1FZEA

Crystal structure of fragment double-d from human fibrin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
DLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 30
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzeA00
1LWUC 2FFDA 1LT9B 2A45H 2H43A 1M1JC 1RE3C 2HODA 3E1IA 2XNXA 2A45I 1RF1B 1FZFA 1JY3O 2OYHA 3H32A 1LWUB 1RF0A 3GHGC 1FZEA 3HUSC 1FZCB 1JY3P 1M1JB 1RE4A 1FZCC 2HLOA 2FFDC 1JY3N 2OYIA 3GHGB 1FZGA 3HUSB 1LTJA 1N73A 1W2EA 2HPCA 2OYHC 1RF0C 1FZBA 2FFDB 1RE4C 1LT9A 1T3UA 2HODB 2Z4EA 1N86A 2OYIC 1RF1A 3H32B 2OYHB 1LTJC 2A45G 1LWUA 1FZCA 1N73C 1M1JA 1RE3A 2OYIB 1JY2O 2Q9IA 1LT9C 3BVHA 1LTJB 3GHGA 1N73B 1JY2P 3HUSA 2HPCB 1RF1C 1JY2N 1FZAA
chains in the Genus database with same CATH superfamily
3BCCE 4WWIA 2N9YB 1YITP 2D2CB 2AEFA 4PD4E 1OX3A 1H88A 1JOCA 3NXSA 1LTJC 2FYUG 1FAVA 5E79E 2JJLA 3RL0C 2FXOA 3L72J 2Y9YA 1SQQG 4KHXA 1FJKA 3AEFC 2POHA 1IFPA 5CCHC 3AE1C 3GHGB 1BCCJ 1KYOD 3KDPB 1SQBD 2YO2A 2YKQA 4C46A 5APSA 5APTA 1T2KC 3MZWB 3F89A 3R2PA 3FX0A 1ZOYC 3CX5E 1JMMA 2Q1KA 2W6AA 1GK4A 1K8AQ 2LXBA 1M90Q 1MFZA 1L0LE 3L75E 1NTKG 2IDBA 2CK3H 4RESB 3CXHE 2FYUJ 4IFFA 2QJYC 4U3FD 3H1LG 1DIPA 2WSEH 3GW6A 1G2CA 3B5NC 1FZAA 1WT6A 5KLVD 4WY4C 1YIJP 1DD4A 3AE8C 1KQLA 2FKWB 2HODB 3VYIA 5K5GB 4OGQB 1L4AC 1RE3C 3A3YB 2JKVA 4N78E 3WU2H 2R3SA 4XE5B 2M3EA 1K9MQ 3O6QA 2FYUK 4EYYQ 1JEKA 1PP9J 1QLED 2KLVA 2N1TC 3U59A 2J59M 4PV1B 1SQBG 1L0ND 4HB1A 3AE4C 2WSCJ 1HGVA 1IC2A 4IOIH 1K73Q 1P84D 3P7KA 4C7RA 3TDKA 1MUUA 2OYHB 1KZUB 1LTSC 1J1EB 2BCCE 1HF9A 1AQTA 1VDFA 1JM0A 1ZR2A 1EZVI 1KILB 1EXIA 2QA4P 2KNCB 1S5LE 1EDLA 1LP1A 5AW1B 2E76D 1DH3A 1FDIA 5KTBA 1SLQA 3TGUD 1CSBA 2Q3IA 1BSHA 4U3FG 1S5LX 2IBZE 1PGQA 1X0TA 3H25A 1JY3P 1K05A 3HUSB 4GOFA 5APWA 5KLVG 5M1BA 3GLMA 1WRGA 5KAIE 1BE3D 1SQPG 1FZCC 1Y47A 1LT9B 2ZXEB 2FXMA 5CBOA 1GDTA 2YXQB 3NMDA 3RK3E 3FWLA 1LTJA 1LT1A 2LKMA 1AJYA 2QE7H 2YIUB 1M1KQ 1KQSO 5CCHA 4YXDC 5AVZB 1ZN5A 2NZ2A 2BEZF 4HJGH 3A5TA 3HD7C 1VQ9P 2IZ0A 2WITA 4XA4A 5KLIB 2OYIC 1OFCX 1KQGB 4AUWA 5KLVJ 4DCKA 3CXHH 4I1LA 3H1KG 3CXHI 2QM8A 2N9BA 2KZJA 2H8PD 5BVZA 5KJ7C 1BDCA 4NPDA 3HTKB 2WPRA 5CCHD 1SQPE 3A2AA 4UB8E 1WMKA 3G3ZA 3M91A 3RK2D 1T2KD 2XV5A 2BEQD 3B8EB 4H0LD 5BU5A 2XU6A 1KD1Q 3CCMP 1X8YA 4WY4A 1L0NJ 1JTHA 3AE5C 2FYNB 1EZVD 1BE3G 5APVA 1G2CB 3IFMA 4I7ZC 2P10A 5KLVK 1SQVE 1FZBA 1VQPP 2IPPA 5AVUB 3CCEP 1L4AA 1RE3A 1D7MA 3H1JD 4L76A 1NVOA 3H1IE 2KLUA 2WSCH 5CMZA 1NKZB 3MIWA 2A06E 1NTZE 2KIKA 4H13B 4BWNA 2N1TA 3TGUJ 2Z4EA 3L35A 3TK1A 3L73D 1CZQA 2IZ1A 3BASA 3HE5A 3CPWO 2OGUA 3G71P 1BGYD 3O6QB 1M1JC 3L72D 4C7NB 1VQOP 1L0NK 2WZ7A 1JUNA 2ZYAA 1BE3J 3CC2P 3BRVB 1URQC 1OW8A 2L5GB 2NPSC 4UB6H 1JMBA 1ZLLA 4GIFA 3EWKA 4RO0A 2QG4A 5C39A 2N1TD 3ABVC 1T8ZA 2WSEJ 4D6TD 1H8AA 2QJPB 1VQ7P 3PLNA 1NKNA 5CCGD 1BSNA 1UIXA 2E42A 1EQ7A 4K35A 3CCJP 5APQA 3ZDMA 2WPVB 3CXHD 1M8OB 1OXZA 3PHLA 1EZVG 1FZCA 1FE6A 1MZ9A 2WT7A 2W27A 4NPFX 4L74A 2WSSH 3H1JG 3L74E 4OGQD 2Y0DA 3K5BA 2L91A 4U7JA 5AW7B 3HE4A 3PP5A 4TT3H 1BDDA 3I55P 1NTME 3EQ2A 1VQKP 3D6ZA 1LTJB 5B66E 3II6A 4H44C 3RL0B 1PPJG 3CC4P 3L73G 3KYQA 2OYIA 2ZAEB 1VQMP 1BGYG 3CWBE 2KP8A 1A02F 3L72G 1RE4C 5TJHA 1KC8Q 1KV4A 2P67A 1YTZI 3D71A 1YI2P 1BCCG 4EOTA 1LTBC 4UB8H 2K37A 2H88C 2LXCB 4NPEA 4H0LB 5KJ7A 2HPCA 3A7OA 2RMZA 1YJ9P 3WUVA 3H1JJ 5AW8B 1SQXJ 3S1KA 3V2PA 3MTUE 1AFOA 1RQUA 2P1JA 3L70E 4XFJA 1P84H 1KB9E 3H32A 4D6TG 1P84I 2Q7CA 2B88A 2QJYB 2PP6A 3L73J 1HJBA 2C9LY 3CD6P 1BGYJ 3GMAA 3AECC 2A45H 2A45I 3B5NB 5KJ7D 3FXDA 1NU1D 4WY4B 1JTHB 3VOPA 3L71E 1Y9BA 3O8ZA 2KYVA 1L2PA 3BATA 4ZMDA 1L4AB 1SQXK 3HTKA 2IYPA 3USSA 3JCUE 1RHZB 4D6TJ 1RQVA 1M1JA 2PGDA 3LW5J 1JY2P 5AVQB 2N1TB 4M3LA 1GMJA 1PP9G 4WVZA 3HE5B 3A0HE 4JQ0D 5CJ0A 3RBZA 3KXDA 2ZT9C 5GTIH 1URQA 3RGUA 4L73A 2NPSA 2CPBA 1T3JA 3KZIE 5AW9B 1VF5C 1HBWA 1Q81Q 2FYUE 3MD0A 1QVFO 1KFNA 4N6JA 1OMIA 5CJ4A 4L75A 1SQQE 3TF5A 1RY3A 1PIXA 1M7LA 2JDIH 5CBNA 2W8ZA 1KQFB 