1FZCC

Crystal structure of fragment double-d from human fibrin with two different bound ligands
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment double-D from human fibrin with two different bound ligands.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRIN
total genus 92
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzcC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzcC02
2A45I 1W2EA 1FZAA 2J64A 4ZFGA 2J2PA 1JY2O 3H32A 1M1JB 2FFDA 1LT9C 1N73A 4M7HA 2J0YA 1RE4C 2J0HA 1RF1A 2FIBA 4NYTA 1LTJB 2H43A 1LT9A 1N73C 2Z4EC 2XNXB 3HUSB 2OYHA 1LWUA 1FZDA 2JHMF 2XNXA 1RE3A 2HPCC 2J5ZA 1FZGC 1JY3P 1RE3B 2WNPF 1JY3O 1LWUC 2Q9IC 1FZFC 2OYHB 1FZAB 2OYIC 1RF0C 3E1IB 2J1GA 4M7FA 2HLOC 2J60A 1RF1B 1T3UA 2Z4EA 1RE4B 2J0GA 3GHGB 3H32C 2FFDB 2J3UA 1FIBA 3GHGA 3E1IA 1FICA 1LTJA 1M1JC 1M1JA 2JHIF 2HLOA 1FZEC 2JHLF 1LT9B 4EPUA 1N86A 2JHHC 1FZCA 1FZCC 2H43B 3BVHB 2GY7A 3HUSC 1N86C 2HODC 2J61B 1FZBC 1FZEA 1FIDA 2HPCB 3HUSA 1FZGB 1JC9A 1RE3C 2HPCA 2J3FA 1JY2P 4R9JA 1LTJC 2J3GA 2Q9IB 1RF0A 1N73B 2Z4EB 2XNXC 2Q9IA 3GHGC 3E1IC 2HLOB 2J61A 4JYOX 1JY2N 4R9TA 2A45H 2A45G 2J3FD 1JY3N 1LWUB 1Z3UA 2HODA 2OYIA 1FZEB 2D39A 1Z3SA 2JHKF 1FZFB 3FIBA 2OYHC 1FZAC 2OYIB 1RF0B 1FZCB 1RE4A 2H43C 3BVHC 1FZBA 1FZGA 2J3OA 1N86B 2HODB 1RF1C 4JZCA 3BVHA 1FZBB 3H32B 1FZFA 2FFDC
chains in the Genus database with same CATH superfamily
3CWBE 2O3JA 1LT9C 5KAIE 4M7HA 2J0YA 3KQGA 5AW8B 4W80A 1LT9A 2V4HA 1RQVA 2XNXB 3B5NA 3H1JJ 3L70J 3S9OA 2C9NY 5CHXA 3SSUA 1PGPA 1Y47A 1YIJP 2O1KA 1IK7A 3V5BA 4EDFA 1LWUC 2JP3A 2BCCE 3M9QA 2Q9IC 2O1JA 4D6TJ 1OIPA 1R5SA 4W7YA 5KAIH 5KLVG 5GTHH 1BSHA 4MN4C 5KKZC 1X8YA 1FICA 2XKMA 5AW0B 2E75D 3W68A 2ITAA 1KYOH 1YITP 1OW7A 3D71A 1NVOA 1VQLP 1JNMA 2K9YA 2KOGA 3M06A 1K04A 2BEZF 2IBZI 4GODA 5AVSB 3L75E 1IO4A 2SPZA 4OH8B 2FXPA 1J1EB 2Q6QA 3QWOC 5KKZB 1AV1A 3VMAA 2JHKF 3FIBA 1NTKG 4AQRD 1P84H 3V2RA 3MHVA 2J3OA 3M9BA 2QEXP 1PL5A 1SQXD 2FXMA 1M1JB 2YKQA 2ZVOB 1U57A 2WPQA 1SQQK 5B66E 1YYCA 1OWAA 3L36A 2GUSA 2J59M 2Y9ZA 5B5EH 3TF5A 1OZHA 1LP1B 3BCCE 1OXZA 2WNPF 5AW3B 1MFTA 1KQGB 1H0TA 4H13B 1K05A 4N6JA 1CI6A 3D6YA 4H0LC 1ZR4A 2QJPB 2I8DA 2HR3A 3CMEP 1RE4B 1KYOE 4YPCA 3BVHA 3E1IA 3I56P 1M1KQ 2A06D 2HLOA 5AW9B 2FYUE 1FZCC 4C7RA 4I7ZB 3H1ID 5AW6B 3VMXA 1URQD 1FZGB 3KDPB 1YI2P 1OVVA 3RK2D 2HPCA 5KJ7C 2IYPA 1YJWP 1LTJC 1SQBK 1WRGA 3HE5B 4LGDE 4O9BA 3N4XA 2KLVA 3WU2E 1J1DB 1VQ7P 1Q7YQ 3TGUJ 3CX5E 3NXSA 5APSA 3Q5RA 1RF0B 1ZXGA 3N7NA 3KXDA 1N86B 2HODB 2WQYC 1G2CA 2E74D 3H1HG 2JO1A 1FZAA 1QL2A 2D2CD 3L72E 1YBKA 3L75G 5KTBA 3BCCG 4OGQB 1VQ6P 3Q5PA 4DOJA 1UIIA 1BE3J 5APYA 4U3FG 2NPSD 2Z4EC 5APUA 4ZKUA 4WY4D 2Z5IA 3G3ZA 2Y0EA 3MGNA 2C0XA 4DZOA 3RK2C 2LKMA 1FZFC 1AFOA 5APWA 4D6TD 2QG4A 3RL0C 2HLOC 3H32C 2WPSA 3L35A 1Q86Q 1N7SC 3FGAD 1TU3F 2M5AA 1FZCA 2ZFCA 1GZLA 4IL6X 3TGUG 2Y0CA 2W90A 3UIAA 4GOFA 1T3JA 2J3FA 3FXDA 3AE1C 3L72G 1L0NK 5AVWB 2NRGA 2W8ZA 1EDKA 1ZRTD 4GDOA 3VP8A 3GG2A 2M3EA 1IK9A 3Q3DA 1FDMA 3Q2YA 2ZAEB 3CCQP 3EWKA 3GLMA 3L71D 2R32A 1VL2A 3HD7C 3FX0A 1FZAC 1NU1D 1FZGA 2B9BA 2JKVA 1USEA 3P7KA 1T8ZA 1HUCA 4IFFA 1N7SD 3SWYA 1FZFA 2GM4A 2WVRA 3V6IA 3AE3C 3CX5D 2J0HA 1L0LG 4JYCA 5DJUB 4H44B 2AEFA 4KHXA 1KN7A 4LC1A 2P58A 1A02F 2JDIH 1NKZB 3CWBG 1QVGO 1JY3O 2B87A 3HE4A 5KJ7A 3VN0A 2RH0A 1T2KC 1NTZG 2C9LY 3CCRP 1JMBA 2J60A 4EYYQ 3L75D 1PGJA 1W2BO 2FFDB 2WMMA 2P1JA 3L74D 1LTJA 2JHLF 3AE7C 4Y99C 4LLHA 3CI9A 1OVUA 4YXDC 3A2AA 1EZVG 1E79H 2XNDH 4I1LA 1YJ9P 3JC22 3LW5H 2J3GA 1HJ0A 1PP9J 4OWFA 2FYNC 1NGMB 2Q9IA 4QMAA 4TLFA 2FYUD 2P10A 2W6BA 1NTKD 1OMIA 3CWBJ 1JY3N 4ASWA 5AVZB 2OYIA 1OVRA 1FE6A 5GTIE 1KILE 2E75C 3R2PA 1VQ9P 3A3YB 1S3JA 5AVVB 3CX5H 3W67A 3ABVC 3EFFK 2XV5A 3H32A 3A0HE 4N3YB 3LIDA 2OARA 4PD4H 1SQPJ 3JCUH 1IC2A 2KYVA 2N1TB 1ZMEC 1T6AA 1R5LA 3AEEC 4RJTA 1EZVE 1JCCA 1HWTC 3CCSP 1IJDB 3G71P 1G1IA 3RGUA 4JF7A 1L0NE 2PAJA 2M8RA 4ZNCA 3PTZA 2D2CC 2JHIF 1LT9B 1JTHA 1N2DC 2E42A 3CCUP 2N1TA 2WSSH 2HODC 2K9JA 2FYUJ 2C0WA 1VQ5P 4RESB 5AW5B 4GIFA 2KUBA 4HJGH 1LTAC 1KC8Q 5AW4B 2M3BA 1KILA 4H0LD 1CW5A 4PV1B 2A45G 3MIWA 1VQNP 2J3FD 3AE4C 1FOSE 1OW8A 4OVNF 3R4YA 2K9JB 2ZXXA 1X0TA 3BVHC 3S4RA 1SQPD 2QJYB 1RE4C 1KB9H 4EI2A 1VQMP 1QEXA 3L75J 2J2PA 1HF9A 1NTMK 2GUVA 4WY4B 1FS0E 2J5UA 2J5ZA 3F5HA 4HB1A 1ZP0C 4GKGA 1MZ9A 5AVQB 3L73J 4C46A 3OAKA 2QJKB 2IBZD 3HRNA 2WPVB 2G3AA 1VQ8P 2J1GA 5DJTB 1FJPA 