1FZCC

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRIN
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 92
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcC02
1FZBC 2J2PA 3BVHB 1FZCB 2J60A 2GY7A 1N73A 2J1GA 2HODC 1RE3C 1N86C 2OYIB 2XNXB 2WNPF 1FZGB 1FZAB 2OYHC 3FIBA 1FZFA 1LT9B 1RF1A 2JHMF 4M7HA 2J3GA 4ZFGA 3H32A 2J3FD 1RF0A 3H32C 2Z4EB 1RE4B 1JY3N 2J61B 2JHHC 1LT9C 1M1JB 3HUSA 2HPCB 3HUSC 2H43B 2J64A 2FFDC 2HODA 1RE3A 2Q9IA 1FZEA 2Q9IC 1FZEC 3GHGC 1JY2O 3BVHA 2OYHA 2J0HA 1FZCA 2JHIF 3BVHC 2A45H 1FZCC 1FICA 1JY2P 1LTJB 1LWUB 3E1IB 1N73B 2OYIC 1FZGA 4M7FA 2XNXC 1FZGC 1FZAC 1LT9A 1FZFB 2FIBA 1LWUC 2HLOB 4R9TA 3E1IC 1RF0B 4NYTA 2A45I 2FFDA 2Z4EC 1RE4C 2J0GA 2J61A 1T3UA 3GHGA 1N86B 2HPCA 2HLOC 1FZBB 1M1JC 2HPCC 2H43A 4EPUA 2H43C 1FIDA 1JY3O 2J5ZA 2HODB 1RE3B 2A45G 2OYIA 2J3UA 2XNXA 2JHLF 1JY3P 1FZAA 2OYHB 1LTJA 1LWUA 1LTJC 1RF1B 3E1IA 4JYOX 1N73C 3H32B 1Z3SA 2J3OA 2Z4EA 1RE4A 4JZCA 1Z3UA 4R9JA 1JC9A 2D39A 1FZFC 2HLOA 1JY2N 1RF1C 1M1JA 2J0YA 1W2EA 3HUSB 2JHKF 1RF0C 2FFDB 2J3FA 1FZDA 1FIBA 2Q9IB 1FZEB 1N86A 3GHGB 1FZBA
chains in the Genus database with same CATH superfamily
2XU6A 1NTMJ 3CXHD 5B5EH 4Z1MH 1LNQA 1RE3C 4GKGA 4I7ZB 2XZRA 2K3RA 3AE5C 5APTA 1RF1A 2JHMF 4ZFGA 3CX5E 5CCHA 3AE9C 5CCHC 5KKZC 3Q5RA 1JY3N 2K88A 2N1TB 2R5BA 1NYHA 3TGUD 4UB6E 1KFMA 3CWBD 4PD4H 2H43B 3D6ZA 2QJPC 1JO5A 1SFCD 1NOHA 2OYHA 2YIUC 4Y99C 3V6IA 1BGYE 2VRSA 2KLUA 3BCCD 3HE4A 5E79E 5DJUB 2RH0A 2Z4EC 2Y0EA 1URQB 5KLVJ 2GA1A 1DH3A 1XTGB 2QIWA 2D2CC 1BCCJ 1VF5C 3IAOA 1VQ9P 3HD7A 3HD7C 1FOSF 4IL6E 2A45G 4LGDE 3AE1C 2Q6QA 2C0XA 1FOSE 3U59A 1VQPP 1JCDA 1SP4A 3QH9A 1J1EB 4JZCA 1UIIA 2OARA 2J0YA 1NTME 2QJKC 3CCLP 1GU5A 3H1LG 2E75C 2Q9IB 1FBMA 1KILE 4D6TJ 2XV5A 4W80A 3OJAB 3NFQA 3F89A 1FC2C 5KLVD 1YIJP 5AVZB 3VN0A 2A06E 4GOEA 1RF0A 1GK6A 1SLQA 2HYNA 2MJZA 2P58A 1NTKJ 1PP9G 3HUSA 3HUSC 3L74G 1KILB 1PPJD 1BE3G 2KIKA 1GD2E 2WPRA 3C1LA 1IJDB 4RKUJ 1KYOH 2M5AB 4AYCA 4PV1D 1LT9A 5GTIH 4LC1A 3R4YA 1YJ9P 4IOIH 1RE4C 3HRNA 3D70A 1PL5A 1NTZG 2FYUG 2V7QH 1RE3B 1FZAA 2WSCH 1L4AA 5APWA 1VQOP 1L4AC 2PAJA 5CBNA 1RF1B 1JMBA 1H0TA 2PFXA 3SWYA 2W27A 3RK2D 4R9JA 1GW3A 1K04A 5GTHH 1YITP 5KAIH 1IFJA 1OW8A 1E5WA 2W90A 2QJPB 1FZDA 1KFNA 3H1IG 2OTJP 3V2QA 3ABVC 2YIUB 4Y99B 2FYUK 1L0NG 2J60A 2J1GA 4U3FG 1VQ4P 5AVQB 1SQBG 2IBZG 1NU1G 2YNYA 1M7LA 1NTKE 1T6AA 2Z4EB 5APQA 4EDFA 2D2CB 1VF5B 3JCUH 3HD7B 1QGKB 3FXEA 2FFDC 3EFFK 3A0HH 1T2KC 1QX8A 2WPSA 3F5HA 1MZ9A 1Q81Q 4ZKPA 3L75J 1SS1A 3PJSK 3I5CA 3CCJP 5BU5A 2B9BA 4WWIA 4BRYA 2QJKB 2YXRB 5CCGA 2E75B 3G6EP 1ZRTD 1M1JC 1FDOA 1S5LH 4C7NA 5AVXB 2J5ZA 2JHLF 4OGQD 1YTZT 3W67A 2WMMA 3RBZA 5H2FH 1Q86Q 3WU2E 3A0BH 2WTYA 4IFFA 3H25A 3V2NA 4I6MC 3HUSB 2ZXEB 3H1JG 4WB4A 3H1HJ 1LTAC 1HUCA 1S5LX 3L71J 3L70D 1VQMP 5KAFE 2BCCE 2HODC 1SQVG 1WRGA 3KZIH 1FS0E 1H89A 3RGUA 1LT9B 4XFJA 2E5TA 4H44D 1YJNP 2Y9YA 4HJGH 1NH4A 1RE4B 3P32A 1SQXD 1OWAA 2BASA 1LP1A 3V4QA 2Y9ZA 4NPFX 2C9LY 1L0LK 3P8CE 1SQPK 2W6JH 2FXMA 2Q3EA 3CWBG 3AE4C 4UB8H 1SQQG 5B66H 3FX0A 4YPCA 4GOFA 2H88C 4KT0J 1L4AB 1JY2P 3NMDA 1N7SA 3OW2O 1D7MA 1N7SC 1HTLC 1H0TB 2L91A 3TSIA 1FZGA 2Q7CA 1FZGC 2RKLA 3H1KJ 2B87B 3CMEP 3LIDA 1GDTA 3L74D 4EIJA 2P2UA 1ZXGA 2J0GA 2O3JA 2NPSA 3HE5A 1BE3D 3LW5H 3FGAD 3A5TA 1FDMA 4I1LA 1VQLP 1JY3P 4I2LC 3TF5A 2WSEJ 2ZYGA 3H1LE 1NVOA 2K9YA 4PD4D 1S3JA 1NTZD 4Y28J 4N78E 3RK3D 2FFDB 5AW3B 4ZMDA 1N86A 5EFWB 1N86C 1KORA 1JM0A 1S1CX 2R5DA 2RN0A 2R3CA 1KQGB 3VMAA 5APYA 1MFTA 3IFMA 2JEEA 5KLVG 2IYPA 3SWFA 1BCCG 1OXZA 2KNCB 4ASVA 1TU3F 3H1ID 2E74B 1HH0A 1M1JB 3G4SP 2ZVNB 1L0ND 2HFED 4U3FD 2J5UA 1OVUA 1RHZB 3JC22 1JUNA 3L72J 1SQBD 2J59M 3GW6A 2QEXP 1NU1D 2W6BA 2KOGA 1PPJG 1OZHA 1KQSO 1OW7A 2YKQA 2FYUE 4DOJA 2Y0CA 3E1IC 4D6TG 1EZVD 3AEGC 3CPWO 2ZJSE 3WUUA 1KZUB 1K9MQ 3RL0C 2HODB 4K35A 3VMZA 2FBWC 1BGYJ 4EOTA 4JYOX 1X79B 3CCUP 1AJYA 1L0LJ 2E42A 2HLOA 1LP1B 1SFCC 1RQUA 3II6A 4WY4A 2W83C 2WT7A 1U7JA 2YXQB 1N7SB 1W5CE 2FYNB 2M5AA 3C8VA 5CJ4A 1FZGB 3H1JD 3WMM0 3TDKA 2PGDA 2OQQA 2O1JA 3HE5B 1NJIQ 2QA4P 1RY3A 4U7JA 1JCCA 2O01J 1SQVD 1RE3A 5KTBA 2NZ2A 2OYOA 3CCMP 1KYOI 4IFMA 1FZCA 1FZCC 4YXWH 1AVOA 5AVVB 3M06A 1AFOA 1K05A 1KB9I 1JTHA 4WVZA 3IR9A 2IFNA 2IPPA 5AW2B 2Q3IA 3M0DC 1ZOYC 4XE5B 1SQQD 2QVAA 1EDIA 3CD6P 4CPGA 1N86B 3CXHI 1Q82Q 3AE7C 1FIDA 1KB9E 1HBWA 1NKNA 2XDJA 1LTJA 1L0LE 1SQPE 