4HYTB 2I1KA 4LGDE 4AQRD 1ZRTE 3V2RA 3P8MC 1M57D 2WPQA 3G4SP 2IYOA 1DX7A 2Y9ZA 1NO4A 4HKZH 1URQD 1VQ8P 3SFEC 2HR3A 4PJ0H 2RN0A 1NAYA 4C7NA 2R5BA 1NTKE 1NU1G 4ZKUA 1S9KE 1FDMA 2M0BA 4CPGA 3FGAD 2ZVNB 3CCLP 1QEXA 5APUA 1FZCB 2IX7C 2WT7B 2YNYA 1T3UA 3CCRP 5AVWB 4H13D 3H1LE 2K9JA 2AXTE 2C0XA 3E1RA 2NRGA 1NJIQ 3H1HD 5TISH 3HE4B 1GZLA 1SFCC 1FZFA 3H1ID 1U7JA 1JNMA 1RE4A 3B4SA 1Q2NA 5B5EH 1NTZD 4IL6E 2I1JA 1ZV8A 3EFGA 3HD7B 5H2FE 2XZRA 1HTLC 2OYIB 4IL6X 1ZMEC 3TNUB 1NU1J 4ZKPA 4PD4H 1E5WA 1MFTA 4PD4I 1HVVA 4W7ZA 3UIAA 2XKMA 5E79H 2HPCB 1KYOE 1IK7A 1SQBE 3IN6A 2IFMA 4O9BA 3KPEA 4PV1C 3A0BE 3H32B 3M9QA 2O1JA 2ZVOB 1J1DC 3CX5H 3CX5I 2WMMA 1HUCA 1GU4A 3L4FA 1KORA 3Q1MA 1L0NG 3N4XA 4OWFA 5GTHE 4I7ZB 1NU1K 2AEJA 1GK6A 2HYNA 3Q5SA 3LW5H 3CC7P 4JYBA 1USDA 4BXLA 1IZNB 2H43A 4U3FE 3H1HG 3CCQP 3MP7B 3RL0D 1ZR4A 3C9IA 3JC22 4A7PA 3L74D 1GW4A 5KLVE 3PJSK 3HRNA 3TGUG 5DJUB 1M1JB 4RKUJ 4DJGA 5AVXB 3T97A 1GTWA 3VMXA 4EDFA 5AVVB 2QIWA 2AXCA 2V4HA 1KN7A 3B5NA 3M06A 2YMKA 2PRRA 1AA0A 1URQB 2NPSB 4JYCA 3WUTA 3RK3C 1ZXGA 1DEBA 2QSIA 1QL2A 3V5BA 1SQVJ 1FOSF 3BRTB 1PV3A 3R4YA 3H1HJ 1SQXD 2RH0A 2R3CA 2ZT9D 1NAFA 3H1IJ 4JF7A 1JY3N 3BCCD 1NTZJ 1VF5D 3EFFK 3H1KE 2KSEA 1YQ4C 4PD4D 3B5ND 2J5UA 4WY4D 1KTMA 1TU3F 3TSIA 2MKVA 2G8YA 4KT0J 1S5LH 1L4AD 3QWOC 1VQ5P 2PFXA 3N7NA 1SFCA 3PRJA 1S1CX 1CW5A 5APXA 3L71D 1M56D 2FBWC 1SQVK 2IBZI 1USEA 4H44B 2K9JB 4MN4C 3CX5D 2FFDC 1IFMA 2W6JH 1W2EA 1BE3E 1FC2C 1H0TA 1DEEG 3V2QA 1N73C 2XDJA 3MGNA 1NWQA 3I5CA 1NTZK 1Z56A 1L0LD 3L75D 4DZOA 5KAIH 2QJKC 4DOJA 2E74C 3B71A 3OAKA 1VQ4P 1QGKB 5KAFE 4N3YB 2P7JA 3A0BH 3FXEA 4GT1A 1NGMB 1YYCA 1K04A 2Z5IA 1MV8A 2B87A 4ASVA 2JO1A 3MUDC 1SQXG 4GDOA 3L74J 3M0DC 1SQQD 2JWAA 1Q90D 3BCCG 2E76C 1OW6A 4I6MC 2YO3A 5AW6B 1Q82Q 1NH4A 3WU2E 2E43A 4HH2A 3U1AA 1LTGC 2V7QH 3HD7A 1SS1A 3AEAC 3Q2YA 2M5AA 3AE3C 1OIPA 4N78D 3W67A 2YKOA 3CWBJ 1KMIZ 3TNUA 3CCVP 2YMYA 1ZW0A 1NTKD 3E1IA 4R4MA 2WTYA 3V2NA 4IFMA 1HJ0A 4Y99C 5AVTB 3AEDC 2QJPC 2GUSA 3CI9A 2M8RA 3I56P 2GUVA 1EZVE 5L8RJ 2KSJA 3H1LD 3HD7D 2JWDA 2BCCD 3BCCJ 2HLOA 3L75G 2W6BA 3M9BA 3H1JE 2FXPA 2O01H 2ZT9B 1MKMA 2RKLA 2ITAA 3T97B 1GL2C 2G3AA 3MHVA 1OVUA 1VF5B 2K88A 2ZFCA 1PGPA 2E75C 2IBZD 3VN0A 1PPJE 1R5SA 5AW5B 2WWWA 3OJAB 3L73E 2Q6QA 3Q5PA 2R32A 1BGYE 3L72E 2Q3EA 3L71J 1G1JA 1NHLA 3OW2O 2WVRA 3IF4A 4YXWH 1BCCE 3Q5RA 3WMM0 4GOEA 3RK2C 3RK3D 1L0LJ 3L75J 1CI6A 4RJTA 1RF1C 5AVSB 1Q86Q 1LWUC 3SFDC 4H0LC 2WSFH 3SWYA 4D6TE 2C0WA 1N7SC 3GF7A 4BRYA 4IFDK 5EFWB 5KKZC 2M3BA 1SVFA 1LGHB 1QX8A 3V4WA 2ZXXA 2D2CC 2FFDA 3D6YA 2O01N 3LIDA 1JY3O 1SFCB 1SQQJ 1N73A 2KB7P 1EXJA 5KAFH 1N86A 1OW7A 5AW4B 2BCCG 1KFMA 2GM4A 1IK9A 1PFIA 4EI2A 3AE6C 2J58A 1QVGO 4LLHA 1H0TB 3D70A 2KK7A 2JR8A 2OTLP 3SWFA 1H89A 3GHGC 1L0LK 2KOGA 3ITKA 3F5HA 2WPSA 1IFJA 1SQPD 3PTZA 1VQNP 1AVOA 2NPSD 2O1KA 2IBZG 1NTKJ 3MUDA 4TLFA 3AE9C 5B66H 3M0DA 2P2UA 2QVAA 2WQYC 1PP9E 5AW3B 2R5DA 1QL1A 1X9VA 2E74D 4GKGA 4GODA 2B87B 4DT0A 1SQVD 1SQQK 1U57A 2K3RA 3H1LJ 3U1CA 3G9RA 2Y0CA 2BCCJ 5AVRB 5CCGC 1J1DB 1KILE 2KZIA 1LTTC 3SWKA 2A06D 1E79H 2IFNA 3P8CE 2KS1A 3H1KD 4OVNF 3C8VA 2Q9IA 2M5AB 4QMAA 3NTNA 1FU1A 1KB9H 1NTKK 1KB9I 3VMZA 1RF0C 1R5LA 1GU5A 4H44D 2Q5UA 4OGQC 1S4XA 3IR9A 1IFNA 4UB6E 3CMAP 1JY2N 1LTIC 1NU1E 3S9OA 2HFED 2OARA 2Z5HA 1SQBJ 1EDKA 1LNQA 3P32A 3VTPC 1GL2A 2W83C 3FWNA 3M0AA 3KQGA 1PGJA 3QH9A 2I8DA 3G6EP 2DW3A 1VQLP 1X79B 2E5YA 2O3JA 1VL2A 2R44A 3RK3B 1ZP0C 2H7HA 3CMEP 1JO5A 3W68A 2OYHC 1J1EC 1IFDA 1YBKA 3NFQA 2AEMA 3JCUH 1KILC 1PZQA 3SSUA 3CL3D 3VP9A 1DD3A 2V7QJ 1SQVG 4U3FJ 1GL2D 5BU8B 2OQQA 3A0HH 1IO4A 2E5TA 1RF1A 3H1IG 2A45G 1LWUA 1SQBK 2E75D 3KZIH 3LIEA 2JP3A 3IAOA 1S72P 2A06G 1NTZG 1LTAC 3AE7C 2B9BA 1NTMD 1FS0E 5AW2B 3HUSC 1N7SA 1SQPJ 2JEEA 2BASA 1CI6B 2MJZA 1OWAA 1YTZT 3JSVC 1JCCA 1GW3A 1FBMA 1EDIA 1LT9C 3CWBD 1NYHA 4BRYB 2YXRB 4YPCA 1Q7YQ 5DJTB 4YTPC 2KUBA 2YIUC 2FFDB 1HGZA 1IJDB 2O01J 1L0NE 1X22A 1YHQP 