;  1FC2 C;  3SFE C;  5CCG C;  3NFQ A;  1FZG A;  4PD4 E;  1S5L H;  3H32 C;  2A45 I;  2GUS A;  2P7J A;  1KC8 Q;  1TU3 F;  3G6E P;  4RJT A;  1SQB G;  2RMZ A;  1SQV G;  2YMY A;  3SWY A;  4GOE A;  3TSI A;  1LT9 A;  4U3F J;  3HRN A;  3L75 E;  1ZV8 A;  2NPS C;  4EDF A;  3H1K G;  2J60 A;  2HG5 D;  1OW7 A;  5CMZ A;  3B5N C;  3U59 A;  1OW6 A;  1NU1 D;  4IFD K;  1VQM P;  3M9B A;  1S1C X;  3ZDM A;  4UB6 H;  4YXW H;  1FIB A;  1SQQ K;  3KDP B;  1SQQ D;  4TT3 H;  3N7N A;  5TIS H;  4JF7 A;  1LTJ B;  2M3E A;  2Q1K A;  2NPS B;  1DD3 A;  1BSN A;  3L72 D;  1EXI A;  5APW A;  3FWN A;  1VF5 D;  2XND H;  4NPF X;  2JHI F;  1W5C E;  2W6B A;  3B5N D;  3AE1 C;  1JCC A;  3CWB D;  2H43 B;  1T2K D;  1SQQ J;  5CHX A;  2OYI B;  4B86 A;  3TF5 A;  4GOF A;  1M56 D;  1GW3 A;  5KJ7 A;  3A2A A;  2OYI A;  1DH3 A;  3QWO C;  3C9I A;  2HLO B;  2W27 A;  2ZYA A;  2QJK C;  3OW2 O;  1FZG B;  3MGN A;  2LR2 A;  1M1J C;  1RE4 C;  1LTJ A;  2B87 A;  2BCC D;  5AW6 B;  1YJW P;  2J61 B;  3FIB A;  1MFT A;  2Z4E B;  2DW3 A;  1XTG B;  1HBW A;  4BXL A;  1PP9 D;  4L75 A;  2QM8 A;  3RGU A;  1H88 A;  2JHK F;  2IBZ E;  3CCM P;  4GDO A;  1EDJ A;  1J1D B;  1SQP K;  5H2F E;  1W2E A;  3RK3 D;  1FBM A;  2KK7 A;  4RO0 A;  3G71 P;  3SWK A;  3TK1 A;  1JM0 A;  3JCU E;  3KZI E;  4QMA A;  1CZQ A;  1NU1 E;  3L70 J;  4ZFG A;  4W80 A;  2Z5I A;  3FXD A;  1LT9 C;  3CXH H;  3V4Q A;  2N1T A;  2ZT9 D;  5AW5 B;  1NAY A;  2RN0 A;  2KLV A;  4D6T J;  3H32 B;  1PL5 A;  4IFM A;  3BCC E;  2J2P A;  1BDD A;  2FXP A;  3G4S P;  3MTU E;  2Y9Y A;  3RK3 B;  1SQX D;  4BWN A;  2YKQ A;  1Q86 Q;  1GK6 A;  2Q3E A;  2JJL A;  3L35 A;  5K5G B;  1FZE C;  4KT0 J;  4YPC A;  2KS1 B;  1VQ7 P;  1ZLL A;  2YKO A;  1EZV D;  1HTL C;  1JUN A;  3NXS A;  2HR3 A;  1G1I A;  2FYU G;  2IYP A;  1BGY E;  1SQV J;  3MIW A;  4ZKP A;  2NRG A;  2FYU K;  2NPS D;  1NTK G;  4PD4 D;  2N1T C;  2ZXE B;  1ZP0 C;  3GF7 A;  1L4A A;  1KB9 E;  2Z4E A;  2P1J A;  3MZW B;  3JC2 2;  1FZA B;  2H7H A;  1SS1 A;  1PPJ D;  2P2U A;  5KLV J;  1KIL A;  2ZT9 B;  1AQT A;  2ZVN B;  3H25 A;  1SQB D;  3PP5 A;  1SVF A;  4LLH A;  1VQ5 P;  2VRS A;  3R2P A;  3TGU G;  1SQB K;  5CBO A;  2J3F D;  1QL1 A;  3AE7 C;  1LP1 B;  5BU8 B;  2N9B A;  3CCQ P;  4D6T D;  4A7P A;  2K37 A;  1Y47 A;  5L8R J;  