1LTJC 4OVNF 2QM7A 1ZLLA 2Z4EA 1NTMD 4WBAA 4LLHA 2O1KA 2FXOA 1GK4A 3CXHE 1M1KQ 3D6YA 1KILD 3GMAA 2R44A 1SVFA 1ZV8A 3FWLA 2WSEH 3K5BA 4PV1C 3L75G 4MN4C 2ZXXA 3L70G 3PP5A 3IN6A 1GTWA 3BATA 2ZT9D 2AXTH 3AEAC 3TGUE 1MKMA 2P10A 1OW6A 4C46A 1SQXG 4H0LD 2R32A 3BCCE 1HJ0A 3CC7P 3RL0B 2M8RA 1FZEA 1W2BO 1FZEC 3AEBC 2FYZA 3RK2C 1ZMEC 1MFZA 2FXPA 1BCCD 1J1DB 2PRRA 1FE6A 3A0HE 3H1HG 2KK7A 2HLOB 1SFCB 3NXSA 1BSHA 4NYTA 2CPBA 4WY4B 3B5ND 1SQXK 3HTKB 3L71G 1K73Q 1LT1A 2WT7B 2M3EA 1HF9A 3FWNA 5TISE 4IFDK 5M1BA 4O9BA 4D6TD 1S5LE 1Z3SA 1RE4A 4R4LA 1LGHB 1ZR4A 4UB6H 4OWFA 1JMMA 2JHKF 5H2FE 3AE3C 1PGJA 2J3FA 2Z5HA 3VP9A 1FJKA 3OA7A 2P67A 1FZCB 3Q1MA 5AW0B 3KQGA 3SWKA 3L36A 1NTKD 3H1KG 4RO0A 2JR8A 5KKZB 1JTHB 2WNPF 5TJHA 1M57D 1OIPA 5E79H 1KTMA 2WQYC 2B87A 3VTPC 1VQ6P 1GL2D 1MUUA 1PPJE 4OGQC 1L2PA 2JO1A 1NTZK 2AEJA 3S4RA 3P7KA 2KS1B 3M9HA 1LTJB 3SSUA 2BCCJ 1IFIA 1IFNA 1IFDA 1Y8AA 1PGOA 1FJPA 2XNXC 2E76D 5AVTB 3L73E 2MKVA 2FFDA 2O01H 1EZVG 3S1KA 4PV1B 1L0NK 2N9BA 3OAKA 3KDPB 3GF7A 2LXCB 1SQBK 1YYCA 1NU1K 5L8RJ 4HKZH 4N6JA 1KN7A 1N73C 1S4XA 2KNCA 3KYQA 3CCSP 1Z3UA 1YJWP 2ZAEB 4JQ0D 1FZFC 4HYTB 1VDFA 1M1JA 1UIXA 1YQ3C 3L72G 2XNDH 5C39A 1CSBA 1L4AD 1A02J 1FZEB 1WMKA 2AXCA 3L37A 3W68A 2FKWB 3H6PA 3AE8C 3H1LJ 4DCKA 1T8ZA 5BVZA 2JKVA 3V4WA 1PFIA 4TT3H 2BEZF 3L75D 4B86A 1NKZB 2HODA 1BGYG 1P84I 2JHIF 2UWJE 1FICA 1M90Q 2YMKA 2OYIC 3RK3C 1OMIA 5CJ0A 1ZRTE 1EDLA 3WUTA 1PGQA 3E7KA 1LWUC 2Q5UA 4R9TA 1XTCC 2N9YB 2A45I 2QSIA 1P84E 4H13D 3CCEP 1G1IA 4AQRD 5AW9B 2K1AA 1ZP0C 3MD0A 1SQVK 2SPZA 2OTLP 3BRVB 3A7OA 2YMYA 3H1HD 4KJMA 1NGMB 1QL2A 3WUVA 3AEFC 1KC8Q 2K37A 2E74D 5KJ7D 5CCGD 2O01N 2GUSA 2R3SA 3L71D 1NTMG 3L70E 2FYUJ 2C0WA 1QVGO 1S9KD 4OGQB 4PJ0E 2NPSB 1SQQK 2GM4A 4NPEA 3BASA 2RMZA 4ASWA 1H88A 1SQXE 2A06G 1DEBA 2W8ZA 2XNXB 2KSEA 2WVRA 4M7HA 5K5GB 2QRXA 1KQFB 2QM8A 1KMIZ 2WPQA 3H1KD 1PP9E 1JB0J 1VQ8P 3L74E 1QLED 2QE7H 5B5EE 1N73B 3WU2H 4PD4I 1EDJA 4R4MA 1Q7YQ 1BE3E 3IF4A 1VQ5P 1NWQA 1OFCX 1QVFO 1FZFB 1T3JA 4DJGA 2J61A 1DEEG 4L76A 1VQKP 3VP8A 5KAFH 1NAFA 1R5SA 4PD4E 2OTKE 1LTIC 2J3UA 2CK3H 1KQLA 1NTZE 2IYOA 5KLVK 3RK3E 2Q1KA 3E1IA 1USEA 4EI2A 3CMAP 2PP6A 2NPSD 2H7HA 4L74A 5AW5B 2YO2A 3V2RA 2IBZI 3T97B 2JP3A 1Z56A 1FZBA 1RQVA 1FZBC 1GW4A 2I1JA 2WSFJ 3V2PA 2B88A 3H1IE 3EWKA 1NTKG 2OYIB 3RK3B 2N1TD 3A2AA 1L0NE 1SQPJ 1SFCA 4U3FE 3L72D 2J3GA 1EZVI 1SQBE 2IBZE 5KLIC 2HG5D 3HTKA 3CLQA 4YTPC 1NU1E 4DT0A 4EYYQ 2POHA 3CC2P 4DZOA 2IZ1A 1IZNB 1NHLA 2J58A 3CX5D 3R2PA 3GHGC 1KD1Q 2M0BA 1URQD 1KILC 4M3LA 2QJYC 3TGUJ 3CWBJ 3B4SA 3VMXA 4N3YB 1H8AA 1QL1A 1NAYA 1BGYD 1OVVA 3MZWB 3RL0g 2ZYDA 2L5GB 1LTTC 2ZT9C 3BCCJ 4EPUA 2V4HA 1L0LD 4ZKUA 1GZLA 1YQ4C 1G2CB 4H0LC 1JEKA 3M0DA 2J3OA 1R8EA 3S9OA 1KYOE 1HGVA 3RL0D 5GTIE 1RF1C 2E43A 1YBKA 3D71A 2KS1A 5CMZA 2BCCG 2ZFCA 3L4FA 3H1JE 2G3AA 1PV3A 3B5NA 3B5NC 2WITA 2OYHC 3FIBA 3M91A 1IO4A 4WY4D 4TLFA 1SQVE 4OH8B 1QEXA 2J61B 3I55P 3TNUA 5GTHE 1AQTA 2A06D 3AECC 5KAIE 2I1KA 3BVHA 5AVWB 3PRJA 3BVHC 3VMYA 3CWBE 1FDIA 1SQQE 3E1IB 1ZN5A 2G8YA 3E1RA 3Q2YA 3CC4P 1PGPA 1N7LA 1MV8A 3MTUE 4ZNCA 1G1JA 1CI6B 4GODA 3AEDC 5AW1B 3MIWA 1FZBB 3JCUE 5CCHD 4HB1A 1GL2A 3L35A 1GL2C 2ITAA 1EC5A 1S2EA 3GF3A 4JBZA 1FAVA 5KLIB 3MHVA 2ZYAA 1X22A 2OGUA 1JC9A 3L73J 2YKPA 2P1JA 2AEMA 1K8AQ 1RF0C 5AVYB 1X0TA 4XA4A 3USSA 3GHGB 2E76C 3MUDA 3MUDC 3CX5H 1AQ5A 2GY7A 2D2CD 1VF5D 2QJYB 3A3YB 3HD7D 3LW5J 2Y0DA 3GLMA 1N2DC 3KXDA 2H8PD 1VPCA 5KLVE 3A0BE 1LT9C 2W6AA 3NTNA 1BCCE 2ZT9B 1HGZA 2WSFH 1KB9H 1KV4A 1YHQP 2ZVOB 3O6QA 1JY2O 5CBOA 3U1CA 3SFDC 4H0LB 3G71P 3L73D 1J2JB 1VQ7P 2E75D 1DD3A 3B71A 4KHXA 3CXHH 3LIEA 3KZIE 1FZAC 3UIAA 2JJLA 2FIBA 3N4XA 5CHXA 1E79H 4IL6H 3M9BA 3P8MC 4D6TE 2WSSH 1LTGC 1JY3O 4W7YA 2XNXA 4UB8E 1EXIA 4C7RA 3B5NB 2OYHB 5B66E 2WPVB 1AVYA 2KUBA 1IK7A 2P7JA 3PH0A 3HE4B 3ZDMA 4IL6X 1U7MA 2KP8A 3TNUB 4YXDC 1HWTC 4H44C 5APVA 2J2PA 3BVHB 1IC2A 1N73A 1WT6A 1DIPA 2NRGA 1FZFA 4H13C 3CCQP 2JDIH 2GUVA 1Q90D 2IZ0A 2YKOA 2J3FD 1LJ2A 1YI2P 1X9VA 3L70J 2BCCD 3RK2B 3C9IA 3B8EB 3TK1A 2LXBA 1IK9A 2KZJA 1HJBA 2IFMA 5KJ7A 3M9QA 5TISH 2E74C 5AW6B 5KJ7C 1GL2B 5CCGC 3RBXA 1LTSC 1SQXJ 4NPDA 1PIXA 3P8CD 2KLVA 1P84D 2K9JA 4BWNA 3GG2A 1RF0B 3CCRP 4RJTA 3T97A 4BXLA 1M56D 1T3UA 3AE6C 2HPCA 2HPCC 2E76B 1JNMA 3VYIA 1L0LG 1SQPG 1PP9J 3CI9A 2OYIA 4W7ZA 2LKMA 3L74J 1GMJA 2DW3A 4JYCA 1LWUA 5APXA 1BE3J 