5CHXA 4I2LC 3GHGA 1N73B 1VQ6P 1P84E 2UWJE 1N7SD 4B86A 2QJKB 2P58A 4AYCA 2E74B 1AQ5A 5KLIC 3L70D 1KB9D 2QRXA 2D2CD 3H1HE 1OVVA 1SQPK 3H1KJ 4EIJA 4JPZB 3GG2A 4Y28J 3RL0g 3AEEC 2AXTH 4JBZA 4W7YA 3KHUA 1GD2E 4WB4A 1YQ3C 2FYZA 1U7MA 3TGUE 3M9HA 2K1AA 4R4LA 1PPJD 1FOSE 4IL6H 3VMAA 1W5CE 5H2FH 3AE2C 5CCGA 3RBXA 2E76B 1JB0J 1JCDA 3L74G 4Z1MH 3CLQA 2WSFJ 3CCSP 2SPZA 1SP4A 1BCCD 1YJNP 1PGOA 1NTMG 4WBAA 2C9NY 1RH5B 1VPCA 1LJ2A 2FYNC 1S2EA 2HODA 2KI7B 1RF0A 2KS1B 4KJMA 1KYOH 5AVYB 5GTIE 1OVRA 3CWBG 1KYOI 1N7LA 2PAJA 4OH8B 1FZGA 2OTJP 2K9YA 4Y99B 2VRSA 1T6AA 2LR2A 1SFCD 1LP1B 1OZHA 2OYOA 5APYA 4H13C 2GA1A 3WUUA 2QEXP 2FYUD 3C1LA 2H89C 2ZYGA 3V6IA 2YKPA 2ZYDA 5GTHH 1Y8AA 3AEBC 3V4QA 1YJWP 3VMYA 3L70G 2QM7A 1GL2B 1NTMJ 3L37A 3CCUP 3BVHA 1IFIA 1ZRTD 1XTGB 2B89A 2OYHA 1FZEA 3L36A 3E7KA 1N8RQ 2E75B 4PJ0E 1R8EA 1UIIA 1N2DC 3OA7A 1KILA 1JY2O 2KNCA 4ZNCA 2OTKE 2Y0EA 2XNXA 1AV1A 1S9KD 4PV1D 4ASWA 3Q3DA 1PL5A 3S4RA 2HG5D 3L71G 1NOHA 3PH0A 4LC1A 4K3AA 2KXPB 2W90A 1PP9D 5TISE 3RK2B 1AVYA 3HUSA 2XNDH 2ZJSE 3TYYA 4W80A 1RF1B 3VP8A 5B5EE 1LWUB 3H6PA 1EC5A 2FY8A 1L0LG 3L70J 1HH0A 1NTMK 3AEGC 1W2BO 1HWTC 5AW0B 1FJPA 1KILD 2CPSA 1LT9A 1XTCC 1SQXE 1G1IA 1N7SB 1A02J 1FDOA 5KKZB 1S3JA 3GF3A 1J2JB 1EDJA 3P8CD
chains in the Genus database with same CATH topology
2H43A 3MUDA 1ZLLA 4GIFA 3M0DA 2P2UA 2N1TD 5AW3B 2R5DA 3RL0D 1QL1A 1ZR4A 1H88A 3C9IA 1T8ZA 1JOCA 1X9VA 3NXSA 1GW4A 4GKGA 1LTJC 1H8AA 1FAVA 1NKNA 2JJLA 5CCGD 1SQQK 3RL0C 3HRNA 3U1CA 4KHXA 2E42A 1FJKA 1EQ7A 5AVRB 5CCGC 1J1DB 1M1JB 5AVXB 2POHA 3T97A 5CCHC 1GTWA 3GHGB 1LTTC 3VMXA 5APQA 3KDPB 2YO2A 1OXZA 2YKQA 5AVVB 2IFNA 4C46A 3P8CE 5APSA 1FZCA 5APTA 3B5NA 1T2KC 3M06A 2Q9IA 1MZ9A 3R2PA 2WT7A 1JMMA 2W27A 1URQB 2W6AA 2NPSB 3NTNA 4JYCA 3RK3C 1GK4A 1DEBA 1FU1A 1NTKK 1QL2A 3V5BA 1MFZA 3VMZA 1RF0C 5AW7B 3HE4A 3PP5A 1GU5A 1FOSF 2Q5UA 3BRTB 3IR9A 3EQ2A 1IFNA 1LTJB 1JY2N 1LTIC 2R3CA 3II6A 1NAFA 3RL0B 4JF7A 4RESB 2HFED 4IFFA 3KYQA 2OARA 2Z5HA 1JY3N 2OYIA 3P32A 3VTPC 2KP8A 1A02F 1GL2A 1RE4C 3M0AA 3KQGA 3B5ND 2WSEH 4WY4D 2P67A 1YTZI 1G2CA 3B5NC 1FZAA 1WT6A 4EOTA 1X79B 1LTBC 4WY4C 3RK3B 3TSIA 2H7HA 1JO5A 1KQLA 5KJ7A 2HPCA 2OYHC 2FKWB 1J1EC 2HODB 3A7OA 1IFDA 1L4AD 5AW8B 3NFQA 3VYIA 3N7NA 1SFCA 3V2PA 1CW5A 1KILC 5APXA 3MTUE 1AFOA 1L4AC 1SQVK 1RE3C 3A3YB 2P1JA 3CL3D 3VP9A 4N78E 3H32A 2Q7CA 2FFDC 4XE5B 1GL2D 1IFMA 5BU8B 1W2EA 2PP6A 1IO4A 2FYUK 3V2QA 1RF1A 1HJBA 2C9LY 2A45G 1LWUA 2XDJA 1SQBK 3MGNA 1NWQA 1N73C 3I5CA 2KLVA 2N1TC 1NTZK 3U59A 2J59M 3LIEA 1Z56A 4DZOA 4DOJA 1LTAC 2A45H 2A45I 1HGVA 5AW2B 3B5NB 1IC2A 3HUSC 1N7SA 5KJ7D 2JEEA 3OAKA 3P7KA 2BASA 4C7RA 4WY4B 1CI6B 2MJZA 1JTHB 1OWAA 1YTZT 1MUUA 3VOPA 2OYHB 1KZUB 1LTSC 1J1EB 4N3YB 2P7JA 1JCCA 1GW3A 3O8ZA 1FBMA 1LT9C 4GT1A 1YYCA 2KYVA 1VDFA 1ZR2A 3BATA 1KILB 2Z5IA 1MV8A 1L4AB 1SQXK 3HTKA 5AW1B 1DH3A 2FFDB 3M0DC 1HGZA 5KTBA 1IJDB 1SLQA 1CSBA 2Q3IA 1M1JA 5CHXA 4I6MC 2YO3A 5AW6B 4I2LC 3GHGA 1N73B 1JY2P 1NH4A 5AVQB 2N1TB 2E43A 4M3LA 4HH2A 3U1AA 1N7SD 4B86A 1LTGC 3HD7A 4AYCA 1JY3P 3HE5B 5CJ0A 3HUSB 1AQ5A 5APWA 4N78D 1URQA 2NPSA 2CPBA 1T3JA 5AW9B 2YKOA 1SQPK 4EIJA 1WRGA 3TNUA 1HBWA 3MD0A 1KFNA 4N6JA 1FZCC 2YMYA 4W7YA 1LT9B 2ZXEB 3E1IA 1GD2E 5CJ4A 2FXMA 2WTYA 3V2NA 4WB4A 4IFMA 2FYZA 1GDTA 3NMDA 1RY3A 4Y99C 5AVTB 3M9HA 1LTJA 1M7LA 2LKMA 2GUSA 4HYTB 3CI9A 1FOSE 2M8RA 2I1KA 4LGDE 4AQRD 3V2RA 3P8MC 2GUVA 2WPQA 5CCGA 1JCDA 2KSJA 5CCHA 1DX7A 3HD7D 5AVZB 3CLQA 1NO4A 1ZN5A 2HLOA 2W6BA 1URQD 1SP4A 3HD7C 3M9BA 3A5TA 2O01H 2WITA 4XA4A 2OYIC 4WBAA 2C9NY 4C7NA 2R5BA 4AUWA 1VPCA 4ZKUA 1GL2C 1S9KE 1FDMA 2ZFCA 2HODA 5APUA 1FZCB 1RF0A 5AVYB 3VN0A 4I1LA 2WWWA 3OJAB 5AW5B 1N7LA 2PAJA 2QM8A 2IX7C 2N9BA 4OH8B 2WT7B 1FZGA 2YNYA 4Y99B 2VRSA 1T3UA 2R32A 2H8PD 5BVZA 5AVWB 5KJ7C 1SFCD 3HTKB 2C0XA 2WPRA 5CCHD 1G1JA 1NHLA 3A2AA 3HE4B 5APYA 1GZLA 1SFCC 1FZFA 3G3ZA 3M91A 1JNMA 1RE4A 3RK2D 3WMM0 1T2KD 2XV5A 2I1JA 1ZV8A 3EFGA 2YKPA 3HD7B 3RK2C 3RK3D 3B8EB 5BU5A 2XZRA 1HTLC 3V4QA 2OYIB 2XU6A 1X8YA 4WY4A 3VMYA 1CI6A 1JTHA 1RF1C 2QM7A 5AVSB 1GL2B 3L37A 1LWUC 3BVHA 1IFIA 1XTGB 2OYHA 3TNUB 1FZEA 2WSFH 4ZKPA 3L36A 5APVA 1G2CB 3SWYA 3IFMA 5KLVK 2C0WA 1E5WA 1FZBA 1HVVA 1N7SC 1N2DC 3OA7A 4IFDK 2IPPA 4W7ZA 5AVUB 1KILA 2M3BA 1L4AA 1RE3A 1LGHB 1SVFA 3UIAA 1JY2O 2XKMA 3V4WA 2HPCB 2FFDA 2WSCH 2XNXA 3LIDA 5CMZA 1NKZB 1JY3O 3MIWA 1S9KD 1SFCB 2IFMA 4O9BA 2HG5D 1N73A 2KB7P 1NOHA 2N1TA 3KPEA 4LC1A 2Z4EA 3L35A 3TK1A 1N86A 3H32B 5AW4B 1KFMA 1CZQA 1IK9A 3BASA 2GM4A 1PFIA 3HE5A 3M9QA 3RK2B 3HUSA 2O1JA 2J58A 4LLHA 1J1DC 1M1JC 3TYYA 4W80A 1RF1B 3VP8A 4C7NB 3SWFA 1H89A 1LWUB 3GHGC 1L0LK 2KOGA 1HUCA 3H6PA 1GU4A 2WPSA 1L0NK 1IFJA 2WZ7A 3L4FA 1HH0A 1NTMK 1HWTC 1JUNA 3N4XA 5AW0B 1FJPA 1KILD 2NPSD 2CPSA 2O1KA 1LT9A 1XTCC 1G1IA 1NU1K 1N7SB 1GK6A 1A02J 3BRVB 2HYNA 1URQC 3LW5H 2L5GB 2NPSC 4JYBA 1J2JB 3P8CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU C;  2FFD A;  1LT9 B;  2A45 H;  2H43 A;  1M1J C;  1RE3 C;  2HOD A;  3E1I A;  2XNX A;  2A45 I;  1RF1 B;  1FZF A;  1JY3 O;  2OYH A;  3H32 A;  1LWU B;  1RF0 A;  3GHG C;  1FZE A;  3HUS C;  1FZC B;  1JY3 P;  1M1J B;  1RE4 A;  1FZC C;  2HLO A;  2FFD C;  1JY3 N;  2OYI A;  3GHG B;  1FZG A;  3HUS B;  1LTJ A;  1N73 A;  1W2E A;  2HPC A;  2OYH C;  1RF0 C;  1FZB A;  2FFD B;  1RE4 C;  1LT9 A;  1T3U A;  2HOD B;  2Z4E A;  1N86 A;  2OYI C;  1RF1 A;  3H32 B;  2OYH B;  1LTJ C;  2A45 G;  1LWU A;  1FZC A;  1N73 C;  1M1J A;  1RE3 A;  2OYI B;  1JY2 O;  2Q9I A;  1LT9 C;  3BVH A;  1LTJ B;  3GHG A;  1N73 B;  1JY2 P;  3HUS A;  2HPC B;  1RF1 C;  1JY2 N;  1FZA A; 
#chains in the Genus database with same CATH topology
 3BCC E;  4WWI A;  2N9Y B;  1YIT P;  2D2C B;  2AEF A;  4PD4 E;  1OX3 A;  1H88 A;  1JOC A;  3NXS A;  1LTJ C;  2FYU G;  1FAV A;  5E79 E;  2JJL A;  3RL0 C;  2FXO A;  3L72 J;  2Y9Y A;  1SQQ G;  4KHX A;  1FJK A;  3AEF C;  2POH A;  1IFP A;  5CCH C;  3AE1 C;  3GHG B;  1BCC J;  1KYO D;  3KDP B;  1SQB D;  2YO2 A;  2YKQ A;  4C46 A;  5APS A;  5APT A;  1T2K C;  3MZW B;  3F89 A;  3R2P A;  3FX0 A;  1ZOY C;  3CX5 E;  1JMM A;  2Q1K A;  2W6A A;  1GK4 A;  1K8A Q;  2LXB A;  1M90 Q;  1MFZ A;  1L0L E;  3L75 E;  1NTK G;  2IDB A;  2CK3 H;  4RES B;  3CXH E;  2FYU J;  4IFF A;  2QJY C;  4U3F D;  3H1L G;  1DIP A;  2WSE H;  3GW6 A;  1G2C A;  3B5N C;  1FZA A;  1WT6 A;  5KLV D;  4WY4 C;  1YIJ P;  1DD4 A;  3AE8 C;  1KQL A;  2FKW B;  2HOD B;  3VYI A;  5K5G B;  4OGQ B;  1L4A C;  1RE3 C;  3A3Y B;  2JKV A;  4N78 E;  3WU2 H;  2R3S A;  4XE5 B;  2M3E A;  1K9M Q;  3O6Q A;  2FYU K;  4EYY Q;  1JEK A;  1PP9 J;  1QLE D;  2KLV A;  2N1T C;  3U59 A;  2J59 M;  4PV1 B;  1SQB G;  1L0N D;  4HB1 A;  3AE4 C;  2WSC J;  1HGV A;  1IC2 A;  4IOI H;  1K73 Q;  1P84 D;  3P7K A;  4C7R A;  3TDK A;  1MUU A;  2OYH B;  1KZU B;  1LTS C;  1J1E B;  2BCC E;  1HF9 A;  1AQT A;  1VDF A;  1JM0 A;  1ZR2 A;  1EZV I;  1KIL B;  1EXI A;  2QA4 P;  2KNC B;  1S5L E;  1EDL A;  1LP1 A;  5AW1 B;  2E76 D;  1DH3 A;  1FDI A;  5KTB A;  1SLQ A;  3TGU D;  1CSB A;  2Q3I A;  1BSH A;  4U3F G;  1S5L X;  2IBZ E;  1PGQ A;  1X0T A;  3H25 A;  1JY3 P;  1K05 A;  3HUS B;  4GOF A;  5APW A;  5KLV G;  5M1B A;  3GLM A;  1WRG A;  5KAI E;  1BE3 D;  1SQP G;  1FZC C;  1Y47 A;  1LT9 B;  2ZXE B;  2FXM A;  5CBO A;  1GDT A;  2YXQ B;  3NMD A;  3RK3 E;  3FWL A;  1LTJ A;  1LT1 A;  2LKM A;  1AJY A;  2QE7 H;  2YIU B;  1M1K Q;  1KQS O;  5CCH A;  4YXD C;  5AVZ B;  1ZN5 A;  2NZ2 A;  2BEZ F;  4HJG H;  3A5T A;  3HD7 C;  1VQ9 P;  2IZ0 A;  2WIT A;  4XA4 A;  5KLI B;  2OYI C;  1OFC X;  1KQG B;  4AUW A;  5KLV J;  4DCK A;  3CXH H;  4I1L A;  3H1K G;  3CXH I;  2QM8 A;  2N9B A;  2KZJ A;  2H8P D;  5BVZ A;  5KJ7 C;  1BDC A;  4NPD A;  3HTK B;  2WPR A;  5CCH D;  1SQP E;  3A2A A;  4UB8 E;  1WMK A;  3G3Z A;  3M91 A;  3RK2 D;  1T2K D;  2XV5 A;  2BEQ D;  3B8E B;  4H0L D;  5BU5 A;  2XU6 A;  