1IFJA 2MJZA 2QJYC 1J1DC 2BCCG 5GTHE 4BWNA 3GHGA 2BCCJ 1RHZB 3I5CA 4RKUJ 2CK3H 1DEEG 3MP7B 1S5LH 2KXPB 1NHLA 1K73Q 3CMAP 1PPJE 5GTIH 2YO2A 3PH0A 3D70A 2JWAA 1BE3D 3H1HD 1EZVD 1XTCC 1JY2P 1USDA 4KJMA 2Q9IB 1GDTA 1RF0A 3PJSK 4H44C 3T97A 1NTMJ 1BE3E 3B5NC 3L71G 1FOSF 1IFNA 4BRYB 1XTGB 1QVFO 1N7SA 2D39A 5L8RJ 5E79E 2L91A 2H43C 3AEAC 5APXA 1M7LA 1Z56A 4Z1MH 2WT7B 3H32B 2W83C 2IYOA 1YTZT 2E5TA 3HD7A 2FFDA 3A5TA 1KB9D 1RF1A 1BGYJ 2IBZE 3GMAA 3EFGA 1N73C 1DH3A 3KZIH 5CCHA 3G4SP 4UB6H 2B87B 2HPCC 2L5GB 2CPBA 3ITKA 1L0LE 3VOPA 1N7LA 2A06E 1KYOI 1KYOD 3P8CD 1ZR2A 5K5GB 2P7JA 2VRSA 1JB0J 2N9YB 3AE6C 1NU1K 1URQB 1X79B 1SQXE 4XE5B 2FXOA 4Y28J 3OA7A 4WB4A 4NPEA 4WY4C 4IOIH 1JOCA 1EC5A 4U3FD 1NTMD 1YQ3C 1BCCD 1L4AC 1FZEA 2HPCB 3VMZA 3CD6P 1GK4A 2H88C 3P8CE 1FU1A 4R9JA 2YNYA 1NTMG 4L73A 2P67A 1RQUA 3TGUE 1PP9G 2HLOB 3H1KJ 5APTA 2E74B 5B5EE 3S1KA 1KB9E 1IFIA 4IL6E 3JSVC 1Q2NA 1H89A 1FZCB 1G2CB 4U3FJ 1VF5D 1RF1C 3HE5A 4ZFGA 2Q7CA 3U1CA 5CCHC 2BASA 1IFPA 1KILB 5KLVD 3I55P 2O01N 1LTBC 4UB6E 3Q5SA 3H1LD 1IFDA 3RK3D 2Q3IA 1H8AA 2KNCA 1R8EA 3RK3B 1FZAB 4GOEA 3RK3E 3USSA 2W6JH 3WUTA 3E1IB 3SFDC 4W7ZA 2LXBA 1BSNA 2WSEJ 3KHUA 3GW6A 1DX7A 2YKPA 2W6AA 3WU2H 4HKZH 3L73D 3P32A 4BXLA 2XNXC 3HTKB 1RY3A 1MUUA 2J61A 3AE8C 1FBMA 3C9IA 3TNUA 3F89A 1N7SB 1S9KD 3HD7D 1EDJA 4L76A 1LGHB 4WVZA 2KI7B 1Z3SA 1KQFB 3H1IJ 5BU5A 1JTHB 1FZBA 2ZYAA 4JZCA 4CPGA 3FWNA 2QSIA 2YXRB 3B8EB 4HYTB 4WBAA 1Q81Q 5TISH 2OQQA 1JY2O 1HJBA 1LJ2A 1BGYD 5CMZA 1NAYA 1EDLA 3AEBC 3TK1A 1NTZE 5M1BA 1L0NJ 3AEFC 2KB7P 1S72P 3TYYA 3H1KG 2IPPA 4C7NA 2E76B 3G6EP 2NPSA 1SQBJ 5CCGC 2Z4EA 3IF4A 5B66H 3MZWB 2DW3A 1J1EC 2KNCB 4D6TE 5TISE 3H1KD 1M1JA 1P84E 2JR8A 3OW2O 2H43B 2OGUA 1BCCJ 3PP5A 5APQA 3WMM0 1N86C 3M0DA 2CPSA 2E5YA 2RN0A 4TT3H 2OTJP 2R5DA 3CLQA 1GD2E 4IL6H 1FDIA 2XU6A 1KILD 2J58A 2I1JA 1H0TB 3E1IC 1EZVI 4R9TA 2A45H 1NU1E 2IFMA 1FZEB 1PP9E 1FZFB 1LNQA 2YKOA 3G9RA 3A0BE 3L73G 3H1IG 3M0AA 1G1JA 1URQC 2KSEA 4L74A 3O8ZA 5CJ0A 2HYNA 1SQVE 3L74J 1HVVA 4K3AA 3TNUB 3L37A 2FYNB 2YIUB 1LWUA 3C1LA 1L4AB 3CC4P 1KB9I 1NKNA 4K35A 1FZGC 1SQXG 4AUWA 4EOTA 1YJNP 1QX8A 2QM7A 1GL2A 2E43A 1URQA 3A0HH 4BRYA 1FDOA 3KZIE 4AYCA 1L0LJ 4M7FA 3B5NB 3L74G 3M0DC 3L72D 3SFEC 4H44D 2QM8A 1VF5C 4PJ0H 1BDCA 1LTIC 1M1JC 2K37A 4DJGA 1GL2B 2WZ7A 3HD7B 3AEDC 3SWKA 1NYHA 2PFXA 1X9VA 2H7HA 1FZBC 5TJHA 2ZT9B 1L4AA 2WSFJ 2A06G 3M91A 4N78D 3CCLP 2OTLP 1PP9D 3MUDA 1PV3A 4H13C 3Q1MA 2E76C 1VQKP 1Y9BA 4H0LB 3RL0D 1L0LD 2KZJA 1JY2N 2R44A 2JJLA 1PGQA 1KFNA 3U59A 2BEQD 1Z3UA 4U3FE 2PGDA 2UWJE 3WUVA 4M3LA 1RE4A 1NOHA 1SFCC 1VQ4P 1MFZA 3GHGC 2A45I 3QH9A 1SQBG 2M5AB 4JBZA 1SQVG 1KTMA 2PP6A 3CXHD 2GA1A 3H1JD 3L70D 3BCCD 2Y9YA 1L0NG 2R3CA 1VPCA 1YQ4C 5KAFE 2OYHB 1SQVD 1X22A 3O6QB 2KSJA 2POHA 1T3UA 1NJIQ 1NAFA 2I1KA 4OGQC 3U1AA 2AXTH 3H1HJ 2FYUG 1ZLLA 3FXEA 2NZ2A 3V2QA 3HUSC 2FYZA 2KZIA 3VTPC 1AA0A 5KJ7D 1S5LX 5KLIB 3MTUE 1NTZK 2R3SA 2YXQB 4DCKA 1RE3C 2K88A 3B5ND 2QIWA 1VQOP 1K9MQ 3CCVP 5AVRB 3CL3D 1VF5B 1L4AD 3NMDA 1LWUB 4WWIA 3L4FA 1S5LE 5H2FH 1FAVA 2ZT9D 1L2PA 4JQ0D 1SVFA 1JO5A 1BGYG 4IFDK 2J64A 1AQ5A 1JMMA 2JWDA 5EFWB 1SQPE 1SQXJ 1M57D 2HFED 2FIBA 1S2EA 3V2PA 1HH0A 1NTKK 3P8MC 3C8VA 2XNXA 4PV1D 3CCEP 1JUNA 1LP1A 2V7QJ 3MUDC 3H6PA 1JCDA 3A7OA 3L71J 2PRRA 1P84D 3B4SA 1P84I 1DD3A 1RF0C 2Z5HA 4PD4D 3AEGC 4PD4I 3D6ZA 2AXCA 2AXTE 1RF1B 2ZVNB 1NTME 3CWBD 2HG5D 1ZW0A 4EPUA 3VYIA 1AQTA 2E75B 2J61B 1SQQJ 2ZYGA 5CBNA 1SS1A 1KD1Q 2Q5UA 1QL1A 2WWWA 4U7JA 1ZV8A 4JPZB 2Y0DA 3IN6A 3CXHI 1BCCG 2W27A 1SQXK 4A7PA 5AVXB 3OJAB 1ZRTE 1RH5B 1SQVK 5APVA 5AW2B 1DIPA 5AVTB 1OW6A 2HODA 5KLVJ 1T2KD 2QJKC 1NTZD 4NPFX 4B86A 1W5CE 2G8YA 2V7QH 5KLIC 1W2EA 3L74E 5CCGD 2D2CB 2MKVA 1MV8A 4NYTA 4L75A 4I7ZC 2JHMF 1EXJA 1A02J 2KS1A 4R4LA 3LIEA 2WSCH 3H1LG 3JCUE 1GMJA 3H1JG 3L70G 3RBZA 3H25A 1L0LK 2AEMA 1NWQA 2N1TD 1HGVA 2FKWB 3V4WA 3HE4B 1SQQD 2IX7C 2K3RA 4PV1C 1SFCD 1S1CX 1PGOA 1FIBA 1AVOA 1KV4A 1SFCA 2IZ1A 4XFJA 1QLED 1GTWA 5KLVK 2NPSC 1PPJD 2FBWC 3M9HA 3H1LE 2N1TC 2OYOA 2IFNA 1LTSC 1M8OB 1VQPP 1DEBA 4YXWH 3AE2C 4NPDA 3PRJA 2YMYA 1KZUB 1N73B 2Z4EB 1IZNB 2XZRA 5AW1B 4H13D 4KT0J 2QE7H 3FWLA 2FY8A 1KQSO 3IR9A 1QGKB 4I2LC 3ZDMA 2OYHC 1AVYA 2QA4P 2WPRA 1EDIA 4I6MC 1S4XA 1ZOYC 5KAFH 3AE5C 1GK6A 2H43A 1NH4A 3HUSB 2IBZG 2XDJA 2OYHA 1ZN5A 3O6QA 1SQQE 2IZ0A 3II6A 5BU8B 1LTGC 3IAOA 1E5WA 1RE3B 2K1AA 1WMKA 2J0GA 3PHLA 3V4QA 