1FZEA

Crystal structure of fragment double-d from human fibrin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
DLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRINOGEN
total genus 30
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzeA00
2XNXA 1RE3A 3E1IA 3H32B 2A45H 3HUSC 1LT9B 2Q9IA 2FFDB 1RF1B 1N73C 2OYHB 2A45G 1N73A 2FFDA 1RF1C 1N73B 1N86A 1RE3C 2OYIB 1FZBA 3HUSA 1M1JC 1RF0C 2OYIA 1M1JA 3GHGA 1T3UA 1LTJA 1FZCC 1LWUA 3GHGB 1FZCB 3GHGC 1JY3P 2A45I 1FZCA 1JY2O 1JY3N 3BVHA 1LT9C 2HPCB 1RF1A 2H43A 1RE4C 2HLOA 2OYHA 3H32A 1JY2P 1RE4A 3HUSB 2Z4EA 2FFDC 1W2EA 2OYHC 1LTJC 1FZFA 1RF0A 2OYIC 1LTJB 1JY3O 1M1JB 1FZGA 1LWUC 2HODA 1LWUB 2HODB 2HPCA 1JY2N 1FZAA 1FZEA 1LT9A
chains in the Genus database with same CATH superfamily
1SVFA 3P32A 3H32B 3RK3D 1M8OB 1PGJA 1QL1A 3S1KA 2H89C 3H1KE 2D2CD 3KPEA 1KYOD 3BASA 3B8EB 2KS1B 2N1TA 2Y0EA 1L0NJ 1KILA 2GA1A 2XU6A 2ZT9D 1Q86Q 1KILC 1LTGC 1BE3G 4WY4A 3U59A 2JJLA 3BRVB 2W83C 4D6TJ 3A7OA 4D6TE 2RMZA 2IFNA 1MV8A 2XV5A 1JMMA 1N2DC 1A02F 2W90A 1OVUA 3R4YA 1L0NE 4H0LC 3TF5A 5DJTB 2KLUA 4M3LA 1KQFB 3CX5H 3GF3A 3H1KJ 2ZT9B 2QE7H 2FFDC 2QJPC 1DD4A 1KILE 3TGUG 1BGYG 2BASA 3CCMP 1EXIA 4OGQB 4R4MA 1BGYJ 1RF0A 3CPWO 2Q9IA 2IBZE 3I55P 2QSIA 4EDFA 4IL6E 2NZ2A 4PJ0E 3RK3E 1GMJA 1CI6A 1GW3A 2AEMA 2BEQD 2YXQB 1S5LH 2FXMA 2WVRA 3JCUE 3V2NA 3H1LG 2A45H 1VQ9P 1RF1B 3KZIH 3PJSK 4I7ZC 2KSJA 2ZVOB 2CPSA 3NXSA 5EFWB 2QM8A 3AEAC 1NTKE 1RQUA 3USSA 1JO5A 3CC7P 2YXRB 1NTMJ 2IX7C 3CXHE 1KYOH 3AEFC 5APWA 3AE7C 2KSEA 5APYA 3H1HJ 1JY2O 1KZUB 2FKWB 2WMMA 3TDKA 1VL2A 1PGQA 5KJ7D 3W67A 5BVZA 1NTKD 3RK2C 1KYOI 2PFXA 5APVA 1PP9E 1SQXE 3ABVC 3C8VA 2H88C 2M3EA 1Y9BA 2KNCB 1URQD 1G1IA 1M56D 1DD3A 1LTIC 1SQPE 2B87B 2KNCA 3MP7B 5AW6B 1NHLA 3G4SP 1GZLA 2OARA 1OX3A 5B66H 3M0AA 4PV1D 2ZXXA 3AEBC 5AVUB 2JDIH 2WSSH 3VP8A 1KTMA 1LP1B 4PD4E 4AQRD 3L4FA 1JY2N 5AVXB 3HD7C 2ITAA 1NKZB 1SQQG 1URQB 3WUVA 3M91A 2KP8A 2V4HA 3V2QA 1JUNA 1YTZT 3L71E 2OYIB 1EZVE 4W7ZA 1G1JA 2GUVA 3EWKA 4AYCA 2OYIA 3PLNA 3E1RA 1LGHB 1L4AD 3H1IG 4IFDK 3ZDMA 3C1LA 2E5YA 3A3YB 3F89A 1AV1A 2E74D 2Q3EA 4BWNA 2LXCB 4BXLA 5TISH 2O3JA 2GM4A 2P7JA 3H1HG 2Q7CA 3H1ID 5H2FH 1HWTC 2IDBA 1OVVA 1BSNA 1L0NG 1L4AB 2KZIA 2ZXEB 4Y28J 3S4RA 2WZ7A 1J1DB 1H88A 5CMZA 4DOJA 2E74B 3T97A 1KORA 1VQLP 2JEEA 2QJKB 1VQ4P 3NMDA 2PGDA 1JY3O 3D70A 1FZEA 1SQPJ 2N9BA 4K3AA 1JCDA 2Z5IA 4UB6H 3CMAP 3D6ZA 1GL2C 1NOHA 3L71D 1S9KE 1PP9J 3A0BE 4NPEA 1VQMP 1NGMB 1EZVI 1FAVA 1L4AC 1LT1A 2R5BA 3EFFK 2YIUB 4U3FJ 2FYUD 4UB6E 1VF5C 1GDTA 3H1LE 3H1JG 3H1HE 1T3UA 2BEZF 1NTMD 2MJZA 5E79E 1SQBD 4DT0A 3CX5E 2H8PD 1SQBK 3OAKA 3QH9A 5B5EH 1IFDA 2A45I 2OTKE 3CWBD 2O01H 1HGZA 1NTKJ 1RF1A 1T6AA 1JB0J 1RE4C 1TU3F 2FYZA 2JWDA 3KYQA 3L75J 1HTLC 3CWBG 4JF7A 4JYBA 4O9BA 3FWLA 5CBNA 1W5CE 3L73E 1J1EC 4I2LC 1P84D 2ZVNB 4HH2A 