1M8OB 1T2KD 1Y9BA 2D39A 2CPSA 2FY8A 1LTBC 1W2EA 3H1LD 1FU1A 1FIBA 1EQ7A 3O6QB 1EXJA 2KSJA 4GDOA 3TGUG 5APSA 1ZR2A 4N78D 2QG4A 1NTZJ 3L75E 1FZAB 5AVSB 3H32A 3MP7B 4L73A 3H32C 2BEQD 1YTZI 2FYNC 1PZQA 1N8RQ 3ITKA 3BCCG 1PP9D 2H89C 1A02F 1BDCA 4RESB 2KXPB 1R5LA 1DX7A 5DJTB 2NPSC 1IFMA 1G2CA 2J0HA 2IDBA 3H1IJ 3PHLA 4A7PA 1DD4A 1NTMK 3VOPA 4M7FA 3PLNA 4I7ZC 5APUA 1L0NJ 1EDKA 4U3FJ 2WWWA 1BSNA 1SQBJ 3KHUA 1OX3A 2KZIA 2WZ7A 5AVUB 2M3BA 1NU1J 3H1HE 4H44B 2N1TA 2N1TC 2C9NY 2H43A 3L71E 2FYUD 2H43C 4JPZB 3CL3D 2I8DA 1S9KE 1U57A 2KI7B 3AEEC 3N7NA 4H13B 3O8ZA 3BRTB 5AW7B 3PTZA 1CW5A 4BRYB 1N7SD 1VL2A 2IX7C 1URQA 1URQC 2Z5IA 3KPEA 4HH2A 1X8YA 4K3AA 1JOCA 5BU8B 3G9RA 1Q2NA 2KYVA 3AE2C 4C7NB 2IBZD 3M0AA 1AA0A 1BDDA 3EFGA 3H1KE 1CI6A 3TYYA 3Q3DA 2K9JB 2LR2A 1P84H 1J1EC 3Q5PA 2JHHC 1AV1A 2HPCB 1HVVA 2YO3A 2XKMA 3FXDA 1S72P 4JYBA 2J64A 2AEFA 2Q9IA 1RH5B 3I56P 1IFPA 2Q9IC 3H1JJ 2KB7P 2A45H 5AW4B 4L75A 1LWUB 3MGNA 4JF7A 3L73G 1GU4A 1Y47A 2V7QJ 2B89A 1USDA 2WSCJ 4PJ0H 2AXTE 1SQVJ 1J1DC 1VQNP 3U1AA 4QMAA 2JWDA 3GHGA 2HLOC 4GT1A 3Q5SA 5AVRB 1CZQA 1EZVE 4WY4C 1KILA 3EQ2A 1NTKK 3JSVC 3G3ZA 3QWOC 2JWAA 1KYOD 1SQQJ 3V5BA 3H32B 2HR3A 1KB9D 5AW8B 3CCVP 1JY2N 2E5YA 3SFEC 3CX5I 1SQPD 4AUWA 1ZW0A 4GIFA 1NO4A 3L72E 1OVRA
chains in the Genus database with same CATH topology
2XU6A 2R5DA 3MUDA 3L37A 1AQ5A 2R3CA 2GY7A 2FKWB 5APYA 1RE3C 3A3YB 3H6PA 4GKGA 3IFMA 2JEEA 2XZRA 3HD7D 5APTA 1T8ZA 5BVZA 1RF1A 2JHMF 4ZFGA 3SWFA 5CCHA 3V4WA 1OXZA 5CCHC 1N2DC 2H8PD 1PFIA 1JY3N 1VPCA 1LT9C 2W6AA 1HH0A 3NTNA 2N1TB 1M1JB 2R5BA 1HGZA 2WSFH 4B86A 1KFMA 2HFED 2H43B 1NKZB 2HODA 1JUNA 1JO5A 1SFCD 2J59M 1JY2O 1NOHA 2OYHA 2JHIF 1FICA 2W6BA 3U1CA 2KOGA 4Y99C 1J2JB 2VRSA 2OYIC 4KHXA 5CJ0A 3RK3C 2YKQA 3LIEA 3HE4A 1FZAC 3UIAA 2JJLA 4DOJA 2FIBA 1LWUC 2Q5UA 3N4XA 4R9TA 3E1IC 1XTCC 2A45I 5CHXA 2Z4EC 1URQB 1DH3A 1XTGB 3M9BA 1G1IA 1KZUB 3P8MC 4AQRD 3HD7A 5AW9B 3HD7C 1LTGC 3RL0C 3MD0A 1FOSF 1JY3O 1SQVK 4W7YA 2HODB 2A45G 2XNXA 3BRVB 3VMZA 4C7RA 3A7OA 3B5NB 2YMYA 4LGDE 2OYHB 1QL2A 2C0XA 1FOSE 3U59A 4EOTA 1JCDA 5KJ7D 4JYOX 5CCGD 2P7JA 1SP4A 1X79B 1J1EB 2GUSA 4JZCA 3HE4B 2C0WA 2E42A 2HLOA 1S9KD 2OARA 2J0YA 1SFCC 2KP8A 3II6A 3TNUB 4WY4A 1GU5A 1HWTC 1SQQK 2GM4A 2Q9IB 1FBMA 2WT7A 2XV5A 4W80A 5APVA 2J2PA 3BVHB 3BASA 1H88A 3OJAB 1IC2A 1N73A 1WT6A 3NFQA 1N7SB 1DEBA 2XNXB 5CJ4A 1FZGB 1FZFA 2GUVA 5AVZB 3VN0A 4M7HA 2YKOA 2J3FD 1RF0A 1GK6A 3WMM0 1SLQA 1X9VA 2HYNA 2MJZA 2QM8A 2O1JA 3RK2B 3C9IA 3B8EB 3HE5B 3HUSA 3TK1A 3HUSC 1IK9A 1RY3A 2WPQA 1HJBA 1JCCA 1KILB 2IFMA 5KJ7A 1RE3A 3M9QA 5KTBA 5AW6B 5KJ7C 1GL2B 5CCGC 4IFMA 1FZCA 1FZCC 1LTSC 5AVVB 1N73B 1GD2E 2WPRA 3M06A 1AFOA 1IJDB 1JTHA 3P8CD 3IR9A 2IFNA 2KLVA 4AYCA 1LT9A 1NWQA 2IPPA 1FZFB 4LC1A 5AW2B 2Q3IA 1T3JA 1RF0B 3M0DC 1RE4C 4XE5B 3T97A 2J61A 1T3UA 3HRNA 1N86B 2HPCA 3VP8A 2HPCC 1NAFA 1JNMA 3VYIA 1FIDA 1HBWA 1RE3B 1LTIC 3CI9A 2OYIA 4W7ZA 2J3UA 1NKNA 1FZAA 2LKMA 1KQLA 2WSCH 5KLVK 1L4AA 5APWA 2XDJA 1L4AC 1LTJA 4JYCA 1LWUA 2PAJA 1LTJC 1RF1B 3E1IA 3SWYA 2QM7A 1ZLLA 2W27A 4WBAA 5APXA 2PP6A 3RK2D 2NPSD 4LLHA 2Z4EA 2O1KA 4R9JA 1T2KD 1GK4A 1GW3A 2D39A 2H7HA 1KILD 2CPSA 1LTBC 1W2EA 5AW5B 1IFJA 2YO2A 1E5WA 3V2RA 1SVFA 1FU1A 1ZV8A 1KFNA 1FIBA 1FZDA 2WSEH 3V2QA 1EQ7A 1Z56A 1FZBA 1FZBC 1GW4A 2KSJA 2I1JA 4Y99B 2FYUK 3V2PA 3PP5A 2J60A 5APSA 2J1GA 1ZR2A 1GTWA 2OYIB 3BATA 4N78D 2N1TD 3RK3B 5AVQB 1FZAB 3A2AA 2YNYA 1SFCA 5AVSB 1M7LA 2J3GA 3H32A 3H32C 1YTZI 2Z4EB 2HG5D 3HTKA 3CLQA 5APQA 4C46A 2POHA 1A02F 4DZOA 2R32A 3HD7B 1NHLA 4RESB 3RL0B 2FFDC 2M8RA 2J58A 1DX7A 1FZEA 3R2PA 1FZEC 3GHGC 2FYZA 3RK2C 2NPSC 1IFMA 1MFZA 1G2CA 1T2KC 2J0HA 2WPSA 1URQD 1J1DB 1KILC 4M3LA 1MZ9A 1NTMK 3VOPA 4ZKPA 4M7FA 3I5CA 5APUA 5BU5A 2WWWA 3VMXA 2HLOB 1SFCB 3NXSA 4NYTA 4N3YB 2CPBA 2WZ7A 4WY4B 1H8AA 3B5ND 1QL1A 2M3BA 1SQXK 3HTKB 5AVUB 5CCGA 2N1TA 2WT7B 2L5GB 2N1TC 1LTTC 1M1JC 2C9NY 2H43A 4EPUA 2H43C 4ZKUA 4C7NA 5AVXB 3CL3D 2J5ZA 2JHLF 1S9KE 4IFDK 1GZLA 1G2CB 3N7NA 1YTZT 4O9BA 3O8ZA 3BRTB 3M0DA 1Z3SA 2J3OA 5AW7B 1RE4A 1CW5A 2WTYA 4IFFA 1HGVA 1LGHB 3RL0D 1ZR4A 1RF1C 1N7SD 3V2NA 4I6MC 3HUSB 2E43A 1JMMA 2IX7C 2JHKF 2ZXEB 1URQA 4WB4A 1URQC 2Z5IA 2J3FA 1LTAC 5CMZA 2Z5HA 3KPEA 3VP9A 2ZFCA 1FJKA 3L4FA 3OA7A 4HH2A 1HUCA 1X8YA 2P67A 1FZCB 1JOCA 5BU8B 5AW0B 3KQGA 2KYVA 3L36A 4C7NB 2HODC 1WRGA 1JTHB 2WNPF 3B5NA 1H89A 3B5NC 