3H1KE 2E74C 4HH2A 2E76D 3L71E 1SQPK 1AJYA 3MD0A 1N86A 5E79H 2O01H 3TSIA 4OGQD 2Q1KA 1PZQA 1K8AQ 2YIUC 1NTZJ 1FC2C 1FIDA 4GT1A 3HUSA 2QVAA 2P2UA 3VP9A 1U7JA 1KILC 1OX3A 4WY4A 1EQ7A 3TDKA 1EXIA 1M90Q 2QJPC 1GU4A 1WT6A 1Q82Q 3KPEA 3LW5J 3BASA 4R4MA 3BATA 3CC2P 3L73E 2B88A 4PJ0E 1IFMA 1U7MA 3KYQA 2WITA 2N9BA 2ZT9C 2FFDC 1KQLA 2KIKA 3CPWO 4JYBA 1N73A 3V2NA 3SWFA 1GW3A 1HBWA 3H1HE 3T97B 1NTKJ 4UB8E 3CX5I 3L72J 2KLUA 2KP8A 3H1IE 1JY3P 2R5BA 5AW7B 3TGUD 1UIXA 1VDFA 1SQPG 3CXHH 3CC7P 4YTPC 5CJ4A 1PIXA 4DT0A 3GHGB 2J3UA 1SQBD 1OFCX 3BRTB 5H2FE 5C39A 3CCMP 2OTKE 2QRXA 1NU1G 1BDDA 4EIJA 2GY7A 1SP4A 5BVZA 2WT7A 1NO4A 1FJKA 1GL2D 4ZMDA 3RL0g 1PPJG 4RO0A 3HTKA 4N78E 1Y8AA 1LT1A 4ZKPA 2IDBA 1JM0A 3PLNA 1SQVJ 2KK7A 3RL0B 1N8RQ 4D6TG 1KMIZ 1HGZA 4JYOX 5CCGA 3NFQA 2WSCJ 1Q90D 1GL2C 2RKLA 3AE9C 3GF3A 3RK3C 3B71A 1MKMA 5CBOA 2OYIB 1DD4A 2AEJA 1GW4A 4IFMA 2WTYA 1FZBB 1BE3G 1KFMA 2B89A 2ZXEB 3BCCJ 1BGYE 1KORA 3CCJP 3BRVB 1NTKE 3A0BH 3CXHE 3H1JE 3L70E 2FYUK 1LTJB 5AVYB 1M56D 5AVUB 2NPSB 1FZDA 1RE3A 1YHQP 1CSBA 2ZJSE 2M0BA 4ASVA 3RBXA 2RMZA 4PD4E 3E7KA 2LR2A 1CZQA 3K5BA 1SQQG 2H8PD 3VMYA 5CCHD 2OYIC 1YTZI 2YMKA 1S9KE 1SFCB 2O01J 2ZYDA 1L0ND 2LXCB 3IFMA 2YO3A 1FZEC 2H89C 1H88A 2BCCD 3WUUA 2JHHC 3BVHB 1HTLC 1JEKA 1BCCE 3NTNA 1J2JB 1JC9A 2Q3EA 2KS1B 3RK2B 3GF7A 2WSEH 5KLVE 3AECC 1NU1J 1LTTC 1SQBE 3EQ2A 3E1RA 2JEEA 4UB8H 4XA4A 2WSFH 1D7MA 4C7NB 1GU5A 4Y99B 1SLQA 1PFIA 1CI6B 3H1LJ
chains in the Genus database with same CATH topology
1W2EA 4HYTB 4WBAA 2XV5A 1JY2O 3H32A 1HJBA 5CCGD 1LT9C 4M7HA 2J0YA 5CMZA 1MV8A 3KQGA 4N3YB 4NYTA 5AW8B 4W80A 3LIDA 1LT9A 2XNXB 2OARA 3B5NA 3TK1A 2JHMF 1IC2A 2KYVA 2C9NY 5CHXA 2N1TB 1A02J 2O1KA 3LIEA 2WSCH 3V5BA 2KB7P 1LWUC 3TYYA 1JCCA 3M9QA 1HWTC 1L0LK 2Q9IC 1NWQA 2IPPA 2O1JA 4C7NA 2N1TD 1HGVA 1IJDB 2FKWB 1G1IA 4W7YA 3V4WA 2NPSA 3HE4B 4JF7A 5CCGC 2Z4EA 2PAJA 2IX7C 2M8RA 1SFCD 1FIBA 1J1EC 1X8YA 1FICA 2XKMA 5AW0B 1M1JA 1SFCA 2JHIF 1LT9B 1JTHA 1N2DC 2E42A 2H43B 1GTWA 2N1TA 3PP5A 5APQA 3WMM0 1N86C 3M0DA 2CPSA 5KLVK 2HODC 2NPSC 3M9HA 2N1TC 2R5DA 3CLQA 1GD2E 2IFNA 1LTSC 2C0WA 1DEBA 4RESB 5AW5B 4GIFA 1JNMA 2KOGA 2YMYA 3M06A 1KZUB 1KILD 2XU6A 5AVSB 1LTAC 2J58A 1N73B 2Z4EB 2XZRA 2I1JA 5AW1B 5AW4B 2M3BA 3E1IC 1KILA 1IO4A 4R9TA 1CW5A 4OH8B 2A45H 2A45G 3MIWA 2J3FD 1J1EB 3IR9A 2IFMA 1FOSE 1FZEB 4I2LC 2JHKF 1FZFB 3FIBA 2OYHC 4AQRD 2YKOA 3V2RA 3BVHC 2WPRA 2J3OA 3M9BA 1RE4C 3M0AA 1G1JA 4I6MC 1URQC 2J2PA 2FXMA 1M1JB 2YKQA 1NTMK 3O8ZA 5CJ0A 2WPQA 1SQQK 1GK6A 1YYCA 2GUVA 2HYNA 1OWAA 3L36A 1HVVA 4WY4B 3TNUB 2GUSA 2H43A 2J59M 3L37A 1NH4A 3HUSB 2XDJA 2OYHA 1ZN5A 1LWUA 3II6A 1L4AB 1NKNA 5BU8B 2J5ZA 1FZGC 1LTGC 1E5WA 4AUWA 4EOTA 1OXZA 1RE3B 2WNPF 4GKGA 5AW3B 1MZ9A 2QM7A 1GL2A 2E43A 1URQA 5AVQB 4C46A 3OAKA 3HRNA 4N6JA 1CI6A 1ZR4A 4AYCA 2J1GA 1FJPA 4M7FA 3B5NB 1IFJA 3M0DC 2MJZA 1J1DC 2J0GA 1RE4B 2QM8A 3V4QA 1LTIC 3GHGA 3E1IA 4HH2A 1M1JC 2HLOA 1GL2B 5AW9B 2WZ7A 1SQPK 3HD7B 3I5CA 3MD0A 1N86A 2O01H 3TSIA 1FZCC 4C7RA 1X9VA 5AW6B 2H7HA 1NHLA 3VMXA 1FIDA 1FZBC 4GT1A 1URQD 3HUSA 1FZGB 2P2UA 2YO2A 3KDPB 1L4AA 3RK2D 3M91A 2HPCA 5KJ7C 4N78D 3VP9A 1KILC 1XTCC 1JY2P 3MUDA 4WY4A 1EQ7A 1LTJC 1SQBK 1WRGA 2Q9IB 1GDTA 1RF0A 3HE5B 3T97A 4LGDE 3B5NC 4O9BA 1GU4A 3N4XA 3RL0D 2KLVA 1WT6A 3KPEA 1JY2N 1J1DB 1FOSF 3BASA 2JJLA 1IFNA 1KFNA 3U59A 1XTGB 1Z3UA 1N7SA 2D39A 3BATA 3NXSA 5APSA 1RF0B 4M3LA 2H43C 1RE4A 1IFMA 3N7NA 3KYQA 2WITA 1N86B 1NOHA 2N9BA 1M7LA 1SFCC 2HODB 1Z56A 5APXA 2WT7B 1MFZA 3H32B 3GHGC 1G2CA 2FFDC 2A45I 1FZAA 1QL2A 1YTZT 3HD7A 1KQLA 5KTBA 2FFDA 4JYBA 1N73A 3A5TA 3V2NA 4DOJA 3SWFA 1RF1A 1GW3A 1HBWA 5APYA 3EFGA 2NPSD 1N73C 1DH3A 2Z4EC 5APUA 5CCHA 4ZKUA 4WY4D 2Z5IA 3G3ZA 2HPCC 2L5GB 2PP6A 2CPBA 2KP8A 1JY3P 2R5BA 5AW7B 3MGNA 2C0XA 2R3CA 3VOPA 1VPCA 4DZOA 1N7LA 3RK2C 2LKMA 1VDFA 1FZFC 2OYHB 1AFOA 5APWA 3RL0C 5CJ4A 2HLOC 2KSJA 2POHA 3P8CD 1ZR2A 1T3UA 2P7JA 2VRSA 3GHGB 3H32C 2WPSA 3L35A 2J3UA 1N7SC 1PFIA 1NU1K 1URQB 1X79B 1NAFA 2I1KA 4XE5B 3BRTB 3U1AA 3OA7A 4WB4A 4WY4C 1JOCA 1ZLLA 4EIJA 1FZCA 3V2QA 2ZFCA 2GY7A 3HUSC 1SP4A 2FYZA 5BVZA 3VTPC 2WT7A 1L4AC 1FZEA 1GZLA 1NO4A 5KJ7D 1FJKA 2HPCB 3MTUE 3VMZA 1GL2D 1NTZK 1GK4A 3UIAA 1RE3C 1T3JA 2J3FA 3P8CE 3HTKA 1FU1A 4N78E 4R9JA 1L0NK 4ZKPA 2YNYA 3B5ND 5AVWB 2P67A 3RL0B 2HLOB 1HGZA 4JYOX 3VP8A 5AVRB 3CL3D 1IK9A 5APTA 5CCGA 1FDMA 3NFQA 1L4AD 3NMDA 1LWUB 1IFIA 2R32A 