1NHL A;  5AW2 B;  4AYC A;  3H1J D;  5APX A;  1J1D C;  3USS A;  2XU6 A;  1NTZ G;  4I1L A;  5AVU B;  1LTJ C;  3A0B H;  1M1J B;  1RE4 B;  2Q3I A;  1QVG O;  3WUV A;  1T2K C;  3TYY A;  3H1L D;  1PIX A;  3VOP A;  1ZME C;  4GIF A;  1S72 P;  1ZW0 A;  5KAI E;  2JHM F;  2O01 N;  1E5W A;  2J1G A;  3MUD C;  1FJP A;  3S4R A;  5AW9 B;  3N4X A;  3CXH E;  1IFM A;  1OVV A;  1JEK A;  2W90 A;  1M1J A;  1RE4 A;  3H1K D;  2XNX B;  1S5L E;  2JHH C;  1FZC A;  2GM4 A;  3JCU H;  3L37 A;  1RY3 A;  1SQB J;  2WVR A;  4H0L D;  3H1H J;  1QX8 A;  2WPQ A;  1UII A;  1M8O B;  1YTZ I;  1NKN A;  5AVW B;  1M57 D;  2QA4 P;  1HJB A;  2N1T B;  2K3R A;  1LTA C;  4Y28 J;  4NYT A;  1JMB A;  1KQS O;  2H43 A;  2IBZ I;  3E1R A;  2KSE A;  1MUU A;  1VQ4 P;  2P67 A;  1KIL B;  3E1I A;  3AE4 C;  3NTN A;  3MUD A;  1NGM B;  5APU A;  3Q5S A;  5AVZ B;  3VYI A;  1SQV E;  1USD A;  1VF5 C;  4NPE A;  3CCE P;  4H0L C;  3ABV C;  1PZQ A;  3VTP C;  2OGU A;  2AXT H;  5GTH H;  3BRT B;  2JP3 A;  2WSF J;  3FXE A;  1KYO E;  1Z3U A;  1JY3 P;  2OTJ P;  4U3F D;  3L74 G;  5APV A;  3BRV B;  1FAV A;  5AW3 B;  1M7L A;  1HH0 A;  3B5N A;  3UIA A;  3H1J J;  3O6Q B;  1RF0 C;  1H89 A;  2WSC H;  4WBA A;  1HUC A;  1FZF A;  1NKZ B;  3L73 J;  1BSH A;  1BCC J;  1JNM A;  1PPJ E;  2PAJ A;  3BAS A;  3M91 A;  4EI2 A;  3AEA C;  2B9B A;  2AEF A;  2CK3 H;  1K05 A;  2I8D A;  1GL2 A;  5AVV B;  4WB4 A;  2Q9I C;  1JY2 O;  5KTB A;  2ZYD A;  5APQ A;  4RKU J;  4R9J A;  1RH5 B;  4HH2 A;  5CCG D;  1ZN5 A;  2HFE D;  2YNY A;  2FYU D;  1VQ6 P;  2KB7 P;  2HPC C;  2Q7C A;  1EDK A;  2Q5U A;  3AE5 C;  1NTZ E;  4WVZ A;  3VN0 A;  3L74 D;  1NU1 K;  2HOD C;  1U7J A;  3CX5 E;  4PV1 D;  2HYN A;  2W8Z A;  4OH8 B;  2LXB A;  2OYH C;  2B87 B;  2ZXX A;  1WT6 A;  2QE7 H;  1OFC X;  5DJU B;  4ZNC A;  3AEG C;  4PD4 H;  4DZO A;  4U7J A;  3B71 A;  4JYC A;  3W67 A;  3CCR P;  1NU1 G;  4R4L A;  4Y99 C;  4C7N A;  4JZC A;  2K9J A;  1AJY A;  4KHX A;  4IL6 E;  3VMX A;  5AW7 B;  1L0L G;  1N7S B;  1NTZ K;  1G1J A;  2N1T D;  1HJ0 A;  1VDF A;  3HD7 C;  4AUW A;  1N2D C;  2XKM A;  2XV5 A;  3CXH I;  3OAK A;  1L0N G;  2A06 D;  3CX5 H;  1GL2 B;  3Q5R A;  3A3Y B;  3CCU P;  1AVY A;  1OZH A;  1ZRT E;  3CXH D;  1BE3 E;  3L71 J;  1LGH B;  1N73 C;  2KLU A;  4C7N B;  2O1K A;  4HB1 