3MD0A 2LXBA 4H13B 4ZMDA 4WB4A 1DEBA 1MKMA 2POHA 3CXHI 3KXDA 4A7PA 5APUA 1HGVA 1FOSE 4EI2A 2WITA 4JPZB 1BE3E 3MTUE 4GKGA 3WUUA 1IC2A 1XTGB 4N78E 1Q81Q 1GU4A 5APTA 1N7SD 3TSIA 4Y99C 3L74G 4XE5B 4Y99B 5KKZB 1KILB 3L70D 2KS1A 2N1TB 1L4AA 1LTJA 4CPGA 5CCGA 1LTBC 4U3FG 2I1KA 3T97B 1OMIA 3CD6P 1OFCX 1JY3P 1L0ND 2E75D 2Y0CA 4N78D 3CCVP 2IBZI 1N7SB 3HD7A 1SFCD 1BGYD 3U1CA 2Q3IA 3G9RA 1OZHA 3SFEC 3H25A 1DEEG 1KILD 2P1JA 2Z5HA 3H32A 3M9QA 1J1EB 3PTZA 1T2KC 1W2EA 2KOGA 4I7ZB 2A06D 1GK6A 2DW3A 4WWIA 4YTPC 2OYIC 2E75B 3GLMA 2WSCJ 3NTNA 1MZ9A 1EDIA 2YNYA 5KTBA 3AE8C 1SQBE 2WT7B 1KC8Q 1ZMEC 1BSHA 2FYUG 4HKZH 5L8RJ 1P84H 3L72J 1AJYA 1LTAC 3LW5H 3B5NA 2E43A 2WWWA 2IBZG 2E76B 2B89A 5AVYB 1URQA 1NKNA 1HJ0A 2YIUC 4OGQC 2JKVA 5AVTB 1R5LA 1MFTA 1P84E 3PRJA 2K9YA 2QJPB 1M1JC 3RL0B 5CCHC 3L35A 1HF9A 1JCCA 1NH4A 2FBWC 1LJ2A 2QIWA 3P8CD 4C46A 1SQXG 4YXWH 5BU5A 1NWQA 1FZCC 2WTYA 1KB9I 1OWAA 4U7JA 1PGPA 3E7KA 4B86A 5AVSB 1L0LK 4WVZA 1H0TA 4HYTB 3I56P 3FXEA 1A02J 1ZRTE 1KB9H 3L75D 2OYHA 4LLHA 3HUSB 3AEGC 1IFMA 1K05A 1OIPA 2E76C 3BCCJ 3S9OA 1FZFA 1SQPD 4L73A 1ZV8A 3H1JJ 3HE5B 1OW7A 4PD4H 4UB8H 3D6YA 2W6BA 1NTMK 2RKLA 5GTIH 2R32A 1M1KQ 1H89A 2V7QJ 3A2AA 4IFMA 1KN7A 4OH8B 1IFNA 1NU1D 1X79B 1FE6A 1KD1Q 4KJMA 3H1IJ 4PJ0H 4Z1MH 1R5SA 1NJIQ 5AVZB 2A45G 3Q5PA 3IAOA 1NAYA 1T2KD 1FZBA 1VQ6P 2ZYAA 1IZNB 2NPSA 1PPJD 1U57A 2Q5UA 1GU5A 1LWUA 3L74E 1T3JA 3OJAB 5GTHE 3CL3D 4HB1A 1FU1A 1KB9E 1FZCA 1RHZB 2HYNA 3AECC 2HPCB 2M5AB 1FJPA 1KYOE 5C39A 2C0XA 1DIPA 2K1AA 3RBXA 2B88A 2WPQA 1JNMA 1J2JB 1LTJC 1S2EA 1YYCA 4WY4B 5CCGC 1M57D 2A06E 1KV4A 1KB9D 3HRNA 4LGDE 3MUDC 4YXDC 1YJWP 1Q2NA 4XA4A 1M90Q 3L70G 3O6QA 3P7KA 1KQSO 1DX7A 1NTZD 3M0DA 4GOFA 4N3YB 4PD4D 5AW7B 4OWFA 1LT9B 4L76A 1JEKA 2FXOA 1VDFA 2Q1KA 3F5HA 4IOIH 3WU2H 1KQLA 1RF1C 1N86A 1SQBG 5E79H 1FDIA 1SQVD 2KI7B 4IL6X 5AW3B 1FJKA 4EIJA 3CWBE 3BATA 1SQQD 3VMXA 1SQQK 1YHQP 3CCEP 1UIXA 2AEFA 3M9HA 4GDOA 3PP5A 3IFMA 3VN0A 3B5NC 1P84I 1Q7YQ 1S1CX 1RQVA 1USEA 2B9BA 1PP9D 3BCCD 4D6TG 1AFOA 5KLVE 1FDOA 2ZT9C 4C7RA 1VQ8P 4L75A 2Y9YA 5KLIC 2D2CB 1L0LE 3OA7A 1VQ5P 3GW6A 2D2CC 2IZ0A 4NPDA 1LWUB 2HODB 4IFFA 1GL2A 1HUCA 4UB8E 1PPJG 5AW1B 3L70J 3TYYA 1CSBA 1NU1E 2CK3H 2QG4A 3AE4C 4W7YA 5CBOA 3L36A 5APQA 1AQ5A 1SLQA 3HE4A 5APXA 3SFDC 5KAIH 1Q82Q 2KUBA 3V4QA 4OGQD 3CX5I 5CJ0A 2WPVB 3GHGC 3CCJP 1YTZI 1NTZE 1JY3N 1HVVA 4LC1A 2O01J 4N6JA 2FYUJ 1LT9C 3VMZA 4L74A 5AW4B 3BVHA 3L72G 3CC2P 1EZVD 3RK3C 1HH0A 4R4LA 2E5TA 1WMKA 2JWAA 2OTJP 1BCCJ 1JOCA 1YI2P 1NU1J 3MZWB 1KFMA 3MHVA 3P8CE 1D7MA 2P10A 5CHXA 3VYIA 1EQ7A 2NPSC 3L72D 3CC4P 3CCLP 3TNUB 4OVNF 1QX8A 1SQQE 2WPRA 1IFJA 1MUUA 3HTKB 3A0BH 4RJTA 1X8YA 2HODA 5KJ7A 5DJUB 1Z56A 1FZAA 1L0LJ 2G8YA 2YMYA 1IK7A 1LTTC 1Y8AA 4H44D 3RGUA 3E1IA 2OTLP 1H8AA 3AE9C 2W6JH 3SWKA 3AEDC 5KAIE 5BU8B 3VMYA 2BCCG 3SWFA 