1GL2C 3L4FA 3HD7C 3RK3C 1FZAC 1H89A 2OYIB 1FZCB 1FAVA 1G2CB 1GW4A 1FZGA 4IFMA 1SVFA 1RF1C 3P7KA 2WTYA 1JO5A 1FZBB 1T8ZA 1HUCA 1KFMA 1N7SD 4IFFA 3SWYA 1FZFA 2GM4A 4IFDK 2J64A 3HE5A 2ZXEB 1AQ5A 4ZFGA 3BRVB 2Q7CA 1JMMA 3U1CA 5CCHC 2BASA 1KILB 2J0HA 2FYUK 2HFED 2FIBA 1LTJB 5AVYB 3V2PA 1HH0A 1LTBC 1NTKK 3P8MC 4JYCA 5AVUB 4KHXA 2NPSB 4LC1A 1FZDA 2XNXA 1RE3A 1A02F 1CSBA 1IFDA 1JUNA 3RK3D 1NKZB 3H6PA 2Q3IA 1JCDA 1JY3O 1H8AA 3A7OA 3HE4A 5KJ7A 1CZQA 3RK3B 3VN0A 2H8PD 1FZAB 3VMYA 5CCHD 2OYIC 1YTZI 1T2KC 1RF0C 2Z5HA 2C9LY 3E1IB 1S9KE 2J60A 1SFCB 1RF1B 2FFDB 2HG5D 3IFMA 2YO3A 4W7ZA 2P1JA 1LTJA 2JHLF 1FZEC 4EPUA 1H88A 3VYIA 4Y99C 2JHHC 3BVHB 4LLHA 3CI9A 1DX7A 1HTLC 2J61B 2YKPA 2W6AA 3A2AA 3NTNA 1J2JB 1JC9A 2Q5UA 3P32A 4I1LA 1QL1A 2WWWA 1ZV8A 3RK2B 3LW5H 2J3GA 2WSEH 2XNXC 2W27A 1SQXK 5AVXB 1LTTC 3EQ2A 3HTKB 2Q9IA 1RY3A 1MUUA 2J61A 3OJAB 2JEEA 1SQVK 1FBMA 2W6BA 5APVA 5AW2B 3C9IA 3TNUA 1N7SB 5AVTB 1S9KD 3HD7D 1JY3N 4XA4A 5AVZB 1LGHB 2HODA 2OYIA 2WSFH 1Z3SA 1T2KD 5BU5A 4C7NB 1GU5A 4Y99B 4B86A 3R2PA 1JTHB 1FZBA 3A3YB 1SLQA 5AVVB 4JZCA 3BVHA 1CI6B 3B8EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 I;  1W2E A;  1FZA A;  2J64 A;  4ZFG A;  2J2P A;  1JY2 O;  3H32 A;  1M1J B;  2FFD A;  1LT9 C;  1N73 A;  4M7H A;  2J0Y A;  1RE4 C;  2J0H A;  1RF1 A;  2FIB A;  4NYT A;  1LTJ B;  2H43 A;  1LT9 A;  1N73 C;  2Z4E C;  2XNX B;  3HUS B;  2OYH A;  1LWU A;  1FZD A;  2JHM F;  2XNX A;  1RE3 A;  2HPC C;  2J5Z A;  1FZG C;  1JY3 P;  1RE3 B;  2WNP F;  1JY3 O;  1LWU C;  2Q9I C;  1FZF C;  2OYH B;  1FZA B;  2OYI C;  1RF0 C;  3E1I B;  2J1G A;  4M7F A;  2HLO C;  2J60 A;  1RF1 B;  1T3U A;  2Z4E A;  1RE4 B;  2J0G A;  3GHG B;  3H32 C;  2FFD B;  2J3U A;  1FIB A;  3GHG A;  3E1I A;  1FIC A;  1LTJ A;  1M1J C;  1M1J A;  2JHI F;  2HLO A;  1FZE C;  2JHL F;  1LT9 B;  4EPU A;  1N86 A;  2JHH C;  1FZC A;  1FZC C;  2H43 B;  3BVH B;  2GY7 A;  3HUS C;  1N86 C;  2HOD C;  2J61 B;  1FZB C;  1FZE A;  1FID A;  2HPC B;  3HUS A;  1FZG B;  1JC9 A;  1RE3 C;  2HPC A;  2J3F A;  1JY2 P;  4R9J A;  1LTJ C;  2J3G A;  2Q9I B;  1RF0 A;  1N73 B;  2Z4E B;  2XNX C;  2Q9I A;  3GHG C;  3E1I C;  2HLO B;  2J61 A;  4JYO X;  1JY2 N;  4R9T A;  2A45 H;  2A45 G;  2J3F D;  1JY3 N;  1LWU B;  1Z3U A;  2HOD A;  2OYI A;  1FZE B;  2D39 A;  1Z3S A;  2JHK F;  1FZF B;  3FIB A;  2OYH C;  1FZA C;  2OYI B;  1RF0 B;  1FZC B;  1RE4 A;  2H43 C;  3BVH C;  1FZB A;  1FZG A;  2J3O A;  1N86 B;  2HOD B;  1RF1 C;  4JZC A;  3BVH A;  1FZB B;  3H32 B;  1FZF A;  2FFD C; 
#chains in the Genus database with same CATH topology
 3CWB E;  2O3J A;  1LT9 C;  5KAI E;  4M7H A;  2J0Y A;  3KQG A;  5AW8 B;  4W80 A;  1LT9 A;  2V4H A;  1RQV A;  2XNX B;  3B5N A;  3H1J J;  3L70 J;  3S9O A;  2C9N Y;  5CHX A;  3SSU A;  1PGP A;  1Y47 A;  1YIJ P;  2O1K A;  1IK7 A;  3V5B A;  4EDF A;  1LWU C;  2JP3 A;  2BCC E;  3M9Q A;  2Q9I C;  2O1J A;  4D6T J;  1OIP A;  1R5S A;  4W7Y A;  5KAI H;  5KLV G;  5GTH H;  1BSH A;  4MN4 C;  5KKZ C;  1X8Y A;  1FIC A;  2XKM A;  5AW0 B;  2E75 D;  3W68 A;  2ITA A;  1KYO H;  1YIT P;  1OW7 A;  3D71 A;  1NVO A;  1VQL P;  1JNM A;  2K9Y A;  2KOG A;  3M06 A;  1K04 A;  2BEZ F;  2IBZ I;  4GOD A;  5AVS B;  3L75 E;  1IO4 A;  2SPZ A;  4OH8 B;  2FXP A;  1J1E B;  2Q6Q A;  3QWO C;  5KKZ B;  1AV1 A;  3VMA A;  2JHK F;  3FIB A;  1NTK G;  4AQR D;  1P84 H;  3V2R A;  3MHV A;  2J3O A;  3M9B A;  2QEX P;  1PL5 A;  1SQX D;  2FXM A;  1M1J B;  2YKQ A;  2ZVO B;  1U57 A;  2WPQ A;  1SQQ K;  5B66 E;  1YYC A;  1OWA A;  3L36 A;  2GUS A;  2J59 M;  2Y9Z A;  5B5E H;  3TF5 A;  1OZH A;  1LP1 B;  3BCC E;  1OXZ A;  2WNP F;  5AW3 B;  1MFT A;  1KQG B;  1H0T A;  4H13 B;  1K05 A;  4N6J A;  1CI6 A;  3D6Y A;  4H0L C;  1ZR4 A;  2QJP B;  2I8D A;  2HR3 A;  3CME P;  1RE4 B;  1KYO E;  4YPC A;  3BVH A;  3E1I A;  3I56 P;  1M1K Q;  2A06 D;  2HLO A;  5AW9 B;  2FYU E;  1FZC C;  4C7R A;  4I7Z B;  3H1I D;  5AW6 B;  3VMX A;  1URQ D;  1FZG B;  3KDP B;  1YI2 P;  1OVV A;  3RK2 D;  2HPC A;  5KJ7 C;  2IYP A;  1YJW P;  1LTJ C;  1SQB K;  1WRG A;  3HE5 B;  4LGD E;  4O9B A;  3N4X A;  2KLV A;  3WU2 E;  1J1D B;  1VQ7 P;  1Q7Y Q;  3TGU J;  3CX5 E;  3NXS A;  5APS A;  3Q5R A;  1RF0 B;  1ZXG A;  3N7N A;  3KXD A;  1N86 B;  2HOD B;  2WQY C;  1G2C A;  2E74 D;  3H1H G;  2JO1 A;  1FZA A;  1QL2 A;  2D2C D;  3L72 E;  1YBK A;  3L75 G;  5KTB A;  3BCC