A;  3EFG A;  5BU5 A;  2KUB A;  5TJH A;  1JY2 P;  3FGA D;  3H1I D;  5GTI E;  3WUU A;  1KMI Z;  2FYU E;  2QG4 A;  2QJY B;  4I7Z C;  2IZ1 A;  1SQP D;  1K9M Q;  2B88 A;  5E79 H;  3D6Z A;  2XNX C;  2V7Q J;  2FFD C;  1LT9 B;  4PJ0 E;  3CX5 I;  3L74 E;  1NWQ A;  1Q7Y Q;  1LWU B;  1URQ B;  3C1L A;  4L74 A;  2OTK E;  1URQ D;  5B66 H;  3M0D C;  3BVH A;  2FKW B;  2G3A A;  1KN7 A;  2WZ7 A;  3L74 J;  2E5T A;  4DCK A;  2G8Y A;  3TGU E;  1RE3 B;  1L0N D;  1FDM A;  2W83 C;  5GTI H;  2Q9I A;  2WWW A;  1N7S A;  1GW4 A;  1HWT C;  2FYN C;  1KYO H;  3RL0 g;  3RBX A;  2J0G A;  1PP9 G;  3VP9 A;  4GT1 A;  3L71 D;  3H1I G;  4GKG A;  1FZF B;  4K35 A;  4JBZ A;  1URQ C;  2WMM A;  4WY4 C;  1OIP A;  1FZB C;  2H89 C;  1IK9 A;  1LWU C;  2A06 E;  1YJN P;  1ZR2 A;  1LTB C;  2CPB A;  4LC1 A; 
#chains in the Genus database with same CATH homology
 3VMZ A;  1L4A A;  3M0A A;  2Z4E A;  4WY4 A;  2P1J A;  5AVS B;  5CCH C;  1FZA B;  5CCG A;  3P32 A;  2H7H A;  1NO4 A;  1IC2 A;  2P2U A;  4JYO X;  2KOG A;  1WRG A;  1KIL A;  2C0W A;  1JC9 A;  1GDT A;  4EOT A;  1EQ7 A;  3PP5 A;  1SVF A;  2OYI C;  4LLH A;  3V2Q A;  2VRS A;  3R2P A;  1SQB K;  1NTM K;  2J3F D;  3E1I C;  1QL1 A;  4W7Z A;  3L36 A;  5CCH D;  3M9H A;  5BU8 B;  3E1I B;  3HD7 A;  1JY2 N;  2N9B A;  2L5G B;  5APS A;  4M3L A;  3H6P A;  2I1J A;  1NHL A;  1KIL D;  5AW2 B;  3RK2 D;  4AYC A;  4O9B A;  3RK2 B;  1N73 A;  1JCD A;  5APX A;  3B8E B;  1J1D C;  2A45 H;  2XU6 A;  4I1L A;  5AVU B;  1LTJ C;  3H32 A;  1KZU B;  5AW1 B;  4I6M C;  2M8R A;  3V2P A;  4ZKU A;  2J3O A;  1VPC A;  2H8P D;  1M1J B;  1RE4 B;  3T97 A;  3HUS C;  2Q3I A;  2J64 A;  1HGZ A;  2WSE H;  2D39 A;  1N86 B;  3P8C E;  1T2K C;  1YTZ T;  3TYY A;  3VOP A;  3VMY A;  3A5T A;  1G2C B;  2R5D A;  2WSF H;  4GIF A;  2J59 M;  3B5N B;  5AW0 B;  1N86 C;  1SFC A;  2HOD B;  1T3J A;  2JHM F;  1E5W A;  1YYC A;  2J3F A;  2R32 A;  1AFO A;  2J1G A;  1FJP A;  4WY4 B;  3RK2 C;  2WPS A;  5AW9 B;  1GD2 E;  2YO2 A;  3N4X A;  3GHG A;  4RES B;  2YO3 A;  3LIE A;  3LW5 H;  1X9V A;  4AQR D;  1JOC A;  1IFM A;  1M1J A;  1RE4 A;  4Y99 B;  2XNX B;  1L0L K;  1OWA A;  1KIL C;  2JHH C;  3M0D A;  1FZC A;  1SFC D;  2GM4 A;  5AVR B;  3II6 A;  5APY A;  1FU1 A;  3L37 A;  1N73 B;  1RY3 A;  1ZR4 A;  4DOJ A;  1Z56 A;  4I2L C;  2HLO A;  2M3B A;  1T8Z A;  2J3G A;  5AVY B;  3HUS A;  1CI6 A;  2WPQ A;  2IFN A;  3OA7 A;  2C9L Y;  3O8Z A;  2KSJ A;  3L4F A;  1YTZ I;  1NKN A;  5AVW B;  4M7F A;  1QL2 A;  2KYV A;  3V2R A;  1HJB A;  1FOS F;  2W6A A;  2N1T B;  1KQL A;  2ZFC A;  3KQG A;  1LTA C;  5CJ0 A;  1MFZ A;  4M7H A;  2I1K A;  4NYT A;  3HTK B;  3BVH B;  1LTT C;  1MV8 A;  3G3Z A;  2H43 A;  2FXM A;  3GHG C;  2P67 A;  1MUU A;  2IX7 C;  3HD7 B;  1KIL B;  3E1I A;  3NTN A;  3MUD A;  5APU A;  5AVZ B;  3VYI A;  2KP8 A;  4HYT B;  1AQ5 A;  2WIT A;  1RF1 B;  2HLO C;  3VTP C;  1JY3 O;  5AVQ B;  3M9Q A;  2J58 A;  3BRT B;  3RL0 C;  2Z5H A;  1A02 F;  2O01 H;  1Z3U A;  2OAR A;  3MD0 A;  1L4A C;  4C46 A;  1JY3 P;  2J61 A;  1HGV A;  2MJZ A;  5AW4 B;  2R3C A;  4EIJ A;  1JTH B;  5APV A;  3BRV B;  5KJ7 C;  1RE3 C;  3BVH C;  1FAV A;  2HOD A;  5AW3 B;  1M7L A;  1HH0 A;  3B5N A;  2CPS A;  4R9T A;  3UIA A;  1XTC C;  4XE5 B;  1N7S D;  3P8C D;  1RF0 B;  1FZA C;  1MZ9 A;  1LTG C;  1FZG C;  1RF0 C;  1H89 A;  2WSC H;  2JHL F;  1JMM A;  4WBA A;  1JY3 N;  3TNU A;  1HUC A;  1FZF A;  1FJK A;  1RF1 A;  1NKZ B;  1L4A D;  3HD7 D;  4WY4 D;  5AVX B;  3V4W A;  1NH4 A;  3CI9 A;  1JNM A;  3HE4 A;  2PAJ A;  3BAS A;  1GTW A;  5CCG C;  3M91 A;  1RE3 A;  3NFQ A;  1A02 J;  1FZG A;  1N7S C;  2J3U A;  5APT A;  3H32 C;  3U1A A;  1GL2 A;  5AVV B;  2A45 I;  4WB4 A;  2GUS A;  2P7J A;  2Q9I C;  1JY2 O;  1LWU A;  2GUV A;  5KTB A;  2WTY A;  3KPE A;  2A45 G;  1GL2 C;  5APQ A;  4R9J A;  2YMY A;  3SWY A;  4HH2 A;  3TSI A;  5CCG D;  1ZN5 A;  1LT9 A;  2HFE D;  3HRN A;  2YNY A;  1ZV8 A;  2NPS C;  3VP8 A;  3HUS B;  1FZE A;  1GU4 A;  2E42 A;  5AVT B;  2C0X A;  3IR9 A;  2J60 A;  1IO4 A;  2KB7 P;  2FYZ A;  2HPC C;  1NOH A;  2Q7C A;  1FZA A;  2POH A;  2HG5 D;  1H8A A;  4W7Y A;  2Q5U A;  1FZB B;  3HE4 B;  5CMZ A;  1RF1 C;  3VN0 A;  1Z3S A;  2NPS A;  3B5N C;  3U59 A;  1SLQ A;  1NU1 K;  2HOD C;  2IPP A;  4IFD K;  2HYN A;  4OH8 B;  1DEB A;  1IFD A;  3M9B A;  5CCH A;  2OYH C;  2WPR A;  1WT6 A;  3KYQ A;  1GZL A;  1S9K D;  3WMM 0;  1FIB A;  1SQQ K;  4DZO A;  3KDP B;  3I5C A;  3N7N A;  4JYC A;  2OYH B;  1JO5 A;  1SQX K;  4JF7 A;  4C7R A;  1LTJ B;  4Y99 C;  2J5Z A;  1G2C A;  2C9N Y;  2NPS B;  4C7N A;  1J1E C;  4IFF A;  