2WITA 3M0AA 2OYHC 3FIBA 3M91A 1LT9B 1IO4A 4WY4D 3EFGA 3VTPC 1CI6A 3TYYA 1GL2D 1MUUA 1J1EC 1NH4A 1RE4B 3P32A 4OH8B 1OWAA 2BASA 2J61B 2JHHC 3V4QA 2HPCB 1HVVA 3TNUA 1NTZK 2YO3A 2XKMA 4JYBA 2C9LY 1L0LK 3P8CE 1SQPK 2J64A 2FXMA 3P7KA 2Q9IA 2Q9IC 2I1KA 3BVHA 5AVWB 3BVHC 2KB7P 1L4AB 2A45H 3M9HA 5AW4B 1JY2P 3VMYA 3NMDA 1LTJB 1LWUB 3MGNA 3E1IB 1N7SA 4JF7A 1N7SC 1HTLC 1ZN5A 1GU4A 1IFIA 1IFNA 1IFDA 3TSIA 1FZGA 1FJPA 2Q7CA 2XNXC 1FZGC 1N7LA 1MV8A 3MTUE 5AVTB 1J1DC 1G1JA 1CI6B 3LIDA 1GDTA 4EIJA 3U1AA 2P2UA 2FFDA 2O01H 2J0GA 5AW1B 3GHGA 2NPSA 3HE5A 2HLOC 3MIWA 1FZBB 4GT1A 3LW5H 5CCHD 5AVRB 1CZQA 1L0NK 2N9BA 3OAKA 4WY4C 1KILA 3EQ2A 1NTKK 1GL2A 3L35A 3KDPB 3A5TA 3G3ZA 1FDMA 1GL2C 4I1LA 1SQBK 1JY3P 1YYCA 4I2LC 1NU1K 4N6JA 3V5BA 1N73C 3H32B 1FAVA 3KYQA 1Z3UA 5AW8B 1JC9A 1FZFC 4HYTB 1VDFA 1JY2N 2YKPA 1M1JA 2P1JA 1RF0C 4N78E 3RK3D 2FFDB 5AW3B 1CSBA 4AUWA 5AVYB 1L4AD 1A02J 4XA4A 4GIFA 1FZEB 1N86A 1NO4A 3GHGB 2NPSB 1N86C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB C;  2J2P A;  3BVH B;  1FZC B;  2J60 A;  2GY7 A;  1N73 A;  2J1G A;  2HOD C;  1RE3 C;  1N86 C;  2OYI B;  2XNX B;  2WNP F;  1FZG B;  1FZA B;  2OYH C;  3FIB A;  1FZF A;  1LT9 B;  1RF1 A;  2JHM F;  4M7H A;  2J3G A;  4ZFG A;  3H32 A;  2J3F D;  1RF0 A;  3H32 C;  2Z4E B;  1RE4 B;  1JY3 N;  2J61 B;  2JHH C;  1LT9 C;  1M1J B;  3HUS A;  2HPC B;  3HUS C;  2H43 B;  2J64 A;  2FFD C;  2HOD A;  1RE3 A;  2Q9I A;  1FZE A;  2Q9I C;  1FZE C;  3GHG C;  1JY2 O;  3BVH A;  2OYH A;  2J0H A;  1FZC A;  2JHI F;  3BVH C;  2A45 H;  1FZC C;  1FIC A;  1JY2 P;  1LTJ B;  1LWU B;  3E1I B;  1N73 B;  2OYI C;  1FZG A;  4M7F A;  2XNX C;  1FZG C;  1FZA C;  1LT9 A;  1FZF B;  2FIB A;  1LWU C;  2HLO B;  4R9T A;  3E1I C;  1RF0 B;  4NYT A;  2A45 I;  2FFD A;  2Z4E C;  1RE4 C;  2J0G A;  2J61 A;  1T3U A;  3GHG A;  1N86 B;  2HPC A;  2HLO C;  1FZB B;  1M1J C;  2HPC C;  2H43 A;  4EPU A;  2H43 C;  1FID A;  1JY3 O;  2J5Z A;  2HOD B;  1RE3 B;  2A45 G;  2OYI A;  2J3U A;  2XNX A;  2JHL F;  1JY3 P;  1FZA A;  2OYH B;  1LTJ A;  1LWU A;  1LTJ C;  1RF1 B;  3E1I A;  4JYO X;  1N73 C;  3H32 B;  1Z3S A;  2J3O A;  2Z4E A;  1RE4 A;  4JZC A;  1Z3U A;  4R9J A;  1JC9 A;  2D39 A;  1FZF C;  2HLO A;  1JY2 N;  1RF1 C;  1M1J A;  2J0Y A;  1W2E A;  3HUS B;  2JHK F;  1RF0 C;  2FFD B;  2J3F A;  1FZD A;  1FIB A;  2Q9I B;  1FZE B;  1N86 A;  3GHG B;  1FZB A; 
#chains in the Genus database with same CATH topology
 2XU6 A;  1NTM J;  3CXH D;  5B5E H;  4Z1M H;  1LNQ A;  1RE3 C;  4GKG A;  4I7Z B;  2XZR A;  2K3R A;  3AE5 C;  5APT A;  1RF1 A;  2JHM F;  4ZFG A;  3CX5 E;  5CCH A;  3AE9 C;  5CCH C;  5KKZ C;  3Q5R A;  1JY3 N;  2K88 A;  2N1T B;  2R5B A;  1NYH A;  3TGU D;  4UB6 E;  1KFM A;  3CWB D;  4PD4 H;  2H43 B;  3D6Z A;  2QJP C;  1JO5 A;  1SFC D;  1NOH A;  2OYH A;  2YIU C;  4Y99 C;  3V6I A;  1BGY E;  2VRS A;  2KLU A;  3BCC D;  3HE4 A;  5E79 E;  5DJU B;  2RH0 A;  2Z4E C;  2Y0E A;  1URQ B;  5KLV J;  2GA1 A;  1DH3 A;  1XTG B;  2QIW A;  2D2C C;  1BCC J;  1VF5 C;  3IAO A;  1VQ9 P;  3HD7 A;  3HD7 C;  1FOS F;  4IL6 E;  2A45 G;  4LGD E;  3AE1 C;  2Q6Q A;  2C0X A;  1FOS E;  3U59 A;  1VQP P;  1JCD A;  1SP4 A;  3QH9 A;  1J1E B;  4JZC A;  1UII A;  2OAR A;  2J0Y A;  1NTM E;  2QJK C;  3CCL P;  1GU5 A;  3H1L G;  2E75 C;  2Q9I B;  1FBM A;  1KIL E;  4D6T J;  2XV5 A;  4W80 A;  3OJA B;  3NFQ A;  3F89 A;  1FC2 C;  5KLV D;  1YIJ P;  5AVZ B;  3VN0 A;  2A06 E;  4GOE A;  1RF0 A;  1GK6 A;  1SLQ A;  2HYN A;  2MJZ A;  2P58 A;  1NTK J;  1PP9 G;  3HUS A;  3HUS C;  3L74 G;  1KIL B;  1PPJ D;  1BE3 G;  2KIK A;  1GD2 E;  2WPR A;  3C1L A;  1IJD B;  4RKU J;  1KYO H;  2M5A B;  4AYC A;  4PV1 D;  1LT9 A;  5GTI H;  4LC1 A;  3R4Y A;  1YJ9 P;  4IOI H;  1RE4 C;  3HRN A;  3D70 A;  1PL5 A;  1NTZ G;  2FYU G;  2V7Q H;  1RE3 B;  1FZA A;  2WSC H;  1L4A A;  5APW A;  1VQO P;  1L4A C;  2PAJ A;  5CBN A;  1RF1 B;  1JMB A;  1H0T A;  2PFX A;  3SWY A;  2W27 A;  3RK2 D;  4R9J A;  1GW3 A;  1K04 A;  5GTH H;  1YIT P;  5KAI H;  1IFJ A;  1OW8 A;  1E5W A;  2W90 A;  2QJP B;  1FZD A;  1KFN A;  3H1I G;  2OTJ P;  3V2Q A;  3ABV C;  2YIU B;  4Y99 B;  2FYU K;  1L0N G;  2J60 A;  2J1G A;  4U3F G;  1VQ4 P;  5AVQ B;  1SQB G;  2IBZ G;  1NU1 G;  2YNY A;  1M7L A;  1NTK E;  1T6A A;  2Z4E B;  5APQ A;  4EDF A;  2D2C B;  1VF5 B;  3JCU H;  3HD7 B;  1QGK B;  