G;  4OGQ B;  1VQ6 P;  3Q5P A;  4DOJ A;  1UII A;  1BE3 J;  5APY A;  4U3F G;  2NPS D;  2Z4E C;  5APU A;  4ZKU A;  4WY4 D;  2Z5I A;  3G3Z A;  2Y0E A;  3MGN A;  2C0X A;  4DZO A;  3RK2 C;  2LKM A;  1FZF C;  1AFO A;  5APW A;  4D6T D;  2QG4 A;  3RL0 C;  2HLO C;  3H32 C;  2WPS A;  3L35 A;  1Q86 Q;  1N7S C;  3FGA D;  1TU3 F;  2M5A A;  1FZC A;  2ZFC A;  1GZL A;  4IL6 X;  3TGU G;  2Y0C A;  2W90 A;  3UIA A;  4GOF A;  1T3J A;  2J3F A;  3FXD A;  3AE1 C;  3L72 G;  1L0N K;  5AVW B;  2NRG A;  2W8Z A;  1EDK A;  1ZRT D;  4GDO A;  3VP8 A;  3GG2 A;  2M3E A;  1IK9 A;  3Q3D A;  1FDM A;  3Q2Y A;  2ZAE B;  3CCQ P;  3EWK A;  3GLM A;  3L71 D;  2R32 A;  1VL2 A;  3HD7 C;  3FX0 A;  1FZA C;  1NU1 D;  1FZG A;  2B9B A;  2JKV A;  1USE A;  3P7K A;  1T8Z A;  1HUC A;  4IFF A;  1N7S D;  3SWY A;  1FZF A;  2GM4 A;  2WVR A;  3V6I A;  3AE3 C;  3CX5 D;  2J0H A;  1L0L G;  4JYC A;  5DJU B;  4H44 B;  2AEF A;  4KHX A;  1KN7 A;  4LC1 A;  2P58 A;  1A02 F;  2JDI H;  1NKZ B;  3CWB G;  1QVG O;  1JY3 O;  2B87 A;  3HE4 A;  5KJ7 A;  3VN0 A;  2RH0 A;  1T2K C;  1NTZ G;  2C9L Y;  3CCR P;  1JMB A;  2J60 A;  4EYY Q;  3L75 D;  1PGJ A;  1W2B O;  2FFD B;  2WMM A;  2P1J A;  3L74 D;  1LTJ A;  2JHL F;  3AE7 C;  4Y99 C;  4LLH A;  3CI9 A;  1OVU A;  4YXD C;  3A2A A;  1EZV G;  1E79 H;  2XND H;  4I1L A;  1YJ9 P;  3JC2 2;  3LW5 H;  2J3G A;  1HJ0 A;  1PP9 J;  4OWF A;  2FYN C;  1NGM B;  2Q9I A;  4QMA A;  4TLF A;  2FYU D;  2P10 A;  2W6B A;  1NTK D;  1OMI A;  3CWB J;  1JY3 N;  4ASW A;  5AVZ B;  2OYI A;  1OVR A;  1FE6 A;  5GTI E;  1KIL E;  2E75 C;  3R2P A;  1VQ9 P;  3A3Y B;  1S3J A;  5AVV B;  3CX5 H;  3W67 A;  3ABV C;  3EFF K;  2XV5 A;  3H32 A;  3A0H E;  4N3Y B;  3LID A;  2OAR A;  4PD4 H;  1SQP J;  3JCU H;  1IC2 A;  2KYV A;  2N1T B;  1ZME C;  1T6A A;  1R5L A;  3AEE C;  4RJT A;  1EZV E;  1JCC A;  1HWT C;  3CCS P;  1IJD B;  3G71 P;  1G1I A;  3RGU A;  4JF7 A;  1L0N E;  2PAJ A;  2M8R A;  4ZNC A;  3PTZ A;  2D2C C;  2JHI F;  1LT9 B;  1JTH A;  1N2D C;  2E42 A;  3CCU P;  2N1T A;  2WSS H;  2HOD C;  2K9J A;  2FYU J;  2C0W A;  1VQ5 P;  4RES B;  5AW5 B;  4GIF A;  2KUB A;  4HJG H;  1LTA C;  1KC8 Q;  5AW4 B;  2M3B A;  1KIL A;  4H0L D;  1CW5 A;  4PV1 B;  2A45 G;  3MIW A;  1VQN P;  2J3F D;  3AE4 C;  1FOS E;  1OW8 A;  4OVN F;  3R4Y A;  2K9J B;  2ZXX A;  1X0T A;  3BVH C;  3S4R A;  1SQP D;  2QJY B;  1RE4 C;  1KB9 H;  4EI2 A;  1VQM P;  1QEX A;  3L75 J;  2J2P A;  1HF9 A;  1NTM K;  2GUV A;  4WY4 B;  1FS0 E;  2J5U A;  2J5Z A;  3F5H A;  4HB1 A;  1ZP0 C;  4GKG A;  1MZ9 A;  5AVQ B;  3L73 J;  4C46 A;  3OAK A;  2QJK B;  2IBZ D;  3HRN A;  2WPV B;  2G3A A;  1VQ8 P;  2J1G A;  5DJT B;  1FJP A;  1IFJ A;  2MJZ A;  2QJY C;  1J1D C;  2BCC G;  5GTH E;  4BWN A;  3GHG A;  2BCC J;  1RHZ B;  3I5C A;  4RKU J;  2CK3 H;  1DEE G;  3MP7 B;  1S5L H;  2KXP B;  1NHL A;  1K73 Q;  3CMA P;  1PPJ E;  5GTI H;  2YO2 A;  3PH0 A;  3D70 A;  2JWA A;  1BE3 D;  3H1H D;  1EZV D;  1XTC C;  1JY2 P;  1USD A;  4KJM A;  2Q9I B;  1GDT A;  1RF0 A;  3PJS K;  4H44 C;  3T97 A;  1NTM J;  1BE3 E;  3B5N C;  3L71 G;  1FOS F;  1IFN A;  4BRY B;  1XTG B;  1QVF O;  1N7S A;  2D39 A;  5L8R J;  5E79 E;  2L91 A;  2H43 C;  3AEA C;  5APX A;  1M7L A;  1Z56 A;  4Z1M H;  2WT7 B;  3H32 B;  2W83 C;  2IYO A;  1YTZ T;  2E5T A;  3HD7 A;  2FFD A;  3A5T A;  1KB9 D;  1RF1 A;  1BGY J;  2IBZ E;  3GMA A;  3EFG A;  1N73 C;  1DH3 A;  3KZI H;  5CCH A;  3G4S P;  4UB6 H;  2B87 B;  2HPC C;  2L5G B;  2CPB A;  3ITK A;  1L0L E;  3VOP A;  1N7L A;  2A06 E;  1KYO I;  1KYO D;  3P8C D;  1ZR2 A;  5K5G B;  2P7J A;  2VRS A;  1JB0 J;  2N9Y B;  3AE6 C;  1NU1 K;  1URQ B;  1X79 B;  1SQX E;  4XE5 B;  2FXO A;  4Y28 J;  3OA7 A;  4WB4 A;  4NPE A;  4WY4 C;  4IOI H;  1JOC A;  1EC5 A;  4U3F D;  1NTM D;  1YQ3 C;  1BCC D;  1L4A C;  1FZE A;  2HPC B;  3VMZ A;  3CD6 P;  1GK4 A;  2H88 C;  3P8C E;  1FU1 A;  4R9J A;  2YNY A;  1NTM G;  4L73 A;  2P67 A;  1RQU A;  3TGU E;  1PP9 G;  2HLO B;  3H1K J;  5APT A;  2E74 B;  5B5E E;  3S1K A;  1KB9 E;  1IFI A;  4IL6 E;  3JSV C;  1Q2N A;  1H89 A;  1FZC B;  1G2C B;  4U3F J;  1VF5 D;  1RF1 C;  3HE5 A;  4ZFG A;  2Q7C A;  3U1C A;  5CCH C;  2BAS A;  1IFP A;  1KIL B;  5KLV D;  3I55 P;  2O01 N;  1LTB C;  4UB6 E;  3Q5S A;  3H1L D;  1IFD A;  3RK3 D;  2Q3I A;  1H8A A;  2KNC A;  1R8E A;  3RK3 B;  1FZA B;  4GOE A;  3RK3 E;  3USS A;  2W6J H;  