3P8M C;  4JZC A;  2PP6 A;  3V2N A;  5KJ7 D;  2FFD A;  5APW A;  5KLV K;  4KHX A;  1IJD B;  2WT7 B;  3VMX A;  2HPC B;  3BAT A;  5AW7 B;  3RL0 D;  3M06 A;  1J1E B;  2W6B A;  2JHI F;  3B5N D;  1JCC A;  1N7L A;  2JEE A;  1FZE B;  2FIB A;  1N7S B;  2H43 B;  1HVV A;  4XA4 A;  1T2K D;  1NTZ K;  1G1J A;  5CHX A;  2OYI B;  4B86 A;  2N1T D;  1VDF A;  3HD7 C;  4AUW A;  4N78 E;  3NMD A;  1GW3 A;  1N2D C;  5KJ7 A;  2XKM A;  2XV5 A;  3A2A A;  1SFC C;  2OYI A;  2FFD B;  3OAK A;  3V5B A;  1DH3 A;  1GL2 B;  1CI6 B;  3C9I A;  3A3Y B;  2HLO B;  2W27 A;  1FZG B;  2O1J A;  2YKP A;  3MGN A;  3OJA B;  1FZC B;  1LGH B;  1N73 C;  4C7N B;  1GU5 A;  2O1K A;  1M1J C;  1RE4 C;  1LTJ A;  2XZR A;  3EFG A;  5AW6 B;  5BU5 A;  1JTH A;  1JY2 P;  2J61 B;  3GHG B;  2OYH A;  1FZC C;  3FIB A;  2Z4E B;  1L4A B;  1XTG B;  1HBW A;  3A7O A;  4JYB A;  1IFI A;  1IFJ A;  1FZB A;  1KFM A;  2QM8 A;  1H88 A;  1FID A;  2JHK F;  2H43 C;  1J1D B;  1SQP K;  5BVZ A;  1NTK K;  1KFN A;  3IFM A;  1S9K E;  1LTI C;  1W2E A;  3RK3 D;  1FBM A;  2XNX C;  3P7K A;  2FFD C;  1LT9 B;  1N86 A;  1X8Y A;  3HE5 A;  3TK1 A;  1FOS E;  2J0H A;  1CZQ A;  1OXZ A;  5AW8 B;  4ZFG A;  1SP4 A;  4W80 A;  1NWQ A;  2Z5I A;  2E43 A;  1LT9 C;  1LWU B;  1NAF A;  1URQ B;  3EQ2 A;  3V4Q A;  1URQ D;  3HTK A;  3M0D C;  3BVH A;  2FKW B;  1FIC A;  2N1T A;  5AW5 B;  2WZ7 A;  2Q9I B;  1L0N K;  1RE3 B;  2KLV A;  1FDM A;  2R5B A;  3H32 B;  1DX7 A;  1GK4 A;  2XDJ A;  4IFM A;  2Q9I A;  4N6J A;  2WWW A;  4EPU A;  1N7S A;  2BAS A;  1GW4 A;  1HWT C;  1FZD A;  3TNU B;  1SQV K;  2J2P A;  3RK3 C;  1LTS C;  2LKM A;  4N3Y B;  2J0G A;  3MTU E;  2WT7 A;  2HPC A;  1URQ A;  3VP9 A;  3RK3 B;  4GT1 A;  1CSB A;  1RF0 A;  2IFM A;  1CW5 A;  1J2J B;  2YKQ A;  2J0Y A;  2XNX A;  1GK6 A;  1FZF C;  2JJL A;  3L35 A;  4GKG A;  1FZE C;  1IFN A;  1FZF B;  2GY7 A;  3HE5 B;  1ZLL A;  2YKO A;  2QM7 A;  1HTL C;  5CJ4 A;  1JUN A;  1URQ C;  3U1C A;  2WNP F;  3CL3 D;  1GL2 D;  4N78 D;  3NXS A;  4WY4 C;  1G1I A;  3SWF A;  1FZB C;  1X79 B;  1IK9 A;  1PFI A;  1T3U A;  1LWU C;  1SFC B;  3MIW A;  1ZR2 A;  4LGD E;  3RL0 B;  2Z4E C;  4ZKP A;  2FYU K;  2NPS D;  3CLQ A;  3LID A;  2N1T C;  2ZXE B;  1LTB C;  2CPB A;  4LC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...