3FXE A;  2FFD C;  3EFF K;  3A0H H;  1T2K C;  1QX8 A;  2WPS A;  3F5H A;  1MZ9 A;  1Q81 Q;  4ZKP A;  3L75 J;  1SS1 A;  3PJS K;  3I5C A;  3CCJ P;  5BU5 A;  2B9B A;  4WWI A;  4BRY A;  2QJK B;  2YXR B;  5CCG A;  2E75 B;  3G6E P;  1ZRT D;  1M1J C;  1FDO A;  1S5L H;  4C7N A;  5AVX B;  2J5Z A;  2JHL F;  4OGQ D;  1YTZ T;  3W67 A;  2WMM A;  3RBZ A;  5H2F H;  1Q86 Q;  3WU2 E;  3A0B H;  2WTY A;  4IFF A;  3H25 A;  3V2N A;  4I6M C;  3HUS B;  2ZXE B;  3H1J G;  4WB4 A;  3H1H J;  1LTA C;  1HUC A;  1S5L X;  3L71 J;  3L70 D;  1VQM P;  5KAF E;  2BCC E;  2HOD C;  1SQV G;  1WRG A;  3KZI H;  1FS0 E;  1H89 A;  3RGU A;  1LT9 B;  4XFJ A;  2E5T A;  4H44 D;  1YJN P;  2Y9Y A;  4HJG H;  1NH4 A;  1RE4 B;  3P32 A;  1SQX D;  1OWA A;  2BAS A;  1LP1 A;  3V4Q A;  2Y9Z A;  4NPF X;  2C9L Y;  1L0L K;  3P8C E;  1SQP K;  2W6J H;  2FXM A;  2Q3E A;  3CWB G;  3AE4 C;  4UB8 H;  1SQQ G;  5B66 H;  3FX0 A;  4YPC A;  4GOF A;  2H88 C;  4KT0 J;  1L4A B;  1JY2 P;  3NMD A;  1N7S A;  3OW2 O;  1D7M A;  1N7S C;  1HTL C;  1H0T B;  2L91 A;  3TSI A;  1FZG A;  2Q7C A;  1FZG C;  2RKL A;  3H1K J;  2B87 B;  3CME P;  3LID A;  1GDT A;  3L74 D;  4EIJ A;  2P2U A;  1ZXG A;  2J0G A;  2O3J A;  2NPS A;  3HE5 A;  1BE3 D;  3LW5 H;  3FGA D;  3A5T A;  1FDM A;  4I1L A;  1VQL P;  1JY3 P;  4I2L C;  3TF5 A;  2WSE J;  2ZYG A;  3H1L E;  1NVO A;  2K9Y A;  4PD4 D;  1S3J A;  1NTZ D;  4Y28 J;  4N78 E;  3RK3 D;  2FFD B;  5AW3 B;  4ZMD A;  1N86 A;  5EFW B;  1N86 C;  1KOR A;  1JM0 A;  1S1C X;  2R5D A;  2RN0 A;  2R3C A;  1KQG B;  3VMA A;  5APY A;  1MFT A;  3IFM A;  2JEE A;  5KLV G;  2IYP A;  3SWF A;  1BCC G;  1OXZ A;  2KNC B;  4ASV A;  1TU3 F;  3H1I D;  2E74 B;  1HH0 A;  1M1J B;  3G4S P;  2ZVN B;  1L0N D;  2HFE D;  4U3F D;  2J5U A;  1OVU A;  1RHZ B;  3JC2 2;  1JUN A;  3L72 J;  1SQB D;  2J59 M;  3GW6 A;  2QEX P;  1NU1 D;  2W6B A;  2KOG A;  1PPJ G;  1OZH A;  1KQS O;  1OW7 A;  2YKQ A;  2FYU E;  4DOJ A;  2Y0C A;  3E1I C;  4D6T G;  1EZV D;  3AEG C;  3CPW O;  2ZJS E;  3WUU A;  1KZU B;  1K9M Q;  3RL0 C;  2HOD B;  4K35 A;  3VMZ A;  2FBW C;  1BGY J;  4EOT A;  4JYO X;  1X79 B;  3CCU P;  1AJY A;  1L0L J;  2E42 A;  2HLO A;  1LP1 B;  1SFC C;  1RQU A;  3II6 A;  4WY4 A;  2W83 C;  2WT7 A;  1U7J A;  2YXQ B;  1N7S B;  1W5C E;  2FYN B;  2M5A A;  3C8V A;  5CJ4 A;  1FZG B;  3H1J D;  3WMM 0;  3TDK A;  2PGD A;  2OQQ A;  2O1J A;  3HE5 B;  1NJI Q;  2QA4 P;  1RY3 A;  4U7J A;  1JCC A;  2O01 J;  1SQV D;  1RE3 A;  5KTB A;  2NZ2 A;  2OYO A;  3CCM P;  1KYO I;  4IFM A;  1FZC A;  1FZC C;  4YXW H;  1AVO A;  5AVV B;  3M06 A;  1AFO A;  1K05 A;  1KB9 I;  1JTH A;  4WVZ A;  3IR9 A;  2IFN A;  2IPP A;  5AW2 B;  2Q3I A;  3M0D C;  1ZOY C;  4XE5 B;  1SQQ D;  2QVA A;  1EDI A;  3CD6 P;  4CPG A;  1N86 B;  3CXH I;  1Q82 Q;  3AE7 C;  1FID A;  1KB9 E;  1HBW A;  1NKN A;  2XDJ A;  1LTJ A;  1L0L E;  1SQP E;  1LTJ C;  4OVN F;  2QM7 A;  1ZLL A;  2Z4E A;  1NTM D;  4WBA A;  4LLH A;  2O1K A;  2FXO A;  1GK4 A;  3CXH E;  1M1K Q;  3D6Y A;  1KIL D;  3GMA A;  2R44 A;  1SVF A;  1ZV8 A;  3FWL A;  2WSE H;  3K5B A;  4PV1 C;  3L75 G;  4MN4 C;  2ZXX A;  3L70 G;  3PP5 A;  3IN6 A;  1GTW A;  3BAT A;  2ZT9 D;  2AXT H;  3AEA C;  3TGU E;  1MKM A;  2P10 A;  1OW6 A;  4C46 A;  1SQX G;  4H0L D;  2R32 A;  3BCC E;  1HJ0 A;  3CC7 P;  3RL0 B;  2M8R A;  1FZE A;  1W2B O;  1FZE C;  3AEB C;  2FYZ A;  3RK2 C;  1ZME C;  1MFZ A;  2FXP A;  1BCC D;  1J1D B;  2PRR A;  1FE6 A;  3A0H E;  3H1H G;  2KK7 A;  2HLO B;  1SFC B;  3NXS A;  1BSH A;  4NYT A;  2CPB A;  4WY4 B;  3B5N D;  1SQX K;  3HTK B;  3L71 G;  1K73 Q;  1LT1 A;  2WT7 B;  2M3E A;  1HF9 A;  3FWN A;  5TIS E;  4IFD K;  5M1B A;  4O9B A;  4D6T D;  1S5L E;  1Z3S A;  1RE4 A;  4R4L A;  1LGH B;  1ZR4 A;  4UB6 H;  4OWF A;  1JMM A;  2JHK F;  5H2F E;  3AE3 C;  1PGJ A;  2J3F A;  2Z5H A;  3VP9 A;  1FJK A;  3OA7 A;  2P67 A;  1FZC B;  3Q1M A;  5AW0 B;  3KQG A;  3SWK A;  3L36 A;  1NTK D;  3H1K G;  4RO0 A;  2JR8 A;  5KKZ B;  1JTH B;  2WNP F;  5TJH A;  1M57 D;  1OIP A;  5E79 H;  1KTM A;  2WQY C;  2B87 A;  3VTP C;  1VQ6 P;  1GL2 D;  1MUU A;  1PPJ E;  4OGQ C;  1L2P A;  2JO1 A;  1NTZ K;  2AEJ A;  3S4R A;  3P7K A;  2KS1 B;  3M9H A;  1LTJ B;  3SSU A;  2BCC J;  1IFI A;  1IFN A;  1IFD A;  1Y8A A;  1PGO A;  1FJP A;  2XNX C;  2E76 D;  5AVT B;  3L73 E;  2MKV A;  2FFD A;  2O01 H;  1EZV