3WUT A;  3E1I B;  3SFD C;  4W7Z A;  2LXB A;  1BSN A;  2WSE J;  3KHU A;  3GW6 A;  1DX7 A;  2YKP A;  2W6A A;  3WU2 H;  4HKZ H;  3L73 D;  3P32 A;  4BXL A;  2XNX C;  3HTK B;  1RY3 A;  1MUU A;  2J61 A;  3AE8 C;  1FBM A;  3C9I A;  3TNU A;  3F89 A;  1N7S B;  1S9K D;  3HD7 D;  1EDJ A;  4L76 A;  1LGH B;  4WVZ A;  2KI7 B;  1Z3S A;  1KQF B;  3H1I J;  5BU5 A;  1JTH B;  1FZB A;  2ZYA A;  4JZC A;  4CPG A;  3FWN A;  2QSI A;  2YXR B;  3B8E B;  4HYT B;  4WBA A;  1Q81 Q;  5TIS H;  2OQQ A;  1JY2 O;  1HJB A;  1LJ2 A;  1BGY D;  5CMZ A;  1NAY A;  1EDL A;  3AEB C;  3TK1 A;  1NTZ E;  5M1B A;  1L0N J;  3AEF C;  2KB7 P;  1S72 P;  3TYY A;  3H1K G;  2IPP A;  4C7N A;  2E76 B;  3G6E P;  2NPS A;  1SQB J;  5CCG C;  2Z4E A;  3IF4 A;  5B66 H;  3MZW B;  2DW3 A;  1J1E C;  2KNC B;  4D6T E;  5TIS E;  3H1K D;  1M1J A;  1P84 E;  2JR8 A;  3OW2 O;  2H43 B;  2OGU A;  1BCC J;  3PP5 A;  5APQ A;  3WMM 0;  1N86 C;  3M0D A;  2CPS A;  2E5Y A;  2RN0 A;  4TT3 H;  2OTJ P;  2R5D A;  3CLQ A;  1GD2 E;  4IL6 H;  1FDI A;  2XU6 A;  1KIL D;  2J58 A;  2I1J A;  1H0T B;  3E1I C;  1EZV I;  4R9T A;  2A45 H;  1NU1 E;  2IFM A;  1FZE B;  1PP9 E;  1FZF B;  1LNQ A;  2YKO A;  3G9R A;  3A0B E;  3L73 G;  3H1I G;  3M0A A;  1G1J A;  1URQ C;  2KSE A;  4L74 A;  3O8Z A;  5CJ0 A;  2HYN A;  1SQV E;  3L74 J;  1HVV A;  4K3A A;  3TNU B;  3L37 A;  2FYN B;  2YIU B;  1LWU A;  3C1L A;  1L4A B;  3CC4 P;  1KB9 I;  1NKN A;  4K35 A;  1FZG C;  1SQX G;  4AUW A;  4EOT A;  1YJN P;  1QX8 A;  2QM7 A;  1GL2 A;  2E43 A;  1URQ A;  3A0H H;  4BRY A;  1FDO A;  3KZI E;  4AYC A;  1L0L J;  4M7F A;  3B5N B;  3L74 G;  3M0D C;  3L72 D;  3SFE C;  4H44 D;  2QM8 A;  1VF5 C;  4PJ0 H;  1BDC A;  1LTI C;  1M1J C;  2K37 A;  4DJG A;  1GL2 B;  2WZ7 A;  3HD7 B;  3AED C;  3SWK A;  1NYH A;  2PFX A;  1X9V A;  2H7H A;  1FZB C;  5TJH A;  2ZT9 B;  1L4A A;  2WSF J;  2A06 G;  3M91 A;  4N78 D;  3CCL P;  2OTL P;  1PP9 D;  3MUD A;  1PV3 A;  4H13 C;  3Q1M A;  2E76 C;  1VQK P;  1Y9B A;  4H0L B;  3RL0 D;  1L0L D;  2KZJ A;  1JY2 N;  2R44 A;  2JJL A;  1PGQ A;  1KFN A;  3U59 A;  2BEQ D;  1Z3U A;  4U3F E;  2PGD A;  2UWJ E;  3WUV A;  4M3L A;  1RE4 A;  1NOH A;  1SFC C;  1VQ4 P;  1MFZ A;  3GHG C;  2A45 I;  3QH9 A;  1SQB G;  2M5A B;  4JBZ A;  1SQV G;  1KTM A;  2PP6 A;  3CXH D;  2GA1 A;  3H1J D;  3L70 D;  3BCC D;  2Y9Y A;  1L0N G;  2R3C A;  1VPC A;  1YQ4 C;  5KAF E;  2OYH B;  1SQV D;  1X22 A;  3O6Q B;  2KSJ A;  2POH A;  1T3U A;  1NJI Q;  1NAF A;  2I1K A;  4OGQ C;  3U1A A;  2AXT H;  3H1H J;  2FYU G;  1ZLL A;  3FXE A;  2NZ2 A;  3V2Q A;  3HUS C;  2FYZ A;  2KZI A;  3VTP C;  1AA0 A;  5KJ7 D;  1S5L X;  5KLI B;  3MTU E;  1NTZ K;  2R3S A;  2YXQ B;  4DCK A;  1RE3 C;  2K88 A;  3B5N D;  2QIW A;  1VQO P;  1K9M Q;  3CCV P;  5AVR B;  3CL3 D;  1VF5 B;  1L4A D;  3NMD A;  1LWU B;  4WWI A;  3L4F A;  1S5L E;  5H2F H;  1FAV A;  2ZT9 D;  1L2P A;  4JQ0 D;  1SVF A;  1JO5 A;  1BGY G;  4IFD K;  2J64 A;  1AQ5 A;  1JMM A;  2JWD A;  5EFW B;  1SQP E;  1SQX J;  1M57 D;  2HFE D;  2FIB A;  1S2E A;  3V2P A;  1HH0 A;  1NTK K;  3P8M C;  3C8V A;  2XNX A;  4PV1 D;  3CCE P;  1JUN A;  1LP1 A;  2V7Q J;  3MUD C;  3H6P A;  1JCD A;  3A7O A;  3L71 J;  2PRR A;  1P84 D;  3B4S A;  1P84 I;  1DD3 A;  1RF0 C;  2Z5H A;  4PD4 D;  3AEG C;  4PD4 I;  3D6Z A;  2AXC A;  2AXT E;  1RF1 B;  2ZVN B;  1NTM E;  3CWB D;  2HG5 D;  1ZW0 A;  4EPU A;  3VYI A;  1AQT A;  2E75 B;  2J61 B;  1SQQ J;  2ZYG A;  5CBN A;  1SS1 A;  1KD1 Q;  2Q5U A;  1QL1 A;  2WWW A;  4U7J A;  1ZV8 A;  4JPZ B;  2Y0D A;  3IN6 A;  3CXH I;  1BCC G;  2W27 A;  1SQX K;  4A7P A;  5AVX B;  3OJA B;  1ZRT E;  1RH5 B;  1SQV K;  5APV A;  5AW2 B;  1DIP A;  5AVT B;  1OW6 A;  2HOD A;  5KLV J;  1T2K D;  2QJK C;  1NTZ D;  4NPF X;  4B86 A;  1W5C E;  2G8Y A;  2V7Q H;  5KLI C;  1W2E A;  3L74 E;  5CCG D;  2D2C B;  2MKV A;  1MV8 A;  4NYT A;  4L75 A;  4I7Z C;  2JHM F;  1EXJ A;  1A02 J;  2KS1 A;  4R4L A;  3LIE A;  2WSC H;  3H1L G;  3JCU E;  1GMJ A;  3H1J G;  3L70 G;  3RBZ A;  3H25 A;  1L0L K;  2AEM A;  1NWQ A;  2N1T D;  1HGV A;  2FKW B;  3V4W A;  3HE4 B;  1SQQ D;  2IX7 C;  2K3R A;  4PV1 C;  1SFC D;  1S1C X;  1PGO A;  1FIB A;  1AVO A;  1KV4 A;  1SFC A;  2IZ1 A;  4XFJ A;  1QLE D;  1GTW A;  5KLV K;  2NPS C;  1PPJ D;  2FBW C;  3M9H A;  3H1L E;  2N1T C;  2OYO A;  2IFN A;  1LTS C;  1M8O B;  1VQP P;  1DEB A;  4YXW H;  3AE2 