3OW2O 2IBZD 2WSFH 3AE1C 3H1LD 1PZQA 1SQVE 3H1KG 5AW2B 1YQ3C 2RH0A 4GOEA 3TGUJ 3G6EP 2AEJA 4H44B 3JC22 2O01N 2R3SA 2WQYC 4PV1B 2QRXA 1S9KD 3WMM0 3O8ZA 3L73G 5AW0B 3M0DC 1S5LX 4I1LA 1N7LA 3B4SA 1JTHA 2FYNC 2FXPA 2HLOA 2PRRA 1RE4A 1ZN5A 1VQ7P 1JMBA 2WSEH 4BRYA 4JBZA 1GK4A 2E75C 4C7NB 1BDCA 1QGKB 2H7HA 1NO4A 1EDLA 1LTSC 4WBAA 5AW5B 1BE3D 2R44A 1N7SC 3HUSC 1EC5A 3L37A 4HJGH 1Q90D 2W6AA 2Q6QA 2R5DA 3AE5C 1PPJE 1ZP0C 1L2PA 2C0WA 2O1JA 2UWJE 1RH5B 2BCCJ 5KLVD 2QJKC 3LIEA 3CI9A 3IN6A 1FZCB 2ZAEB 3L74J 2E74C 2BCCE 1NAFA 3MUDA 3RBZA 3VTPC 2M5AA 2YKQA 3KDPB 3CMEP 3MGNA 2V7QH 1BCCD 3Q2YA 2SPZA 1S72P 3VOPA 5APSA 1PGOA 2I8DA 1QL2A 3FX0A 3GMAA 2W27A 5AVRB 2OQQA 2RN0A 3L71G 3M06A 3L75G 1K8AQ 1QLED 3Q5RA 1LT9A 1W2BO 2M8RA 4DJGA 3BCCE 3H1JD 1NTMG 2ZYDA 1VQOP 2QJYC 2KXPB 1NTZG 1SP4A 2HFED 2ZJSE 3HUSA 3P8MC 1ZW0A 3HE5A 2IYPA 1M1JA 5CCHA 2L91A 1K9MQ 2N1TC 5KJ7C 3TGUE 2XDJA 3EQ2A 1SQVJ 1QVGO 4RESB 3M9BA 1L0LG 1LP1A 2L5GB 1SQPK 3PH0A 3V2RA 3VP9A 4ZKUA 1AA0A 3KQGA 1SQXK 4YPCA 3UIAA 1UIIA 1SQXD 5GTIE 2KYVA 1ZR4A 2Z4EA 2OYHC 1R8EA 1L0LD 2G3AA 2OYOA 1FBMA 3VMAA 2N9YB 2YKPA 4H13C 4IL6H 3U1AA 1YITP 1YJNP 3G71P 1S5LE 3BCCG 4D6TD 2Y9ZA 3V4WA 2AXCA 3PHLA 1HJBA 1SQQJ 1SQVK 1DH3A 1EDKA 5TJHA 3RL0g 3V6IA 3N4XA 2FYUK 2IZ1A 1NTKK 1OVRA 1BCCE 1XTCC 3D71A 3SWYA 1VQPP 1SFCB 1N73A 2J5UA 1SFCA 2ZYGA 3W68A 3HD7D 1N73B 1BDDA 2QM7A 4H13D 2WSEJ 4I6MC 2FYUE 2XKMA 1NU1G 1U7JA 1GW4A 1NTZJ 1RY3A 1K73Q 2FY8A 2AXTE 2J58A 3L74D 1KQGB 1EZVG 5CJ4A 3Q1MA 2A06G 3O6QB 2QA4P 2KIKA 1GL2B 3ITKA 3HD7B 1T8ZA 1PL5A 4ASWA 2H43A 3FXDA 3LIDA 2N1TD 1AVOA 5K5GB 2E42A 4PD4I 3L70E 1L0NK 1BE3J 2E76D 1K04A 1S4XA 2B87A 2R3CA 4XFJA 5KKZC 1M1JB 3RL0C 3Q5SA 1GTWA 1IFIA 3TGUD 3WU2E 1PIXA 2PP6A 1GL2D 3QWOC 1QVFO 4W80A 1JM0A 2K9JA 3MIWA 4MN4C 5KLVG 1YIJP 3GF7A 4DCKA 3BRTB 2BCCD 3I5CA 3L73J 5AVWB 4RO0A 2QJYB 5KLVJ 3CCSP 3Q3DA 1ZRTD 1S3JA 3L75E 5AW8B 2M3BA 1MFZA 4NPFX 1NU1K 1X22A 2AXTH 2IPPA 5CCHD 5KAFH 1N73C 3N7NA 1CW5A 3CCQP 3IF4A 3GHGA 1OW6A 5TISE 2C9NY 2KLVA 1WT6A 2W8ZA 1IFPA 3GHGB 3CXHD 3CWBJ 1NTKG 3FGAD 4JQ0D 3C9IA 3JSVC 3KHUA 5H2FE 2CPBA 2HR3A 3H1LJ 4PV1C 1CI6B 1OXZA 1ZOYC 3AE6C 4U3FE 4ZNCA 5KLVK 4EOTA 4DZOA 3CCUP 3RL0D 1URQC 1JTHB 1USDA 2YKOA 5AVVB 1IJDB 1PFIA 1X0TA 1FC2C 1AQTA 1N8RQ 1E79H 3RK2D 1GD2E 1LTJB 4QMAA 2WT7A 3R2PA 1LWUC 2XNDH 2K9JB 1VPCA 4ZKPA 2HPCA 1HBWA 2XNXA 1AVYA 1RE3A 3G3ZA 5KAFE 2VRSA 1VQKP 3RK2B 3V2PA 1ZLLA 3K5BA 5CCGD 2FFDA 2NPSB 1RF0C 3FWNA 4RKUJ 2I1JA 2MKVA 4C7NA 4WY4D 3NFQA 2QEXP 4AUWA 1YBKA 2IYOA 2YMKA 1NYHA 2K3RA 2OGUA 3LW5J 1YQ4C 1CZQA 1SFCC 2NPSD 2NRGA 3L71J 4JYCA 4BRYB 2P2UA 2LKMA 3CXHH 2FYNB 3H1KD 2LR2A 2M0BA 3A0HH 1G2CB 3AEEC 3H1IE 1G2CA 2WSFJ 1NVOA 5AVQB 3H1HD 1ZXGA 3SSUA 1M7LA 1OW8A 3HE4B 1BCCG 2P58A 1VF5B 3WUTA 1SS1A 3CCRP 1Y47A 2P67A 2JP3A 2KB7P 2O1KA 4GODA 3V5BA 3JCUH 