G;  3S1K A;  4PV1 B;  1L0N K;  2N9B A;  3OAK A;  3KDP B;  3GF7 A;  2LXC B;  1SQB K;  1YYC A;  1NU1 K;  5L8R J;  4HKZ H;  4N6J A;  1KN7 A;  1N73 C;  1S4X A;  2KNC A;  3KYQ A;  3CCS P;  1Z3U A;  1YJW P;  2ZAE B;  4JQ0 D;  1FZF C;  4HYT B;  1VDF A;  1M1J A;  1UIX A;  1YQ3 C;  3L72 G;  2XND H;  5C39 A;  1CSB A;  1L4A D;  1A02 J;  1FZE B;  1WMK A;  2AXC A;  3L37 A;  3W68 A;  2FKW B;  3H6P A;  3AE8 C;  3H1L J;  4DCK A;  1T8Z A;  5BVZ A;  2JKV A;  3V4W A;  1PFI A;  4TT3 H;  2BEZ F;  3L75 D;  4B86 A;  1NKZ B;  2HOD A;  1BGY G;  1P84 I;  2JHI F;  2UWJ E;  1FIC A;  1M90 Q;  2YMK A;  2OYI C;  3RK3 C;  1OMI A;  5CJ0 A;  1ZRT E;  1EDL A;  3WUT A;  1PGQ A;  3E7K A;  1LWU C;  2Q5U A;  4R9T A;  1XTC C;  2N9Y B;  2A45 I;  2QSI A;  1P84 E;  4H13 D;  3CCE P;  1G1I A;  4AQR D;  5AW9 B;  2K1A A;  1ZP0 C;  3MD0 A;  1SQV K;  2SPZ A;  2OTL P;  3BRV B;  3A7O A;  2YMY A;  3H1H D;  4KJM A;  1NGM B;  1QL2 A;  3WUV A;  3AEF C;  1KC8 Q;  2K37 A;  2E74 D;  5KJ7 D;  5CCG D;  2O01 N;  2GUS A;  2R3S A;  3L71 D;  1NTM G;  3L70 E;  2FYU J;  2C0W A;  1QVG O;  1S9K D;  4OGQ B;  4PJ0 E;  2NPS B;  1SQQ K;  2GM4 A;  4NPE A;  3BAS A;  2RMZ A;  4ASW A;  1H88 A;  1SQX E;  2A06 G;  1DEB A;  2W8Z A;  2XNX B;  2KSE A;  2WVR A;  4M7H A;  5K5G B;  2QRX A;  1KQF B;  2QM8 A;  1KMI Z;  2WPQ A;  3H1K D;  1PP9 E;  1JB0 J;  1VQ8 P;  3L74 E;  1QLE D;  2QE7 H;  5B5E E;  1N73 B;  3WU2 H;  4PD4 I;  1EDJ A;  4R4M A;  1Q7Y Q;  1BE3 E;  3IF4 A;  1VQ5 P;  1NWQ A;  1OFC X;  1QVF O;  1FZF B;  1T3J A;  4DJG A;  2J61 A;  1DEE G;  4L76 A;  1VQK P;  3VP8 A;  5KAF H;  1NAF A;  1R5S A;  4PD4 E;  2OTK E;  1LTI C;  2J3U A;  2CK3 H;  1KQL A;  1NTZ E;  2IYO A;  5KLV K;  3RK3 E;  2Q1K A;  3E1I A;  1USE A;  4EI2 A;  3CMA P;  2PP6 A;  2NPS D;  2H7H A;  4L74 A;  5AW5 B;  2YO2 A;  3V2R A;  2IBZ I;  3T97 B;  2JP3 A;  1Z56 A;  1FZB A;  1RQV A;  1FZB C;  1GW4 A;  2I1J A;  2WSF J;  3V2P A;  2B88 A;  3H1I E;  3EWK A;  1NTK G;  2OYI B;  3RK3 B;  2N1T D;  3A2A A;  1L0N E;  1SQP J;  1SFC A;  4U3F E;  3L72 D;  2J3G A;  1EZV I;  1SQB E;  2IBZ E;  5KLI C;  2HG5 D;  3HTK A;  3CLQ A;  4YTP C;  1NU1 E;  4DT0 A;  4EYY Q;  2POH A;  3CC2 P;  4DZO A;  2IZ1 A;  1IZN B;  1NHL A;  2J58 A;  3CX5 D;  3R2P A;  3GHG C;  1KD1 Q;  2M0B A;  1URQ D;  1KIL C;  4M3L A;  2QJY C;  3TGU J;  3CWB J;  3B4S A;  3VMX A;  4N3Y B;  1H8A A;  1QL1 A;  1NAY A;  1BGY D;  1OVV A;  3MZW B;  3RL0 g;  2ZYD A;  2L5G B;  1LTT C;  2ZT9 C;  3BCC J;  4EPU A;  2V4H A;  1L0L D;  4ZKU A;  1GZL A;  1YQ4 C;  1G2C B;  4H0L C;  1JEK A;  3M0D A;  2J3O A;  1R8E A;  3S9O A;  1KYO E;  1HGV A;  3RL0 D;  5GTI E;  1RF1 C;  2E43 A;  1YBK A;  3D71 A;  2KS1 A;  5CMZ A;  2BCC G;  2ZFC A;  3L4F A;  3H1J E;  2G3A A;  1PV3 A;  3B5N A;  3B5N C;  2WIT A;  2OYH C;  3FIB A;  3M91 A;  1IO4 A;  4WY4 D;  4TLF A;  1SQV E;  4OH8 B;  1QEX A;  2J61 B;  3I55 P;  3TNU A;  5GTH E;  1AQT A;  2A06 D;  3AEC C;  5KAI E;  2I1K A;  3BVH A;  5AVW B;  3PRJ A;  3BVH C;  3VMY A;  3CWB E;  1FDI A;  1SQQ E;  3E1I B;  1ZN5 A;  2G8Y A;  3E1R A;  3Q2Y A;  3CC4 P;  1PGP A;  1N7L A;  1MV8 A;  3MTU E;  4ZNC A;  1G1J A;  1CI6 B;  4GOD A;  3AED C;  5AW1 B;  3MIW A;  1FZB B;  3JCU E;  5CCH D;  4HB1 A;  1GL2 A;  3L35 A;  1GL2 C;  2ITA A;  1EC5 A;  1S2E A;  3GF3 A;  4JBZ A;  1FAV A;  5KLI B;  3MHV A;  2ZYA A;  1X22 A;  2OGU A;  1JC9 A;  3L73 J;  2YKP A;  2P1J A;  2AEM A;  1K8A Q;  1RF0 C;  5AVY B;  1X0T A;  4XA4 A;  3USS A;  3GHG B;  2E76 C;  3MUD A;  3MUD C;  3CX5 H;  1AQ5 A;  2GY7 A;  2D2C D;  1VF5 D;  2QJY B;  3A3Y B;  3HD7 D;  3LW5 J;  2Y0D A;  3GLM A;  1N2D C;  3KXD A;  2H8P D;  1VPC A;  5KLV E;  3A0B E;  1LT9 C;  2W6A A;  3NTN A;  1BCC E;  2ZT9 B;  1HGZ A;  2WSF H;  1KB9 H;  1KV4 A;  1YHQ P;  2ZVO B;  3O6Q A;  1JY2 O;  5CBO A;  3U1C A;  3SFD C;  4H0L B;  3G71 P;  3L73 D;  1J2J B;  1VQ7 P;  2E75 D;  1DD3 A;  3B71 A;  4KHX A;  3CXH H;  3LIE A;  3KZI E;  1FZA C;  3UIA A;  2JJL A;  2FIB A;  3N4X A;  5CHX A;  1E79 H;  4IL6 H;  3M9B A;  3P8M C;  4D6T E;  2WSS H;  1LTG C;  1JY3 O;  4W7Y A;  2XNX A;  4UB8 E;  1EXI A;  4C7R A;  3B5N B;  2OYH B;  5B66 E;  2WPV B;  1AVY A;  2KUB A;  1IK7 A;  2P7J A;  3PH0 A;  3HE4 B;  3ZDM A;  4IL6 X;  1U7M A;  2KP8 A;  3TNU B;  4YXD C;  1HWT C;  4H44 C;  5APV A;  2J2P A;  3BVH B;  1IC2 A;  