C;  4NPD A;  3PRJ A;  2YMY A;  1KZU B;  1N73 B;  2Z4E B;  1IZN B;  2XZR A;  5AW1 B;  4H13 D;  4KT0 J;  2QE7 H;  3FWL A;  2FY8 A;  1KQS O;  3IR9 A;  1QGK B;  4I2L C;  3ZDM A;  2OYH C;  1AVY A;  2QA4 P;  2WPR A;  1EDI A;  4I6M C;  1S4X A;  1ZOY C;  5KAF H;  3AE5 C;  1GK6 A;  2H43 A;  1NH4 A;  3HUS B;  2IBZ G;  2XDJ A;  2OYH A;  1ZN5 A;  3O6Q A;  1SQQ E;  2IZ0 A;  3II6 A;  5BU8 B;  1LTG C;  3IAO A;  1E5W A;  1RE3 B;  2K1A A;  1WMK A;  2J0G A;  3PHL A;  3V4Q A;  3H1K E;  2E74 C;  4HH2 A;  2E76 D;  3L71 E;  1SQP K;  1AJY A;  3MD0 A;  1N86 A;  5E79 H;  2O01 H;  3TSI A;  4OGQ D;  2Q1K A;  1PZQ A;  1K8A Q;  2YIU C;  1NTZ J;  1FC2 C;  1FID A;  4GT1 A;  3HUS A;  2QVA A;  2P2U A;  3VP9 A;  1U7J A;  1KIL C;  1OX3 A;  4WY4 A;  1EQ7 A;  3TDK A;  1EXI A;  1M90 Q;  2QJP C;  1GU4 A;  1WT6 A;  1Q82 Q;  3KPE A;  3LW5 J;  3BAS A;  4R4M A;  3BAT A;  3CC2 P;  3L73 E;  2B88 A;  4PJ0 E;  1IFM A;  1U7M A;  3KYQ A;  2WIT A;  2N9B A;  2ZT9 C;  2FFD C;  1KQL A;  2KIK A;  3CPW O;  4JYB A;  1N73 A;  3V2N A;  3SWF A;  1GW3 A;  1HBW A;  3H1H E;  3T97 B;  1NTK J;  4UB8 E;  3CX5 I;  3L72 J;  2KLU A;  2KP8 A;  3H1I E;  1JY3 P;  2R5B A;  5AW7 B;  3TGU D;  1UIX A;  1VDF A;  1SQP G;  3CXH H;  3CC7 P;  4YTP C;  5CJ4 A;  1PIX A;  4DT0 A;  3GHG B;  2J3U A;  1SQB D;  1OFC X;  3BRT B;  5H2F E;  5C39 A;  3CCM P;  2OTK E;  2QRX A;  1NU1 G;  1BDD A;  4EIJ A;  2GY7 A;  1SP4 A;  5BVZ A;  2WT7 A;  1NO4 A;  1FJK A;  1GL2 D;  4ZMD A;  3RL0 g;  1PPJ G;  4RO0 A;  3HTK A;  4N78 E;  1Y8A A;  1LT1 A;  4ZKP A;  2IDB A;  1JM0 A;  3PLN A;  1SQV J;  2KK7 A;  3RL0 B;  1N8R Q;  4D6T G;  1KMI Z;  1HGZ A;  4JYO X;  5CCG A;  3NFQ A;  2WSC J;  1Q90 D;  1GL2 C;  2RKL A;  3AE9 C;  3GF3 A;  3RK3 C;  3B71 A;  1MKM A;  5CBO A;  2OYI B;  1DD4 A;  2AEJ A;  1GW4 A;  4IFM A;  2WTY A;  1FZB B;  1BE3 G;  1KFM A;  2B89 A;  2ZXE B;  3BCC J;  1BGY E;  1KOR A;  3CCJ P;  3BRV B;  1NTK E;  3A0B H;  3CXH E;  3H1J E;  3L70 E;  2FYU K;  1LTJ B;  5AVY B;  1M56 D;  5AVU B;  2NPS B;  1FZD A;  1RE3 A;  1YHQ P;  1CSB A;  2ZJS E;  2M0B A;  4ASV A;  3RBX A;  2RMZ A;  4PD4 E;  3E7K A;  2LR2 A;  1CZQ A;  3K5B A;  1SQQ G;  2H8P D;  3VMY A;  5CCH D;  2OYI C;  1YTZ I;  2YMK A;  1S9K E;  1SFC B;  2O01 J;  2ZYD A;  1L0N D;  2LXC B;  3IFM A;  2YO3 A;  1FZE C;  2H89 C;  1H88 A;  2BCC D;  3WUU A;  2JHH C;  3BVH B;  1HTL C;  1JEK A;  1BCC E;  3NTN A;  1J2J B;  1JC9 A;  2Q3E A;  2KS1 B;  3RK2 B;  3GF7 A;  2WSE H;  5KLV E;  3AEC C;  1NU1 J;  1LTT C;  1SQB E;  3EQ2 A;  3E1R A;  2JEE A;  4UB8 H;  4XA4 A;  2WSF H;  1D7M A;  4C7N B;  1GU5 A;  4Y99 B;  1SLQ A;  1PFI A;  1CI6 B;  3H1L J; 
#chains in the Genus database with same CATH homology
 1W2E A;  4HYT B;  4WBA A;  2XV5 A;  1JY2 O;  3H32 A;  1HJB A;  5CCG D;  1LT9 C;  4M7H A;  2J0Y A;  5CMZ A;  1MV8 A;  3KQG A;  4N3Y B;  4NYT A;  5AW8 B;  4W80 A;  3LID A;  1LT9 A;  2XNX B;  2OAR A;  3B5N A;  3TK1 A;  2JHM F;  1IC2 A;  2KYV A;  2C9N Y;  5CHX A;  2N1T B;  1A02 J;  2O1K A;  3LIE A;  2WSC H;  3V5B A;  2KB7 P;  1LWU C;  3TYY A;  1JCC A;  3M9Q A;  1HWT C;  1L0L K;  2Q9I C;  1NWQ A;  2IPP A;  2O1J A;  4C7N A;  2N1T D;  1HGV A;  1IJD B;  2FKW B;  1G1I A;  4W7Y A;  3V4W A;  2NPS A;  3HE4 B;  4JF7 A;  5CCG C;  2Z4E A;  2PAJ A;  2IX7 C;  2M8R A;  1SFC D;  1FIB A;  1J1E C;  1X8Y A;  1FIC A;  2XKM A;  5AW0 B;  1M1J A;  1SFC A;  2JHI F;  1LT9 B;  1JTH A;  1N2D C;  2E42 A;  2H43 B;  1GTW A;  2N1T A;  3PP5 A;  5APQ A;  3WMM 0;  1N86 C;  3M0D A;  2CPS A;  5KLV K;  2HOD C;  2NPS C;  3M9H A;  2N1T C;  2R5D A;  3CLQ A;  1GD2 E;  2IFN A;  1LTS C;  2C0W A;  1DEB A;  4RES B;  5AW5 B;  4GIF A;  1JNM A;  2KOG A;  2YMY A;  3M06 A;  1KZU B;  1KIL D;  2XU6 A;  5AVS B;  1LTA C;  2J58 A;  1N73 B;  2Z4E B;  2XZR A;  2I1J A;  5AW1 B;  5AW4 B;  2M3B A;  3E1I C;  1KIL A;  1IO4 A;  4R9T A;  1CW5 A;  4OH8 B;  2A45 H;  2A45 G;  3MIW A;  2J3F D;  1J1E B;  3IR9 A;  2IFM A;  1FOS E;  1FZE B;  4I2L C;  2JHK F;  1FZF B;  3FIB A;  2OYH C;  4AQR D;  2YKO A;  3V2R A;  3BVH C;  2WPR A;  2J3O A;  3M9B A;  1RE4 C;  3M0A A;  1G1J A;  4I6M C;  1URQ C;  2J2P A;  2FXM A;  1M1J B;  2YKQ A;  1NTM K;  3O8Z A;  5CJ0 A;  2WPQ A;  1SQQ K;  1GK6 A;  1YYC A;  2GUV A;  2HYN A;  1OWA A;  3L36 A;  1HVV A;  4WY4 B;  3TNU B;  2GUS A;  2H43 A;  2J59 M;  3L37 A;  1NH4 A;  3HUS B;  