1KD1 Q;  3CCM P;  1X8Y A;  4WY4 A;  1L0N J;  1JTH A;  3AE5 C;  2FYN B;  1EZV D;  1BE3 G;  5APV A;  1G2C B;  3IFM A;  4I7Z C;  2P10 A;  5KLV K;  1SQV E;  1FZB A;  1VQP P;  2IPP A;  5AVU B;  3CCE P;  1L4A A;  1RE3 A;  1D7M A;  3H1J D;  4L76 A;  1NVO A;  3H1I E;  2KLU A;  2WSC H;  5CMZ A;  1NKZ B;  3MIW A;  2A06 E;  1NTZ E;  2KIK A;  4H13 B;  4BWN A;  2N1T A;  3TGU J;  2Z4E A;  3L35 A;  3TK1 A;  3L73 D;  1CZQ A;  2IZ1 A;  3BAS A;  3HE5 A;  3CPW O;  2OGU A;  3G71 P;  1BGY D;  3O6Q B;  1M1J C;  3L72 D;  4C7N B;  1VQO P;  1L0N K;  2WZ7 A;  1JUN A;  2ZYA A;  1BE3 J;  3CC2 P;  3BRV B;  1URQ C;  1OW8 A;  2L5G B;  2NPS C;  4UB6 H;  1JMB A;  1ZLL A;  4GIF A;  3EWK A;  4RO0 A;  2QG4 A;  5C39 A;  2N1T D;  3ABV C;  1T8Z A;  2WSE J;  4D6T D;  1H8A A;  2QJP B;  1VQ7 P;  3PLN A;  1NKN A;  5CCG D;  1BSN A;  1UIX A;  2E42 A;  1EQ7 A;  4K35 A;  3CCJ P;  5APQ A;  3ZDM A;  2WPV B;  3CXH D;  1M8O B;  1OXZ A;  3PHL A;  1EZV G;  1FZC A;  1FE6 A;  1MZ9 A;  2WT7 A;  2W27 A;  4NPF X;  4L74 A;  2WSS H;  3H1J G;  3L74 E;  4OGQ D;  2Y0D A;  3K5B A;  2L91 A;  4U7J A;  5AW7 B;  3HE4 A;  3PP5 A;  4TT3 H;  1BDD A;  3I55 P;  1NTM E;  3EQ2 A;  1VQK P;  3D6Z A;  1LTJ B;  5B66 E;  3II6 A;  4H44 C;  3RL0 B;  1PPJ G;  3CC4 P;  3L73 G;  3KYQ A;  2OYI A;  2ZAE B;  1VQM P;  1BGY G;  3CWB E;  2KP8 A;  1A02 F;  3L72 G;  1RE4 C;  5TJH A;  1KC8 Q;  1KV4 A;  2P67 A;  1YTZ I;  3D71 A;  1YI2 P;  1BCC G;  4EOT A;  1LTB C;  4UB8 H;  2K37 A;  2H88 C;  2LXC B;  4NPE A;  4H0L B;  5KJ7 A;  2HPC A;  3A7O A;  2RMZ A;  1YJ9 P;  3WUV A;  3H1J J;  5AW8 B;  1SQX J;  3S1K A;  3V2P A;  3MTU E;  1AFO A;  1RQU A;  2P1J A;  3L70 E;  4XFJ A;  1P84 H;  1KB9 E;  3H32 A;  4D6T G;  1P84 I;  2Q7C A;  2B88 A;  2QJY B;  2PP6 A;  3L73 J;  1HJB A;  2C9L Y;  3CD6 P;  1BGY J;  3GMA A;  3AEC C;  2A45 H;  2A45 I;  3B5N B;  5KJ7 D;  3FXD A;  1NU1 D;  4WY4 B;  1JTH B;  3VOP A;  3L71 E;  1Y9B A;  3O8Z A;  2KYV A;  1L2P A;  3BAT A;  4ZMD A;  1L4A B;  1SQX K;  3HTK A;  2IYP A;  3USS A;  3JCU E;  1RHZ B;  4D6T J;  1RQV A;  1M1J A;  2PGD A;  3LW5 J;  1JY2 P;  5AVQ B;  2N1T B;  4M3L A;  1GMJ A;  1PP9 G;  4WVZ A;  3HE5 B;  3A0H E;  4JQ0 D;  5CJ0 A;  3RBZ A;  3KXD A;  2ZT9 C;  5GTI H;  1URQ A;  3RGU A;  4L73 A;  2NPS A;  2CPB A;  1T3J A;  3KZI E;  5AW9 B;  1VF5 C;  1HBW A;  1Q81 Q;  2FYU E;  3MD0 A;  1QVF O;  1KFN A;  4N6J A;  1OMI A;  5CJ4 A;  4L75 A;  1SQQ E;  3TF5 A;  1RY3 A;  1PIX A;  1M7L A;  2JDI H;  5CBN A;  2W8Z A;  1KQF B;  4HYT B;  2I1K A;  4LGD E;  4AQR D;  1ZRT E;  3V2R A;  3P8M C;  1M57 D;  2WPQ A;  3G4S P;  2IYO A;  1DX7 A;  2Y9Z A;  1NO4 A;  4HKZ H;  1URQ D;  1VQ8 P;  3SFE C;  2HR3 A;  4PJ0 H;  2RN0 A;  1NAY A;  4C7N A;  2R5B A;  1NTK E;  1NU1 G;  4ZKU A;  1S9K E;  1FDM A;  2M0B A;  4CPG A;  3FGA D;  2ZVN B;  3CCL P;  1QEX A;  5APU A;  1FZC B;  2IX7 C;  2WT7 B;  2YNY A;  1T3U A;  3CCR P;  5AVW B;  4H13 D;  3H1L E;  2K9J A;  2AXT E;  2C0X A;  3E1R A;  2NRG A;  1NJI Q;  3H1H D;  5TIS H;  3HE4 B;  1GZL A;  1SFC C;  1FZF A;  3H1I D;  1U7J A;  1JNM A;  1RE4 A;  3B4S A;  1Q2N A;  5B5E H;  1NTZ D;  4IL6 E;  2I1J A;  1ZV8 A;  3EFG A;  3HD7 B;  5H2F E;  2XZR A;  1HTL C;  2OYI B;  4IL6 X;  1ZME C;  3TNU B;  1NU1 J;  4ZKP A;  4PD4 H;  1E5W A;  1MFT A;  4PD4 I;  1HVV A;  4W7Z A;  3UIA A;  2XKM A;  5E79 H;  2HPC B;  1KYO E;  1IK7 A;  1SQB E;  3IN6 A;  2IFM A;  4O9B A;  3KPE A;  4PV1 C;  3A0B E;  3H32 B;  3M9Q A;  2O1J A;  2ZVO B;  1J1D C;  3CX5 H;  3CX5 I;  2WMM A;  1HUC A;  1GU4 A;  3L4F A;  1KOR A;  3Q1M A;  1L0N G;  3N4X A;  4OWF A;  5GTH E;  4I7Z B;  1NU1 K;  2AEJ A;  1GK6 A;  2HYN A;  3Q5S A;  3LW5 H;  3CC7 P;  4JYB A;  1USD A;  4BXL A;  1IZN B;  2H43 A;  4U3F E;  3H1H G;  3CCQ P;  3MP7 B;  3RL0 D;  1ZR4 A;  3C9I A;  3JC2 2;  4A7P A;  3L74 D;  1GW4 A;  5KLV E;  3PJS K;  3HRN A;  3TGU G;  5DJU B;  1M1J B;  4RKU J;  4DJG A;  5AVX B;  3T97 A;  1GTW A;  3VMX A;  4EDF A;  5AVV B;  2QIW A;  2AXC A;  2V4H A;  1KN7 A;  3B5N A;  3M06 A;  2YMK A;  2PRR A;  1AA0 A;  1URQ B;  2NPS B;  4JYC A;  3WUT A;  3RK3 C;  1ZXG A;  1DEB A;  2QSI A;  1QL2 A;  3V5B A;  1SQV J;  1FOS F;  3BRT B;  1PV3 A;  3R4Y A;  3H1H J;  1SQX D;  2RH0 A;  2R3C A;  2ZT9 D;  1NAF A;  3H1I J;  4JF7 A;  1JY3 N;  3BCC D;  1NTZ J;  1VF5 D;  3EFF K;  3H1K E;  2KSE A;  1YQ4 C;  4PD4 D;  3B5N D;  2J5U A;  4WY4 D;  1KTM A;  1TU3 F;  3TSI A;  2MKV A;  2G8Y A;  4KT0 J;  1S5L H;  1L4A D;  3QWO C;  1VQ5 P;  2PFX A;  3N7N A;  1SFC A;  3PRJ A;  1S1C X;  1CW5 A;  5APX A;  3L71 D;  1M56 D;  2FBW C;  1SQV K;  2IBZ I;  1USE A;  4H44 B;  2K9J B;  4MN4 C;  3CX5 D;  2FFD C;  1IFM A;  2W6J H;  1W2E A;  1BE3 E;  1FC2 C;  1H0T A;  1DEE G;  3V2Q A;  1N73 C;  2XDJ A;  3MGN A;  1NWQ A;  3I5C A;  1NTZ K;  1Z56 A;  1L0L D;  3L75 D;  4DZO A;  5KAI H;  2QJK C;  4DOJ A;  2E74 C;  3B71 A;  3OAK A;  1VQ4 P;  1QGK B;  5KAF E;  4N3Y B;  2P7J A;  3A0B H;  3FXE A;  4GT1 A;  1NGM B;  1YYC A;  1K04 A;  2Z5I A;  1MV8 A;  2B87 A;  4ASV A;  2JO1 A;  3MUD C;  1SQX G;  4GDO A;  3L74 J;  3M0D C;  1SQQ D;  2JWA A;  1Q90 D;  3BCC G;  2E76 C;  1OW6 A;  4I6M C;  2YO3 A;  5AW6 B;  1Q82 Q;  1NH4 A;  3WU2 E;  2E43 A;  4HH2 A;  3U1A A;  1LTG C;  2V7Q H;  3HD7 A;  1SS1 A;  3AEA C;  3Q2Y A;  2M5A A;  3AE3 C;  1OIP A;  4N78 D;  3W67 A;  2YKO A;  3CWB J;  1KMI Z;  3TNU A;  3CCV P;  2YMY A;  1ZW0 A;  1NTK D;  3E1I A;  4R4M A;  2WTY A;  3V2N A;  4IFM A;  1HJ0 A;  4Y99 C;  5AVT B;  3AED C;  2QJP C;  2GUS A;  3CI9 A;  2M8R A;  3I56 P;  2GUV A;  1EZV E;  5L8R J;  2KSJ A;  3H1L D;  3HD7 D;  2JWD A;  2BCC D;  3BCC J;  2HLO A;  3L75 G;  2W6B A;  3M9B A;  3H1J E;  2FXP A;  2O01 H;  2ZT9 B;  1MKM A;  2RKL A;  2ITA A;  3T97 B;  1GL2 C;  2G3A A;  3MHV A;  1OVU A;  1VF5 B;  2K88 A;  2ZFC A;  1PGP A;  2E75 C;  2IBZ D;  3VN0 A;  1PPJ E;  1R5S A;  5AW5 B;  2WWW A;  3OJA B;  3L73 E;  2Q6Q A;  3Q5P A;  2R32 A;  1BGY E;  3L72 E;  2Q3E A;  3L71 J;  1G1J A;  1NHL A;  3OW2 O;  2WVR A;  3IF4 A;  4YXW H;  1BCC E;  3Q5R A;  3WMM 0;  4GOE A;  3RK2 C;  3RK3 D;  1L0L J;  3L75 J;  1CI6 A;  4RJT A;  1RF1 C;  5AVS B;  1Q86 Q;  1LWU C;  3SFD C;  4H0L C;  2WSF H;  3SWY A;  4D6T E;  2C0W A;  1N7S C;  3GF7 A;  4BRY A;  4IFD K;  5EFW B;  5KKZ C;  2M3B A;  1SVF A;  1LGH B;  1QX8 A;  3V4W A;  2ZXX A;  2D2C C;  2FFD A;  3D6Y A;  2O01 N;  3LID A;  1JY3 O;  1SFC B;  1SQQ J;  1N73 A;  2KB7 P;  1EXJ A;  5KAF H;  1N86 A;  1OW7 A;  5AW4 B;  2BCC G;  1KFM A;  2GM4 A;  1IK9 A;  1PFI A;  4EI2 A;  3AE6 C;  2J58 A;  1QVG O;  4LLH A;  1H0T B;  3D70 A;  2KK7 A;  2JR8 A;  2OTL P;  3SWF A;  1H89 A;  3GHG C;  1L0L K;  2KOG A;  3ITK A;  3F5H A;  2WPS A;  1IFJ A;  1SQP D;  3PTZ A;  1VQN P;  1AVO A;  2NPS D;  2O1K A;  2IBZ G;  1NTK J;  3MUD A;  4TLF A;  3AE9 C;  5B66 H;  3M0D A;  2P2U A;  2QVA A;  2WQY C;  1PP9 E;  5AW3 B;  2R5D A;  1QL1 A;  1X9V A;  2E74 D;  4GKG A;  4GOD A;  2B87 B;  4DT0 A;  1SQV D;  1SQQ K;  1U57 A;  2K3R A;  3H1L J;  3U1C A;  3G9R A;  2Y0C A;  2BCC J;  5AVR B;  5CCG C;  1J1D B;  1KIL E;  2KZI A;  1LTT C;  3SWK A;  2A06 D;  1E79 H;  2IFN A;  3P8C E;  2KS1 A;  3H1K D;  4OVN F;  3C8V A;  2Q9I A;  2M5A B;  4QMA A;  3NTN A;  1FU1 A;  1KB9 H;  1NTK K;  1KB9 I;  3VMZ A;  1RF0 C;  1R5L A;  1GU5 A;  4H44 D;  2Q5U A;  4OGQ C;  1S4X A;  3IR9 A;  1IFN A;  4UB6 E;  3CMA P;  1JY2 N;  1LTI C;  1NU1 E;  3S9O A;  2HFE D;  2OAR A;  2Z5H A;  1SQB J;  1EDK A;  1LNQ A;  3P32 A;  3VTP C;  1GL2 A;  2W83 C;  3FWN A;  3M0A A;  3KQG A;  1PGJ A;  3QH9 A;  2I8D A;  3G6E P;  2DW3 A;  1VQL P;  1X79 B;  2E5Y A;  2O3J A;  1VL2 A;  2R44 A;  3RK3 B;  1ZP0 C;  2H7H A;  3CME P;  1JO5 A;  3W68 A;  2OYH C;  1J1E C;  1IFD A;  1YBK A;  3NFQ A;  2AEM A;  3JCU H;  1KIL C;  1PZQ A;  3SSU A;  3CL3 D;  3VP9 A;  1DD3 A;  2V7Q J;  1SQV