1N73 A;  1WT6 A;  1DIP A;  2NRG A;  1FZF A;  4H13 C;  3CCQ P;  2JDI H;  2GUV A;  1Q90 D;  2IZ0 A;  2YKO A;  2J3F D;  1LJ2 A;  1YI2 P;  1X9V A;  3L70 J;  2BCC D;  3RK2 B;  3C9I A;  3B8E B;  3TK1 A;  2LXB A;  1IK9 A;  2KZJ A;  1HJB A;  2IFM A;  5KJ7 A;  3M9Q A;  5TIS H;  2E74 C;  5AW6 B;  5KJ7 C;  1GL2 B;  5CCG C;  3RBX A;  1LTS C;  1SQX J;  4NPD A;  1PIX A;  3P8C D;  2KLV A;  1P84 D;  2K9J A;  4BWN A;  3GG2 A;  1RF0 B;  3CCR P;  4RJT A;  3T97 A;  4BXL A;  1M56 D;  1T3U A;  3AE6 C;  2HPC A;  2HPC C;  2E76 B;  1JNM A;  3VYI A;  1L0L G;  1SQP G;  1PP9 J;  3CI9 A;  2OYI A;  4W7Z A;  2LKM A;  3L74 J;  1GMJ A;  2DW3 A;  4JYC A;  1LWU A;  5APX A;  1BE3 J;  1M8O B;  1T2K D;  1Y9B A;  2D39 A;  2CPS A;  2FY8 A;  1LTB C;  1W2E A;  3H1L D;  1FU1 A;  1FIB A;  1EQ7 A;  3O6Q B;  1EXJ A;  2KSJ A;  4GDO A;  3TGU G;  5APS A;  1ZR2 A;  4N78 D;  2QG4 A;  1NTZ J;  3L75 E;  1FZA B;  5AVS B;  3H32 A;  3MP7 B;  4L73 A;  3H32 C;  2BEQ D;  1YTZ I;  2FYN C;  1PZQ A;  1N8R Q;  3ITK A;  3BCC G;  1PP9 D;  2H89 C;  1A02 F;  1BDC A;  4RES B;  2KXP B;  1R5L A;  1DX7 A;  5DJT B;  2NPS C;  1IFM A;  1G2C A;  2J0H A;  2IDB A;  3H1I J;  3PHL A;  4A7P A;  1DD4 A;  1NTM K;  3VOP A;  4M7F A;  3PLN A;  4I7Z C;  5APU A;  1L0N J;  1EDK A;  4U3F J;  2WWW A;  1BSN A;  1SQB J;  3KHU A;  1OX3 A;  2KZI A;  2WZ7 A;  5AVU B;  2M3B A;  1NU1 J;  3H1H E;  4H44 B;  2N1T A;  2N1T C;  2C9N Y;  2H43 A;  3L71 E;  2FYU D;  2H43 C;  4JPZ B;  3CL3 D;  2I8D A;  1S9K E;  1U57 A;  2KI7 B;  3AEE C;  3N7N A;  4H13 B;  3O8Z A;  3BRT B;  5AW7 B;  3PTZ A;  1CW5 A;  4BRY B;  1N7S D;  1VL2 A;  2IX7 C;  1URQ A;  1URQ C;  2Z5I A;  3KPE A;  4HH2 A;  1X8Y A;  4K3A A;  1JOC A;  5BU8 B;  3G9R A;  1Q2N A;  2KYV A;  3AE2 C;  4C7N B;  2IBZ D;  3M0A A;  1AA0 A;  1BDD A;  3EFG A;  3H1K E;  1CI6 A;  3TYY A;  3Q3D A;  2K9J B;  2LR2 A;  1P84 H;  1J1E C;  3Q5P A;  2JHH C;  1AV1 A;  2HPC B;  1HVV A;  2YO3 A;  2XKM A;  3FXD A;  1S72 P;  4JYB A;  2J64 A;  2AEF A;  2Q9I A;  1RH5 B;  3I56 P;  1IFP A;  2Q9I C;  3H1J J;  2KB7 P;  2A45 H;  5AW4 B;  4L75 A;  1LWU B;  3MGN A;  4JF7 A;  3L73 G;  1GU4 A;  1Y47 A;  2V7Q J;  2B89 A;  1USD A;  2WSC J;  4PJ0 H;  2AXT E;  1SQV J;  1J1D C;  1VQN P;  3U1A A;  4QMA A;  2JWD A;  3GHG A;  2HLO C;  4GT1 A;  3Q5S A;  5AVR B;  1CZQ A;  1EZV E;  4WY4 C;  1KIL A;  3EQ2 A;  1NTK K;  3JSV C;  3G3Z A;  3QWO C;  2JWA A;  1KYO D;  1SQQ J;  3V5B A;  3H32 B;  2HR3 A;  1KB9 D;  5AW8 B;  3CCV P;  1JY2 N;  2E5Y A;  3SFE C;  3CX5 I;  1SQP D;  4AUW A;  1ZW0 A;  4GIF A;  1NO4 A;  3L72 E;  1OVR A; 
#chains in the Genus database with same CATH homology
 2XU6 A;  2R5D A;  3MUD A;  3L37 A;  1AQ5 A;  2R3C A;  2GY7 A;  2FKW B;  5APY A;  1RE3 C;  3A3Y B;  3H6P A;  4GKG A;  3IFM A;  2JEE A;  2XZR A;  3HD7 D;  5APT A;  1T8Z A;  5BVZ A;  1RF1 A;  2JHM F;  4ZFG A;  3SWF A;  5CCH A;  3V4W A;  1OXZ A;  5CCH C;  1N2D C;  2H8P D;  1PFI A;  1JY3 N;  1VPC A;  1LT9 C;  2W6A A;  1HH0 A;  3NTN A;  2N1T B;  1M1J B;  2R5B A;  1HGZ A;  2WSF H;  4B86 A;  1KFM A;  2HFE D;  2H43 B;  1NKZ B;  2HOD A;  1JUN A;  1JO5 A;  1SFC D;  2J59 M;  1JY2 O;  1NOH A;  2OYH A;  2JHI F;  1FIC A;  2W6B A;  3U1C A;  2KOG A;  4Y99 C;  1J2J B;  2VRS A;  2OYI C;  4KHX A;  5CJ0 A;  3RK3 C;  2YKQ A;  3LIE A;  3HE4 A;  1FZA C;  3UIA A;  2JJL A;  4DOJ A;  2FIB A;  1LWU C;  2Q5U A;  3N4X A;  4R9T A;  3E1I C;  1XTC C;  2A45 I;  5CHX A;  2Z4E C;  1URQ B;  1DH3 A;  1XTG B;  3M9B A;  1G1I A;  1KZU B;  3P8M C;  4AQR D;  3HD7 A;  5AW9 B;  3HD7 C;  1LTG C;  3RL0 C;  3MD0 A;  1FOS F;  1JY3 O;  1SQV K;  4W7Y A;  2HOD B;  2A45 G;  2XNX A;  3BRV B;  3VMZ A;  4C7R A;  3A7O A;  3B5N B;  2YMY A;  4LGD E;  2OYH B;  1QL2 A;  2C0X A;  1FOS E;  3U59 A;  4EOT A;  1JCD A;  5KJ7 D;  4JYO X;  5CCG D;  2P7J A;  1SP4 A;  1X79 B;  1J1E B;  2GUS A;  4JZC A;  3HE4 B;  2C0W A;  2E42 A;  2HLO A;  1S9K D;  2OAR A;  2J0Y A;  1SFC C;  2KP8 A;  3II6 A;  3TNU B;  4WY4 A;  1GU5 A;  1HWT C;  1SQQ K;  2GM4 A;  2Q9I B;  1FBM A;  2WT7 A;  2XV5 A;  4W80 A;  5APV A;  2J2P A;  3BVH B;  3BAS A;  1H88 A;  3OJA B;  1IC2 A;  1N73 A;  1WT6 A;  3NFQ A;  1N7S B;  1DEB A;  2XNX B;  5CJ4 A;  1FZG B;  1FZF A;  2GUV A;  5AVZ B;  3VN0 A;  4M7H A;  2YKO A;  2J3F D;  1RF0 A;  1GK6 A;  3WMM 0;  1SLQ A;  1X9V A;  