2XDJ A;  2OYH A;  1ZN5 A;  1LWU A;  3II6 A;  1L4A B;  1NKN A;  5BU8 B;  2J5Z A;  1FZG C;  1LTG C;  1E5W A;  4AUW A;  4EOT A;  1OXZ A;  1RE3 B;  2WNP F;  4GKG A;  5AW3 B;  1MZ9 A;  2QM7 A;  1GL2 A;  2E43 A;  1URQ A;  5AVQ B;  4C46 A;  3OAK A;  3HRN A;  4N6J A;  1CI6 A;  1ZR4 A;  4AYC A;  2J1G A;  1FJP A;  4M7F A;  3B5N B;  1IFJ A;  3M0D C;  2MJZ A;  1J1D C;  2J0G A;  1RE4 B;  2QM8 A;  3V4Q A;  1LTI C;  3GHG A;  3E1I A;  4HH2 A;  1M1J C;  2HLO A;  1GL2 B;  5AW9 B;  2WZ7 A;  1SQP K;  3HD7 B;  3I5C A;  3MD0 A;  1N86 A;  2O01 H;  3TSI A;  1FZC C;  4C7R A;  1X9V A;  5AW6 B;  2H7H A;  1NHL A;  3VMX A;  1FID A;  1FZB C;  4GT1 A;  1URQ D;  3HUS A;  1FZG B;  2P2U A;  2YO2 A;  3KDP B;  1L4A A;  3RK2 D;  3M91 A;  2HPC A;  5KJ7 C;  4N78 D;  3VP9 A;  1KIL C;  1XTC C;  1JY2 P;  3MUD A;  4WY4 A;  1EQ7 A;  1LTJ C;  1SQB K;  1WRG A;  2Q9I B;  1GDT A;  1RF0 A;  3HE5 B;  3T97 A;  4LGD E;  3B5N C;  4O9B A;  1GU4 A;  3N4X A;  3RL0 D;  2KLV A;  1WT6 A;  3KPE A;  1JY2 N;  1J1D B;  1FOS F;  3BAS A;  2JJL A;  1IFN A;  1KFN A;  3U59 A;  1XTG B;  1Z3U A;  1N7S A;  2D39 A;  3BAT A;  3NXS A;  5APS A;  1RF0 B;  4M3L A;  2H43 C;  1RE4 A;  1IFM A;  3N7N A;  3KYQ A;  2WIT A;  1N86 B;  1NOH A;  2N9B A;  1M7L A;  1SFC C;  2HOD B;  1Z56 A;  5APX A;  2WT7 B;  1MFZ A;  3H32 B;  3GHG C;  1G2C A;  2FFD C;  2A45 I;  1FZA A;  1QL2 A;  1YTZ T;  3HD7 A;  1KQL A;  5KTB A;  2FFD A;  4JYB A;  1N73 A;  3A5T A;  3V2N A;  4DOJ A;  3SWF A;  1RF1 A;  1GW3 A;  1HBW A;  5APY A;  3EFG A;  2NPS D;  1N73 C;  1DH3 A;  2Z4E C;  5APU A;  5CCH A;  4ZKU A;  4WY4 D;  2Z5I A;  3G3Z A;  2HPC C;  2L5G B;  2PP6 A;  2CPB A;  2KP8 A;  1JY3 P;  2R5B A;  5AW7 B;  3MGN A;  2C0X A;  2R3C A;  3VOP A;  1VPC A;  4DZO A;  1N7L A;  3RK2 C;  2LKM A;  1VDF A;  1FZF C;  2OYH B;  1AFO A;  5APW A;  3RL0 C;  5CJ4 A;  2HLO C;  2KSJ A;  2POH A;  3P8C D;  1ZR2 A;  1T3U A;  2P7J A;  2VRS A;  3GHG B;  3H32 C;  2WPS A;  3L35 A;  2J3U A;  1N7S C;  1PFI A;  1NU1 K;  1URQ B;  1X79 B;  1NAF A;  2I1K A;  4XE5 B;  3BRT B;  3U1A A;  3OA7 A;  4WB4 A;  4WY4 C;  1JOC A;  1ZLL A;  4EIJ A;  1FZC A;  3V2Q A;  2ZFC A;  2GY7 A;  3HUS C;  1SP4 A;  2FYZ A;  5BVZ A;  3VTP C;  2WT7 A;  1L4A C;  1FZE A;  1GZL A;  1NO4 A;  5KJ7 D;  1FJK A;  2HPC B;  3MTU E;  3VMZ A;  1GL2 D;  1NTZ K;  1GK4 A;  3UIA A;  1RE3 C;  1T3J A;  2J3F A;  3P8C E;  3HTK A;  1FU1 A;  4N78 E;  4R9J A;  1L0N K;  4ZKP A;  2YNY A;  3B5N D;  5AVW B;  2P67 A;  3RL0 B;  2HLO B;  1HGZ A;  4JYO X;  3VP8 A;  5AVR B;  3CL3 D;  1IK9 A;  5APT A;  5CCG A;  1FDM A;  3NFQ A;  1L4A D;  3NMD A;  1LWU B;  1IFI A;  2R32 A;  1GL2 C;  3L4F A;  3HD7 C;  3RK3 C;  1FZA C;  1H89 A;  2OYI B;  1FZC B;  1FAV A;  1G2C B;  1GW4 A;  1FZG A;  4IFM A;  1SVF A;  1RF1 C;  3P7K A;  2WTY A;  1JO5 A;  1FZB B;  1T8Z A;  1HUC A;  1KFM A;  1N7S D;  4IFF A;  3SWY A;  1FZF A;  2GM4 A;  4IFD K;  2J64 A;  3HE5 A;  2ZXE B;  1AQ5 A;  4ZFG A;  3BRV B;  2Q7C A;  1JMM A;  3U1C A;  5CCH C;  2BAS A;  1KIL B;  2J0H A;  2FYU K;  2HFE D;  2FIB A;  1LTJ B;  5AVY B;  3V2P A;  1HH0 A;  1LTB C;  1NTK K;  3P8M C;  4JYC A;  5AVU B;  4KHX A;  2NPS B;  4LC1 A;  1FZD A;  2XNX A;  1RE3 A;  1A02 F;  1CSB A;  1IFD A;  1JUN A;  3RK3 D;  1NKZ B;  3H6P A;  2Q3I A;  1JCD A;  1JY3 O;  1H8A A;  3A7O A;  3HE4 A;  5KJ7 A;  1CZQ A;  3RK3 B;  3VN0 A;  2H8P D;  1FZA B;  3VMY A;  5CCH D;  2OYI C;  1YTZ I;  1T2K C;  1RF0 C;  2Z5H A;  2C9L Y;  3E1I B;  1S9K E;  2J60 A;  1SFC B;  1RF1 B;  2FFD B;  2HG5 D;  3IFM A;  2YO3 A;  4W7Z A;  2P1J A;  1LTJ A;  2JHL F;  1FZE C;  4EPU A;  1H88 A;  3VYI A;  4Y99 C;  2JHH C;  3BVH B;  4LLH A;  3CI9 A;  1DX7 A;  1HTL C;  2J61 B;  2YKP A;  2W6A A;  3A2A A;  3NTN A;  1J2J B;  1JC9 A;  2Q5U A;  3P32 A;  4I1L A;  1QL1 A;  2WWW A;  1ZV8 A;  3RK2 B;  3LW5 H;  2J3G A;  2WSE H;  2XNX C;  2W27 A;  1SQX K;  5AVX B;  1LTT C;  3EQ2 A;  3HTK B;  2Q9I A;  1RY3 A;  1MUU A;  2J61 A;  3OJA B;  2JEE A;  1SQV K;  1FBM A;  2W6B A;  5APV A;  5AW2 B;  3C9I A;  3TNU A;  1N7S B;  5AVT B;  1S9K D;  3HD7 D;  1JY3 N;  4XA4 A;  5AVZ B;  1LGH B;  2HOD A;  2OYI A;  2WSF H;  1Z3S A;  1T2K D;  5BU5 A;  4C7N B;  1GU5 A;  4Y99 B;  4B86 A;  3R2P A;  1JTH B;  1FZB A;  3A3Y B;  1SLQ A;  5AVV B;  4JZC A;  3BVH A;  1CI6 B;  3B8E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...