2JR8A 1N7SA 2YO3A 3IR9A 2C9LY 3KZIE 4H44C 3H1JE 3EFGA 4U3FD 1SQVG 2K88A 2YO2A 1IK9A 1KFNA 3A5TA 1H0TB 2WSCH 2FFDB 4H0LB 2OYHB 1EXJA 1SQXJ 2JO1A 3II6A 1U7MA 1FS0E 2K37A 2KZJA 1RE3C 1VF5D 4GT1A 4WY4C 5GTHH 5KLIB 3GG2A 1J1DC 1LNQA 2HG5D 1FOSF 3AE3C 3TNUA 3CLQA 5M1BA 1EDJA 3CX5D 2WPSA 1NTME 2J59M 2XZRA 3HTKA 1PP9G 1SQPG 3AE2C 3B5NB 3B71A 4H0LD 1WRGA 3A0HE 1VQNP 2KK7A 5B5EE 3TK1A 1JY2P 2QVAA 2ZFCA 4TT3H 3RK3B 4GIFA 5B66E 2GUSA 1PV3A 4K35A 1FDMA 3L72E 2IFMA 1KMIZ 1NTZK 3H6PA 3L73D 3B5ND 5AW9B 4KT0J 4EYYQ 1X9VA 1FZGA 1SQBJ 4KHXA 1ZR2A 2PAJA 1IO4A 4ASVA 1QEXA 1E5WA 2Y0DA 1YJ9P 1BGYE 4TLFA
chains in the Genus database with same CATH topology
1SVFA 3P32A 3H32B 3RK3D 1QL1A 3KPEA 3BASA 3B8EB 2N1TA 1KILA 2XU6A 1KILC 1LTGC 4WY4A 3U59A 2JJLA 3BRVB 3A7OA 2IFNA 1MV8A 2XV5A 1JMMA 1N2DC 4M3LA 2FFDC 2BASA 1RF0A 1CI6A 1GW3A 2FXMA 3V2NA 2A45H 1RF1B 2KSJA 3NXSA 2CPSA 2QM8A 1JO5A 2IX7C 5APWA 5APYA 1JY2O 1KZUB 2FKWB 5KJ7D 5BVZA 3RK2C 5APVA 3V2QA 2O1KA 1URQD 1G1IA 5AW6B 1LTIC 1NHLA 1GZLA 2OARA 3M0AA 5AVUB 3VP8A 4AQRD 3L4FA 1JY2N 5AVXB 3HD7C 1NKZB 1URQB 3M91A 2KP8A 1JUNA 1YTZT 2OYIB 4W7ZA 1G1JA 2GUVA 4AYCA 2OYIA 1LGHB 1L4AD 4IFDK 3A3YB 2P7JA 2Q7CA 2ZXEB 1L4AB 2WZ7A 1J1DB 1H88A 5CMZA 4DOJA 3T97A 2JEEA 3NMDA 1JY3O 1FZEA 2N9BA 1JCDA 2Z5IA 1GL2C 1NOHA 1S9KE 1FAVA 1L4AC 2R5BA 1GDTA 1T3UA 2MJZA 2H8PD 1SQBK 3OAKA 1IFDA 2A45I 2O01H 1HGZA 1RF1A 1RE4C 2FYZA 3KYQA 4O9BA 1HTLC 4JF7A 4JYBA 4I2LC 1J1EC 4HH2A 3MD0A 4WB4A 1DEBA 2POHA 5APUA 1HGVA 1FOSE 2WITA 3MTUE 4GKGA 2Q9IA 1IC2A 1XTGB 4N78E 1GU4A 5APTA 1N7SD 3TSIA 4Y99C 4XE5B 4Y99B 1KILB 2N1TB 1L4AA 1LTJA 5CCGA 1LTBC 2I1KA 1JY3P 4N78D 3HD7A 1N7SB 1SFCD 3U1CA 2Q3IA 1A02F 1KILD 2P1JA 2Z5HA 3H32A 3M9QA 1J1EB 2E42A 1W2EA 2KOGA 1GK6A 2OYIC 3NTNA 1MZ9A 2YNYA 5KTBA 1LTAC 3LW5H 3B5NA 2E43A 2WWWA 5AVYB 1URQA 1NKNA 5AVTB 1M1JC 3RL0B 5CCHC 3L35A 1JCCA 1NH4A 4C46A 5BU5A 3P8CD 1FZCC 1NWQA 2WTYA 1OWAA 4B86A 5AVSB 1L0LK 4HYTB 1A02J 2OYHA 4LLHA 3HUSB 1IFMA 1FZFA 1ZV8A 3HE5B 2W6BA 1NTMK 1H89A 3A2AA 4IFMA 4OH8B 1IFNA 1X79B 5AVZB 2A45G 1FZBA 2NPSA 2Q5UA 1GU5A 1LWUA 3OJAB 1T3JA 3CL3D 1FU1A 1FZCA 2HYNA 2HPCB 1FJPA 2C0XA 2WPQA 1JNMA 1J2JB 1LTJC 1YYCA 4WY4B 5CCGC 3HRNA 4LGDE 4XA4A 3P7KA 1DX7A 3M0DA 4N3YB 5AW7B 1LT9B 2GM4A 1VDFA 1KQLA 1RF1C 1N86A 5AW3B 1FJKA 4EIJA 3BATA 3VMXA 1SQQK 3M9HA 3PP5A 3IFMA 3VN0A 3B5NC 1AFOA 4C7RA 3OA7A 1LWUB 2HODB 4IFFA 1GL2A 1HUCA 5AW1B 3TYYA 1CSBA 4W7YA 3L36A 5APQA 1AQ5A 1SLQA 3HE4A 5APXA 3V4QA 5CJ0A 3GHGC 1YTZI 3VMZA 1JY3N 1HVVA 4LC1A 3BVHA 4N6JA 1LT9C 5AW4B 3RK3C 1HH0A 1JOCA 3P8CE 1KFMA 5CHXA 3VYIA 1EQ7A 2NPSC 3TNUB 2WPRA 1IFJA 1MUUA 3HTKB 1X8YA 2HODA 5KJ7A 1Z56A 1FZAA 2YMYA 1LTTC 3E1IA 1H8AA 5BU8B 3VMYA 3SWFA 2WSFH 5AW2B 1S9KD 3WMM0 3O8ZA 5AW0B 3M0DC 4I1LA 1N7LA 1JTHA 2HLOA 1RE4A 1ZN5A 2WSEH 1GK4A 4C7NB 2H7HA 