G;  4U3F J;  1GL2 D;  5BU8 B;  2OQQ A;  3A0H H;  1IO4 A;  2E5T A;  1RF1 A;  3H1I G;  2A45 G;  1LWU A;  1SQB K;  2E75 D;  3KZI H;  3LIE A;  2JP3 A;  3IAO A;  1S72 P;  2A06 G;  1NTZ G;  1LTA C;  3AE7 C;  2B9B A;  1NTM D;  1FS0 E;  5AW2 B;  3HUS C;  1N7S A;  1SQP J;  2JEE A;  2BAS A;  1CI6 B;  2MJZ A;  1OWA A;  1YTZ T;  3JSV C;  1JCC A;  1GW3 A;  1FBM A;  1EDI A;  1LT9 C;  3CWB D;  1NYH A;  4BRY B;  2YXR B;  4YPC A;  1Q7Y Q;  5DJT B;  4YTP C;  2KUB A;  2YIU C;  2FFD B;  1HGZ A;  1IJD B;  2O01 J;  1L0N E;  1X22 A;  1YHQ P;  5CHX A;  4I2L C;  3GHG A;  1N73 B;  1VQ6 P;  1P84 E;  2UWJ E;  1N7S D;  4B86 A;  2QJK B;  2P58 A;  4AYC A;  2E74 B;  1AQ5 A;  5KLI C;  3L70 D;  1KB9 D;  2QRX A;  2D2C D;  3H1H E;  1OVV A;  1SQP K;  3H1K J;  4EIJ A;  4JPZ B;  3GG2 A;  4Y28 J;  3RL0 g;  3AEE C;  2AXT H;  4JBZ A;  4W7Y A;  3KHU A;  1GD2 E;  4WB4 A;  1YQ3 C;  2FYZ A;  1U7M A;  3TGU E;  3M9H A;  2K1A A;  4R4L A;  1PPJ D;  1FOS E;  4IL6 H;  3VMA A;  1W5C E;  5H2F H;  3AE2 C;  5CCG A;  3RBX A;  2E76 B;  1JB0 J;  1JCD A;  3L74 G;  4Z1M H;  3CLQ A;  2WSF J;  3CCS P;  2SPZ A;  1SP4 A;  1BCC D;  1YJN P;  1PGO A;  1NTM G;  4WBA A;  2C9N Y;  1RH5 B;  1VPC A;  1LJ2 A;  2FYN C;  1S2E A;  2HOD A;  2KI7 B;  1RF0 A;  2KS1 B;  4KJM A;  1KYO H;  5AVY B;  5GTI E;  1OVR A;  3CWB G;  1KYO I;  1N7L A;  2PAJ A;  4OH8 B;  1FZG A;  2OTJ P;  2K9Y A;  4Y99 B;  2VRS A;  1T6A A;  2LR2 A;  1SFC D;  1LP1 B;  1OZH A;  2OYO A;  5APY A;  4H13 C;  2GA1 A;  3WUU A;  2QEX P;  2FYU D;  3C1L A;  2H89 C;  2ZYG A;  3V6I A;  2YKP A;  2ZYD A;  5GTH H;  1Y8A A;  3AEB C;  3V4Q A;  1YJW P;  3VMY A;  3L70 G;  2QM7 A;  1GL2 B;  1NTM J;  3L37 A;  3CCU P;  3BVH A;  1IFI A;  1ZRT D;  1XTG B;  2B89 A;  2OYH A;  1FZE A;  3L36 A;  3E7K A;  1N8R Q;  2E75 B;  4PJ0 E;  1R8E A;  1UII A;  1N2D C;  3OA7 A;  1KIL A;  1JY2 O;  2KNC A;  4ZNC A;  2OTK E;  2Y0E A;  2XNX A;  1AV1 A;  1S9K D;  4PV1 D;  4ASW A;  3Q3D A;  1PL5 A;  3S4R A;  2HG5 D;  3L71 G;  1NOH A;  3PH0 A;  4LC1 A;  4K3A A;  2KXP B;  2W90 A;  1PP9 D;  5TIS E;  3RK2 B;  1AVY A;  3HUS A;  2XND H;  2ZJS E;  3TYY A;  4W80 A;  1RF1 B;  3VP8 A;  5B5E E;  1LWU B;  3H6P A;  1EC5 A;  2FY8 A;  1L0L G;  3L70 J;  1HH0 A;  1NTM K;  3AEG C;  1W2B O;  1HWT C;  5AW0 B;  1FJP A;  1KIL D;  2CPS A;  1LT9 A;  1XTC C;  1SQX E;  1G1I A;  1N7S B;  1A02 J;  1FDO A;  5KKZ B;  1S3J A;  3GF3 A;  1J2J B;  1EDJ A;  3P8C D; 
#chains in the Genus database with same CATH homology
 2H43 A;  3MUD A;  1ZLL A;  4GIF A;  3M0D A;  2P2U A;  2N1T D;  5AW3 B;  2R5D A;  3RL0 D;  1QL1 A;  1ZR4 A;  1H88 A;  3C9I A;  1T8Z A;  1JOC A;  1X9V A;  3NXS A;  1GW4 A;  4GKG A;  1LTJ C;  1H8A A;  1FAV A;  1NKN A;  2JJL A;  5CCG D;  1SQQ K;  3RL0 C;  3HRN A;  3U1C A;  4KHX A;  2E42 A;  1FJK A;  1EQ7 A;  5AVR B;  5CCG C;  1J1D B;  1M1J B;  5AVX B;  2POH A;  3T97 A;  5CCH C;  1GTW A;  3GHG B;  1LTT C;  3VMX A;  5APQ A;  3KDP B;  2YO2 A;  1OXZ A;  2YKQ A;  5AVV B;  2IFN A;  4C46 A;  3P8C E;  5APS A;  1FZC A;  5APT A;  3B5N A;  1T2K C;  3M06 A;  2Q9I A;  1MZ9 A;  3R2P A;  2WT7 A;  1JMM A;  2W27 A;  1URQ B;  2W6A A;  2NPS B;  3NTN A;  4JYC A;  3RK3 C;  1GK4 A;  1DEB A;  1FU1 A;  1NTK K;  1QL2 A;  3V5B A;  1MFZ A;  3VMZ A;  1RF0 C;  5AW7 B;  3HE4 A;  3PP5 A;  1GU5 A;  1FOS F;  2Q5U A;  3BRT B;  3IR9 A;  3EQ2 A;  1IFN A;  1LTJ B;  1JY2 N;  1LTI C;  2R3C A;  3II6 A;  1NAF A;  3RL0 B;  4JF7 A;  4RES B;  2HFE D;  4IFF A;  3KYQ A;  2OAR A;  2Z5H A;  1JY3 N;  2OYI A;  3P32 A;  3VTP C;  2KP8 A;  1A02 F;  1GL2 A;  1RE4 C;  3M0A A;  3KQG A;  3B5N D;  2WSE H;  4WY4 D;  2P67 A;  1YTZ I;  1G2C A;  3B5N C;  1FZA A;  1WT6 A;  4EOT A;  1X79 B;  1LTB C;  4WY4 C;  3RK3 B;  3TSI A;  2H7H A;  1JO5 A;  1KQL A;  5KJ7 A;  2HPC A;  2OYH C;  2FKW B;  1J1E C;  2HOD B;  3A7O A;  1IFD A;  1L4A D;  5AW8 B;  3NFQ A;  3VYI A;  3N7N A;  1SFC A;  