2HYN A;  2MJZ A;  2QM8 A;  2O1J A;  3RK2 B;  3C9I A;  3B8E B;  3HE5 B;  3HUS A;  3TK1 A;  3HUS C;  1IK9 A;  1RY3 A;  2WPQ A;  1HJB A;  1JCC A;  1KIL B;  2IFM A;  5KJ7 A;  1RE3 A;  3M9Q A;  5KTB A;  5AW6 B;  5KJ7 C;  1GL2 B;  5CCG C;  4IFM A;  1FZC A;  1FZC C;  1LTS C;  5AVV B;  1N73 B;  1GD2 E;  2WPR A;  3M06 A;  1AFO A;  1IJD B;  1JTH A;  3P8C D;  3IR9 A;  2IFN A;  2KLV A;  4AYC A;  1LT9 A;  1NWQ A;  2IPP A;  1FZF B;  4LC1 A;  5AW2 B;  2Q3I A;  1T3J A;  1RF0 B;  3M0D C;  1RE4 C;  4XE5 B;  3T97 A;  2J61 A;  1T3U A;  3HRN A;  1N86 B;  2HPC A;  3VP8 A;  2HPC C;  1NAF A;  1JNM A;  3VYI A;  1FID A;  1HBW A;  1RE3 B;  1LTI C;  3CI9 A;  2OYI A;  4W7Z A;  2J3U A;  1NKN A;  1FZA A;  2LKM A;  1KQL A;  2WSC H;  5KLV K;  1L4A A;  5APW A;  2XDJ A;  1L4A C;  1LTJ A;  4JYC A;  1LWU A;  2PAJ A;  1LTJ C;  1RF1 B;  3E1I A;  3SWY A;  2QM7 A;  1ZLL A;  2W27 A;  4WBA A;  5APX A;  2PP6 A;  3RK2 D;  2NPS D;  4LLH A;  2Z4E A;  2O1K A;  4R9J A;  1T2K D;  1GK4 A;  1GW3 A;  2D39 A;  2H7H A;  1KIL D;  2CPS A;  1LTB C;  1W2E A;  5AW5 B;  1IFJ A;  2YO2 A;  1E5W A;  3V2R A;  1SVF A;  1FU1 A;  1ZV8 A;  1KFN A;  1FIB A;  1FZD A;  2WSE H;  3V2Q A;  1EQ7 A;  1Z56 A;  1FZB A;  1FZB C;  1GW4 A;  2KSJ A;  2I1J A;  4Y99 B;  2FYU K;  3V2P A;  3PP5 A;  2J60 A;  5APS A;  2J1G A;  1ZR2 A;  1GTW A;  2OYI B;  3BAT A;  4N78 D;  2N1T D;  3RK3 B;  5AVQ B;  1FZA B;  3A2A A;  2YNY A;  1SFC A;  5AVS B;  1M7L A;  2J3G A;  3H32 A;  3H32 C;  1YTZ I;  2Z4E B;  2HG5 D;  3HTK A;  3CLQ A;  5APQ A;  4C46 A;  2POH A;  1A02 F;  4DZO A;  2R32 A;  3HD7 B;  1NHL A;  4RES B;  3RL0 B;  2FFD C;  2M8R A;  2J58 A;  1DX7 A;  1FZE A;  3R2P A;  1FZE C;  3GHG C;  2FYZ A;  3RK2 C;  2NPS C;  1IFM A;  1MFZ A;  1G2C A;  1T2K C;  2J0H A;  2WPS A;  1URQ D;  1J1D B;  1KIL C;  4M3L A;  1MZ9 A;  1NTM K;  3VOP A;  4ZKP A;  4M7F A;  3I5C A;  5APU A;  5BU5 A;  2WWW A;  3VMX A;  2HLO B;  1SFC B;  3NXS A;  4NYT A;  4N3Y B;  2CPB A;  2WZ7 A;  4WY4 B;  1H8A A;  3B5N D;  1QL1 A;  2M3B A;  1SQX K;  3HTK B;  5AVU B;  5CCG A;  2N1T A;  2WT7 B;  2L5G B;  2N1T C;  1LTT C;  1M1J C;  2C9N Y;  2H43 A;  4EPU A;  2H43 C;  4ZKU A;  4C7N A;  5AVX B;  3CL3 D;  2J5Z A;  2JHL F;  1S9K E;  4IFD K;  1GZL A;  1G2C B;  3N7N A;  1YTZ T;  4O9B A;  3O8Z A;  3BRT B;  3M0D A;  1Z3S A;  2J3O A;  5AW7 B;  1RE4 A;  1CW5 A;  2WTY A;  4IFF A;  1HGV A;  1LGH B;  3RL0 D;  1ZR4 A;  1RF1 C;  1N7S D;  3V2N A;  4I6M C;  3HUS B;  2E43 A;  1JMM A;  2IX7 C;  2JHK F;  2ZXE B;  1URQ A;  4WB4 A;  1URQ C;  2Z5I A;  2J3F A;  1LTA C;  5CMZ A;  2Z5H A;  3KPE A;  3VP9 A;  2ZFC A;  1FJK A;  3L4F A;  3OA7 A;  4HH2 A;  1HUC A;  1X8Y A;  2P67 A;  1FZC B;  1JOC A;  5BU8 B;  5AW0 B;  3KQG A;  2KYV A;  3L36 A;  4C7N B;  2HOD C;  1WRG A;  1JTH B;  2WNP F;  3B5N A;  1H89 A;  3B5N C;  2WIT A;  3M0A A;  2OYH C;  3FIB A;  3M91 A;  1LT9 B;  1IO4 A;  4WY4 D;  3EFG A;  3VTP C;  1CI6 A;  3TYY A;  1GL2 D;  1MUU A;  1J1E C;  1NH4 A;  1RE4 B;  3P32 A;  4OH8 B;  1OWA A;  2BAS A;  2J61 B;  2JHH C;  3V4Q A;  2HPC B;  1HVV A;  3TNU A;  1NTZ K;  2YO3 A;  2XKM A;  4JYB A;  2C9L Y;  1L0L K;  3P8C E;  1SQP K;  2J64 A;  2FXM A;  3P7K A;  2Q9I A;  2Q9I C;  2I1K A;  3BVH A;  5AVW B;  3BVH C;  2KB7 P;  1L4A B;  2A45 H;  3M9H A;  5AW4 B;  1JY2 P;  3VMY A;  3NMD A;  1LTJ B;  1LWU B;  3MGN A;  3E1I B;  1N7S A;  4JF7 A;  1N7S C;  1HTL C;  1ZN5 A;  1GU4 A;  1IFI A;  1IFN A;  1IFD A;  3TSI A;  1FZG A;  1FJP A;  2Q7C A;  2XNX C;  1FZG C;  1N7L A;  1MV8 A;  3MTU E;  5AVT B;  1J1D C;  1G1J A;  1CI6 B;  3LID A;  1GDT A;  4EIJ A;  3U1A A;  2P2U A;  2FFD A;  2O01 H;  2J0G A;  5AW1 B;  3GHG A;  2NPS A;  3HE5 A;  2HLO C;  3MIW A;  1FZB B;  4GT1 A;  3LW5 H;  5CCH D;  5AVR B;  1CZQ A;  1L0N K;  2N9B A;  3OAK A;  4WY4 C;  1KIL A;  3EQ2 A;  1NTK K;  1GL2 A;  3L35 A;  3KDP B;  3A5T A;  3G3Z A;  1FDM A;  1GL2 C;  4I1L A;  1SQB K;  1JY3 P;  1YYC A;  4I2L C;  1NU1 K;  4N6J A;  3V5B A;  1N73 C;  3H32 B;  1FAV A;  3KYQ A;  1Z3U A;  5AW8 B;  1JC9 A;  1FZF C;  4HYT B;  1VDF A;  1JY2 N;  2YKP A;  1M1J A;  2P1J A;  1RF0 C;  4N78 E;  3RK3 D;  2FFD B;  5AW3 B;  1CSB A;  4AUW A;  5AVY B;  1L4A D;  1A02 J;  4XA4 A;  4GIF A;  1FZE B;  1N86 A;  1NO4 A;  3GHG B;  2NPS B;  1N86 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...