1NO4A 1LTSC 4WBAA 5AW5B 1N7SC 3HUSC 3L37A 2W6AA 2R5DA 2C0WA 2O1JA 3LIEA 3CI9A 1FZCB 1NAFA 3MUDA 3VTPC 2YKQA 3KDPB 3MGNA 3VOPA 5APSA 1QL2A 2W27A 5AVRB 3M06A 1LT9A 2M8RA 1SP4A 2HFED 3HUSA 3P8MC 3HE5A 1M1JA 5CCHA 2N1TC 5KJ7C 2XDJA 3EQ2A 4RESB 3M9BA 2L5GB 1SQPK 3V2RA 3VP9A 4ZKUA 3KQGA 1SQXK 3UIAA 1ZR4A 2OYHC 2Z4EA 2KYVA 1FBMA 2YKPA 3U1AA 3V4WA 1HJBA 1SQVK 1DH3A 3N4XA 2FYUK 1NTKK 1XTCC 1N73C 3SWYA 1SFCB 1N73A 1SFCA 1N73B 3HD7D 2QM7A 4I6MC 2XKMA 1GW4A 1RY3A 2J58A 5CJ4A 1GL2B 3HD7B 1T8ZA 2H43A 3LIDA 2N1TD 1L0NK 2R3CA 1GTWA 1M1JB 3RL0C 1IFIA 2PP6A 1GL2D 4W80A 3MIWA 3BRTB 3I5CA 5AVWB 5AW8B 2M3BA 1MFZA 5CCHD 1NU1K 2IPPA 1CW5A 3N7NA 3GHGA 2C9NY 2KLVA 1WT6A 3GHGB 3C9IA 2CPBA 1CI6B 1OXZA 4EOTA 5KLVK 4DZOA 3RL0D 1URQC 1JTHB 2YKOA 5AVVB 1IJDB 1PFIA 1GD2E 3RK2D 1LTJB 2WT7A 3R2PA 1LWUC 1VPCA 4ZKPA 2HPCA 1HBWA 2XNXA 1RE3A 3G3ZA 2VRSA 3RK2B 3V2PA 1ZLLA 5CCGD 2FFDA 2NPSB 1RF0C 2I1JA 4C7NA 4WY4D 3NFQA 4AUWA 1CZQA 1SFCC 2NPSD 4JYCA 2P2UA 2LKMA 1HWTC 1T2KD 1G2CB 3V5BA 1G2CA 5AVQB 1M7LA 3HE4B 2P67A 1T2KC 2KB7P 1N7SA 2YO3A 3IR9A 2C9LY 3EFGA 3A5TA 2YO2A 1IK9A 1KFNA 2WSCH 2FFDB 2OYHB 3II6A 4GT1A 4WY4C 1RE3C 1J1DC 2HG5D 1FOSF 3TNUA 3CLQA 2WPSA 2J59M 2XZRA 3HTKA 2WT7B 3B5NB 1WRGA 3TK1A 1JY2P 2ZFCA 3RK3B 4GIFA 2GUSA 1FDMA 2IFMA 1NTZK 3H6PA 3B5ND 5AW9B 1FZGA 1X9VA 4KHXA 1ZR2A 2PAJA 1IO4A 1E5WA 2R32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNX A;  1RE3 A;  3E1I A;  3H32 B;  2A45 H;  3HUS C;  1LT9 B;  2Q9I A;  2FFD B;  1RF1 B;  1N73 C;  2OYH B;  2A45 G;  1N73 A;  2FFD A;  1RF1 C;  1N73 B;  1N86 A;  1RE3 C;  2OYI B;  1FZB A;  3HUS A;  1M1J C;  1RF0 C;  2OYI A;  1M1J A;  3GHG A;  1T3U A;  1LTJ A;  1FZC C;  1LWU A;  3GHG B;  1FZC B;  3GHG C;  1JY3 P;  2A45 I;  1FZC A;  1JY2 O;  1JY3 N;  3BVH A;  1LT9 C;  2HPC B;  1RF1 A;  2H43 A;  1RE4 C;  2HLO A;  2OYH A;  3H32 A;  1JY2 P;  1RE4 A;  3HUS B;  2Z4E A;  2FFD C;  1W2E A;  2OYH C;  1LTJ C;  1FZF A;  1RF0 A;  2OYI C;  1LTJ B;  1JY3 O;  1M1J B;  1FZG A;  1LWU C;  2HOD A;  1LWU B;  2HOD B;  2HPC A;  1JY2 N;  1FZA A;  1FZE A;  1LT9 A; 
#chains in the Genus database with same CATH topology
 1SVF A;  3P32 A;  3H32 B;  3RK3 D;  1M8O B;  1PGJ A;  1QL1 A;  3S1K A;  2H89 C;  3H1K E;  2D2C D;  3KPE A;  1KYO D;  3BAS A;  3B8E B;  2KS1 B;  2N1T A;  2Y0E A;  1L0N J;  1KIL A;  2GA1 A;  2XU6 A;  2ZT9 D;  1Q86 Q;  1KIL C;  1LTG C;  1BE3 G;  4WY4 A;  3U59 A;  2JJL A;  3BRV B;  2W83 C;  4D6T J;  3A7O A;  4D6T E;  2RMZ A;  2IFN A;  1MV8 A;  2XV5 A;  1JMM A;  1N2D C;  1A02 F;  2W90 A;  1OVU A;  3R4Y A;  1L0N E;  4H0L C;  3TF5 A;  5DJT B;  2KLU A;  4M3L A;  1KQF B;  3CX5 H;  3GF3 A;  3H1K J;  2ZT9 B;  2QE7 H;  2FFD C;  2QJP C;  1DD4 A;  1KIL E;  3TGU G;  1BGY G;  2BAS A;  3CCM P;  1EXI A;  4OGQ B;  4R4M A;  1BGY J;  1RF0 A;  3CPW O;  