3V2P A;  1CW5 A;  1KIL C;  5APX A;  3MTU E;  1AFO A;  1L4A C;  1SQV K;  1RE3 C;  3A3Y B;  2P1J A;  3CL3 D;  3VP9 A;  4N78 E;  3H32 A;  2Q7C A;  2FFD C;  4XE5 B;  1GL2 D;  1IFM A;  5BU8 B;  1W2E A;  2PP6 A;  1IO4 A;  2FYU K;  3V2Q A;  1RF1 A;  1HJB A;  2C9L Y;  2A45 G;  1LWU A;  2XDJ A;  1SQB K;  3MGN A;  1NWQ A;  1N73 C;  3I5C A;  2KLV A;  2N1T C;  1NTZ K;  3U59 A;  2J59 M;  3LIE A;  1Z56 A;  4DZO A;  4DOJ A;  1LTA C;  2A45 H;  2A45 I;  1HGV A;  5AW2 B;  3B5N B;  1IC2 A;  3HUS C;  1N7S A;  5KJ7 D;  2JEE A;  3OAK A;  3P7K A;  2BAS A;  4C7R A;  4WY4 B;  1CI6 B;  2MJZ A;  1JTH B;  1OWA A;  1YTZ T;  1MUU A;  3VOP A;  2OYH B;  1KZU B;  1LTS C;  1J1E B;  4N3Y B;  2P7J A;  1JCC A;  1GW3 A;  3O8Z A;  1FBM A;  1LT9 C;  4GT1 A;  1YYC A;  2KYV A;  1VDF A;  1ZR2 A;  3BAT A;  1KIL B;  2Z5I A;  1MV8 A;  1L4A B;  1SQX K;  3HTK A;  5AW1 B;  1DH3 A;  2FFD B;  3M0D C;  1HGZ A;  5KTB A;  1IJD B;  1SLQ A;  1CSB A;  2Q3I A;  1M1J A;  5CHX A;  4I6M C;  2YO3 A;  5AW6 B;  4I2L C;  3GHG A;  1N73 B;  1JY2 P;  1NH4 A;  5AVQ B;  2N1T B;  2E43 A;  4M3L A;  4HH2 A;  3U1A A;  1N7S D;  4B86 A;  1LTG C;  3HD7 A;  4AYC A;  1JY3 P;  3HE5 B;  5CJ0 A;  3HUS B;  1AQ5 A;  5APW A;  4N78 D;  1URQ A;  2NPS A;  2CPB A;  1T3J A;  5AW9 B;  2YKO A;  1SQP K;  4EIJ A;  1WRG A;  3TNU A;  1HBW A;  3MD0 A;  1KFN A;  4N6J A;  1FZC C;  2YMY A;  4W7Y A;  1LT9 B;  2ZXE B;  3E1I A;  1GD2 E;  5CJ4 A;  2FXM A;  2WTY A;  3V2N A;  4WB4 A;  4IFM A;  2FYZ A;  1GDT A;  3NMD A;  1RY3 A;  4Y99 C;  5AVT B;  3M9H A;  1LTJ A;  1M7L A;  2LKM A;  2GUS A;  4HYT B;  3CI9 A;  1FOS E;  2M8R A;  2I1K A;  4LGD E;  4AQR D;  3V2R A;  3P8M C;  2GUV A;  2WPQ A;  5CCG A;  1JCD A;  2KSJ A;  5CCH A;  1DX7 A;  3HD7 D;  5AVZ B;  3CLQ A;  1NO4 A;  1ZN5 A;  2HLO A;  2W6B A;  1URQ D;  1SP4 A;  3HD7 C;  3M9B A;  3A5T A;  2O01 H;  2WIT A;  4XA4 A;  2OYI C;  4WBA A;  2C9N Y;  4C7N A;  2R5B A;  4AUW A;  1VPC A;  4ZKU A;  1GL2 C;  1S9K E;  1FDM A;  2ZFC A;  2HOD A;  5APU A;  1FZC B;  1RF0 A;  5AVY B;  3VN0 A;  4I1L A;  2WWW A;  3OJA B;  5AW5 B;  1N7L A;  2PAJ A;  2QM8 A;  2IX7 C;  2N9B A;  4OH8 B;  2WT7 B;  1FZG A;  2YNY A;  4Y99 B;  2VRS A;  1T3U A;  2R32 A;  2H8P D;  5BVZ A;  5AVW B;  5KJ7 C;  1SFC D;  3HTK B;  2C0X A;  2WPR A;  5CCH D;  1G1J A;  1NHL A;  3A2A A;  3HE4 B;  5APY A;  1GZL A;  1SFC C;  1FZF A;  3G3Z A;  3M91 A;  1JNM A;  1RE4 A;  3RK2 D;  3WMM 0;  1T2K D;  2XV5 A;  2I1J A;  1ZV8 A;  3EFG A;  2YKP A;  3HD7 B;  3RK2 C;  3RK3 D;  3B8E B;  5BU5 A;  2XZR A;  1HTL C;  3V4Q A;  2OYI B;  2XU6 A;  1X8Y A;  4WY4 A;  3VMY A;  1CI6 A;  1JTH A;  1RF1 C;  2QM7 A;  5AVS B;  1GL2 B;  3L37 A;  1LWU C;  3BVH A;  1IFI A;  1XTG B;  2OYH A;  3TNU B;  1FZE A;  2WSF H;  4ZKP A;  3L36 A;  5APV A;  1G2C B;  3SWY A;  3IFM A;  5KLV K;  2C0W A;  1E5W A;  1FZB A;  1HVV A;  1N7S C;  1N2D C;  3OA7 A;  4IFD K;  2IPP A;  4W7Z A;  5AVU B;  1KIL A;  2M3B A;  1L4A A;  1RE3 A;  1LGH B;  1SVF A;  3UIA A;  1JY2 O;  2XKM A;  3V4W A;  2HPC B;  2FFD A;  2WSC H;  2XNX A;  3LID A;  5CMZ A;  1NKZ B;  1JY3 O;  3MIW A;  1S9K D;  1SFC B;  2IFM A;  4O9B A;  2HG5 D;  1N73 A;  2KB7 P;  1NOH A;  2N1T A;  3KPE A;  4LC1 A;  2Z4E A;  3L35 A;  3TK1 A;  1N86 A;  3H32 B;  5AW4 B;  1KFM A;  1CZQ A;  1IK9 A;  3BAS A;  2GM4 A;  1PFI A;  3HE5 A;  3M9Q A;  3RK2 B;  3HUS A;  2O1J A;  2J58 A;  4LLH A;  1J1D C;  1M1J C;  3TYY A;  4W80 A;  1RF1 B;  3VP8 A;  4C7N B;  3SWF A;  1H89 A;  1LWU B;  3GHG C;  1L0L K;  2KOG A;  1HUC A;  3H6P A;  1GU4 A;  2WPS A;  1L0N K;  1IFJ A;  2WZ7 A;  3L4F A;  1HH0 A;  1NTM K;  1HWT C;  1JUN A;  3N4X A;  5AW0 B;  1FJP A;  1KIL D;  2NPS D;  2CPS A;  2O1K A;  1LT9 A;  1XTC C;  1G1I A;  1NU1 K;  1N7S B;  1GK6 A;  1A02 J;  3BRV B;  2HYN A;  1URQ C;  3LW5 H;  2L5G B;  2NPS C;  4JYB A;  1J2J B;  3P8C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...