2Q9I A;  2IBZ E;  3I55 P;  2QSI A;  4EDF A;  4IL6 E;  2NZ2 A;  4PJ0 E;  3RK3 E;  1GMJ A;  1CI6 A;  1GW3 A;  2AEM A;  2BEQ D;  2YXQ B;  1S5L H;  2FXM A;  2WVR A;  3JCU E;  3V2N A;  3H1L G;  2A45 H;  1VQ9 P;  1RF1 B;  3KZI H;  3PJS K;  4I7Z C;  2KSJ A;  2ZVO B;  2CPS A;  3NXS A;  5EFW B;  2QM8 A;  3AEA C;  1NTK E;  1RQU A;  3USS A;  1JO5 A;  3CC7 P;  2YXR B;  1NTM J;  2IX7 C;  3CXH E;  1KYO H;  3AEF C;  5APW A;  3AE7 C;  2KSE A;  5APY A;  3H1H J;  1JY2 O;  1KZU B;  2FKW B;  2WMM A;  3TDK A;  1VL2 A;  1PGQ A;  5KJ7 D;  3W67 A;  5BVZ A;  1NTK D;  3RK2 C;  1KYO I;  2PFX A;  5APV A;  1PP9 E;  1SQX E;  3ABV C;  3C8V A;  2H88 C;  2M3E A;  1Y9B A;  2KNC B;  1URQ D;  1G1I A;  1M56 D;  1DD3 A;  1LTI C;  1SQP E;  2B87 B;  2KNC A;  3MP7 B;  5AW6 B;  1NHL A;  3G4S P;  1GZL A;  2OAR A;  1OX3 A;  5B66 H;  3M0A A;  4PV1 D;  2ZXX A;  3AEB C;  5AVU B;  2JDI H;  2WSS H;  3VP8 A;  1KTM A;  1LP1 B;  4PD4 E;  4AQR D;  3L4F A;  1JY2 N;  5AVX B;  3HD7 C;  2ITA A;  1NKZ B;  1SQQ G;  1URQ B;  3WUV A;  3M91 A;  2KP8 A;  2V4H A;  3V2Q A;  1JUN A;  1YTZ T;  3L71 E;  2OYI B;  1EZV E;  4W7Z A;  1G1J A;  2GUV A;  3EWK A;  4AYC A;  2OYI A;  3PLN A;  3E1R A;  1LGH B;  1L4A D;  3H1I G;  4IFD K;  3ZDM A;  3C1L A;  2E5Y A;  3A3Y B;  3F89 A;  1AV1 A;  2E74 D;  2Q3E A;  4BWN A;  2LXC B;  4BXL A;  5TIS H;  2O3J A;  2GM4 A;  2P7J A;  3H1H G;  2Q7C A;  3H1I D;  5H2F H;  1HWT C;  2IDB A;  1OVV A;  1BSN A;  1L0N G;  1L4A B;  2KZI A;  2ZXE B;  4Y28 J;  3S4R A;  2WZ7 A;  1J1D B;  1H88 A;  5CMZ A;  4DOJ A;  2E74 B;  3T97 A;  1KOR A;  1VQL P;  2JEE A;  2QJK B;  1VQ4 P;  3NMD A;  2PGD A;  1JY3 O;  3D70 A;  1FZE A;  1SQP J;  2N9B A;  4K3A A;  1JCD A;  2Z5I A;  4UB6 H;  3CMA P;  3D6Z A;  1GL2 C;  1NOH A;  3L71 D;  1S9K E;  1PP9 J;  3A0B E;  4NPE A;  1VQM P;  1NGM B;  1EZV I;  1FAV A;  1L4A C;  1LT1 A;  2R5B A;  3EFF K;  2YIU B;  4U3F J;  2FYU D;  4UB6 E;  1VF5 C;  1GDT A;  3H1L E;  3H1J G;  3H1H E;  1T3U A;  2BEZ F;  1NTM D;  2MJZ A;  5E79 E;  1SQB D;  4DT0 A;  3CX5 E;  2H8P D;  1SQB K;  3OAK A;  3QH9 A;  5B5E H;  1IFD A;  2A45 I;  2OTK E;  3CWB D;  2O01 H;  1HGZ A;  1NTK J;  1RF1 A;  1T6A A;  1JB0 J;  1RE4 C;  1TU3 F;  2FYZ A;  2JWD A;  3KYQ A;  3L75 J;  1HTL C;  3CWB G;  4JF7 A;  4JYB A;  4O9B A;  3FWL A;  5CBN A;  1W5C E;  3L73 E;  1J1E C;  4I2L C;  1P84 D;  2ZVN B;  4HH2 A;  3MD0 A;  2LXB A;  4H13 B;  4ZMD A;  4WB4 A;  1DEB A;  1MKM A;  2POH A;  3CXH I;  3KXD A;  4A7P A;  5APU A;  1HGV A;  1FOS E;  4EI2 A;  2WIT A;  4JPZ B;  1BE3 E;  3MTU E;  4GKG A;  3WUU A;  1IC2 A;  1XTG B;  4N78 E;  1Q81 Q;  1GU4 A;  5APT A;  1N7S D;  3TSI A;  4Y99 C;  3L74 G;  4XE5 B;  4Y99 B;  5KKZ B;  1KIL B;  3L70 D;  2KS1 A;  2N1T B;  1L4A A;  1LTJ A;  4CPG A;  5CCG A;  1LTB C;  4U3F G;  2I1K A;  3T97 B;  1OMI A;  3CD6 P;  1OFC X;  1JY3 P;  1L0N D;  2E75 D;  2Y0C A;  4N78 D;  3CCV P;  2IBZ I;  1N7S B;  3HD7 A;  1SFC D;  1BGY D;  3U1C A;  2Q3I A;  3G9R A;  1OZH A;  3SFE C;  3H25 A;  1DEE G;  1KIL D;  2P1J A;  2Z5H A;  3H32 A;  3M9Q A;  1J1E B;  3PTZ A;  1T2K C;  1W2E A;  2KOG A;  4I7Z B;  2A06 D;  1GK6 A;  2DW3 A;  4WWI A;  4YTP C;  2OYI C;  2E75 B;  3GLM A;  2WSC J;  3NTN A;  1MZ9 A;  1EDI A;  2YNY A;  5KTB A;  3AE8 C;  1SQB E;  2WT7 B;  1KC8 Q;  1ZME C;  1BSH A;  2FYU G;  4HKZ H;  5L8R J;  1P84 H;  3L72 J;  1AJY A;  1LTA C;  3LW5 H;  3B5N A;  2E43 A;  2WWW A;  2IBZ G;  2E76 B;  2B89 A;  5AVY B;  1URQ A;  1NKN A;  1HJ0 A;  2YIU C;  4OGQ C;  2JKV A;  5AVT B;  1R5L A;  1MFT A;  1P84 E;  3PRJ A;  2K9Y A;  2QJP B;  1M1J C;  3RL0 B;  5CCH C;  3L35 A;  1HF9 A;  1JCC A;  1NH4 A;  2FBW C;  1LJ2 A;  2QIW A;  3P8C D;  4C46 A;  1SQX G;  4YXW H;  5BU5 A;  1NWQ A;  1FZC C;  2WTY A;  1KB9 I;  1OWA A;  4U7J A;  1PGP A;  3E7K A;  4B86 A;  5AVS B;  1L0L K;  4WVZ A;  1H0T A;  4HYT B;  3I56 P;  3FXE A;  1A02 J;  1ZRT E;  1KB9 H;  3L75 D;  2OYH A;  4LLH A;  3HUS B;  3AEG C;  1IFM A;  1K05 A;  1OIP A;  2E76 C;  3BCC J;  3S9O A;  1FZF A;  1SQP D;  4L73 A;  1ZV8 A;  3H1J J;  3HE5 B;  1OW7 A;  4PD4 H;  4UB8 H;  3D6Y A;  2W6B A;  1NTM K;  2RKL A;  5GTI H;  2R32 A;  1M1K Q;  1H89 A;  2V7Q J;  3A2A A;  4IFM A;  1KN7 A;  4OH8 B;  1IFN A;  1NU1 D;  1X79 B;  1FE6 A;  1KD1 Q;  4KJM A;  3H1I J;  4PJ0 H;  4Z1M H;  1R5S A;  1NJI Q;  5AVZ B;  2A45 G;  3Q5P A;  3IAO A;  1NAY A;  1T2K D;  1FZB A;  1VQ6 P;  2ZYA A;  1IZN B;  2NPS A;  1PPJ D;  1U57 A;  2Q5U A;  1GU5 A;  1LWU A;  3L74 E;  1T3J A;  3OJA B;  5GTH E;  3CL3 D;  4HB1 A;  1FU1 A;  1KB9 E;  1FZC A;  1RHZ B;  2HYN A;  3AEC C;  2HPC B;  2M5A B;  1FJP A;  1KYO E;  5C39 A;  2C0X A;  1DIP A;  2K1A A;  3RBX A;  2B88 A;  2WPQ A;  1JNM A;  1J2J B;  1LTJ C;  1S2E A;  1YYC A;  4WY4 B;  5CCG C;  1M57 D;  2A06 E;  1KV4 A;  1KB9 D;  3HRN A;  4LGD E;  3MUD C;  4YXD C;  1YJW P;  1Q2N A;  4XA4 A;  1M90 Q;  3L70 G;  3O6Q A;  3P7K A;  1KQS O;  1DX7 A;  1NTZ D;  3M0D A;  4GOF A;  4N3Y B;  4PD4 D;  5AW7 B;  4OWF A;  1LT9 B;  4L76 A;  1JEK A;  2FXO A;  1VDF A;  2Q1K A;  3F5H A;  4IOI H;  3WU2 H;  1KQL A;  1RF1 C;  1N86 A;  1SQB G;  5E79 H;  1FDI A;  1SQV D;  2KI7 B;  4IL6 X;  5AW3 B;  1FJK A;  4EIJ A;  3CWB E;  3BAT A;  1SQQ D;  3VMX A;  1SQQ K;  1YHQ P;  3CCE P;  1UIX A;  2AEF A;  3M9H A;  4GDO A;  3PP5 A;  3IFM A;  3VN0 A;  3B5N C;  1P84 I;  1Q7Y Q;  1S1C X;  1RQV A;  1USE A;  2B9B A;  1PP9 D;  3BCC D;  4D6T G;  1AFO A;  5KLV E;  1FDO A;  2ZT9 C;  4C7R A;  1VQ8 P;  4L75 A;  2Y9Y A;  5KLI C;  2D2C B;  1L0L E;  3OA7 A;  1VQ5 P;  3GW6 A;  2D2C C;  2IZ0 A;  4NPD A;  1LWU B;  2HOD B;  4IFF A;  1GL2 A;  1HUC A;  4UB8 E;  1PPJ G;  5AW1 B;  3L70 J;  3TYY A;  1CSB A;  1NU1 E;  2CK3 H;  2QG4 A;  3AE4 C;  4W7Y A;  5CBO A;  3L36 A;  5APQ A;  1AQ5 A;  1SLQ A;  3HE4 A;  5APX A;  3SFD C;  5KAI H;  1Q82 Q;  2KUB A;  3V4Q A;  4OGQ D;  3CX5 I;  5CJ0 A;  2WPV B;  3GHG C;  3CCJ P;  1YTZ I;  1NTZ E;  1JY3 N;  1HVV A;  4LC1 A;  2O01 J;  4N6J A;  2FYU J;  1LT9 C;  3VMZ A;  4L74 A;  5AW4 B;  3BVH A;  3L72 G;  3CC2 P;  1EZV D;  3RK3 C;  1HH0 A;  4R4L A;  2E5T A;  1WMK A;  2JWA A;  2OTJ P;  1BCC J;  1JOC A;  1YI2 P;  1NU1 J;  3MZW B;  1KFM A;  3MHV A;  3P8C E;  1D7M A;  2P10 A;  5CHX A;  3VYI A;  1EQ7 A;  2NPS C;  3L72 D;  3CC4 P;  3CCL P;  3TNU B;  4OVN F;  1QX8 A;  1SQQ E;  2WPR A;  1IFJ A;  1MUU A;  3HTK B;  3A0B H;  4RJT A;  1X8Y A;  2HOD A;  5KJ7 A;  5DJU B;  1Z56 A;  1FZA A;  1L0L J;  2G8Y A;  2YMY A;  1IK7 A;  1LTT C;  1Y8A A;  4H44 D;  3RGU A;  3E1I A;  2OTL P;  1H8A A;  3AE9 C;  2W6J H;  3SWK A;  3AED C;  5KAI E;  5BU8 B;  3VMY A;  2BCC G;  3SWF A;  3OW2 O;  2IBZ D;  2WSF H;  3AE1 C;  3H1L D;  1PZQ A;  1SQV E;  3H1K G;  5AW2 B;  1YQ3 C;  2RH0 A;  4GOE A;  3TGU J;  3G6E P;  2AEJ A;  4H44 B;  3JC2 2;  2O01 N;  2R3S A;  2WQY C;  4PV1 B;  2QRX A;  1S9K D;  3WMM 0;  3O8Z A;  3L73 G;  5AW0 B;  3M0D C;  1S5L X;  4I1L A;  1N7L A;  3B4S A;  1JTH A;  2FYN C;  2FXP A;  2HLO A;  2PRR A;  1RE4 A;  1ZN5 A;  1VQ7 P;  1JMB A;  2WSE H;  4BRY A;  4JBZ A;  1GK4 A;  2E75 C;  4C7N B;  1BDC A;  1QGK B;  2H7H A;  1NO4 A;  1EDL A;  1LTS C;  4WBA A;  5AW5 B;  1BE3 D;  2R44 A;  1N7S C;  3HUS C;  1EC5 A;  3L37 A;  4HJG H;  1Q90 D;  2W6A A;  2Q6Q A;  2R5D A;  3AE5 C;  1PPJ E;  1ZP0 C;  1L2P A;  2C0W A;  2O1J A;  2UWJ E;  1RH5 B;  2BCC J;  5KLV D;  2QJK C;  3LIE A;  3CI9 A;  3IN6 A;  1FZC B;  2ZAE B;  3L74 J;  2E74 C;  2BCC E;  1NAF A;  3MUD A;  3RBZ A;  3VTP C;  2M5A A;  2YKQ A;  3KDP B;  3CME P;  3MGN A;  2V7Q H;  1BCC D;  3Q2Y A;  2SPZ A;  1S72 P;  3VOP A;  5APS A;  1PGO A;  2I8D A;  1QL2 A;  3FX0 A;  3GMA A;  2W27 A;  5AVR B;  2OQQ A;  2RN0 A;  3L71 G;  3M06 A;  3L75 G;  1K8A Q;  1QLE D;  3Q5R A;  1LT9 A;  1W2B O;  2M8R A;  4DJG A;  3BCC E;  3H1J D;  1NTM G;  2ZYD A;  1VQO P;  2QJY C;  2KXP B;  1NTZ G;  1SP4 A;  2HFE D;  2ZJS E;  3HUS A;  3P8M C;  1ZW0 A;  3HE5 A;  2IYP A;  1M1J A;  5CCH A;  2L91 A;  1K9M Q;  2N1T C;  5KJ7 C;  3TGU E;  2XDJ A;  3EQ2 A;  1SQV J;  1QVG O;  4RES B;  3M9B A;  1L0L G;  1LP1 A;  2L5G B;  1SQP K;  3PH0 A;  3V2R A;  3VP9 A;  4ZKU A;  1AA0 A;  3KQG A;  1SQX K;  4YPC A;  3UIA A;  1UII A;  1SQX D;  5GTI E;  2KYV A;  1ZR4 A;  2Z4E A;  2OYH C;  1R8E A;  1L0L D;  2G3A A;  2OYO A;  1FBM A;  3VMA A;  2N9Y B;  2YKP A;  4H13 C;  4IL6 H;  3U1A A;  1YIT P;  1YJN P;  3G71 P;  1S5L E;  3BCC G;  4D6T D;  2Y9Z A;  3V4W A;  2AXC A;  3PHL A;  1HJB A;  1SQQ J;  1SQV K;  1DH3 A;  1EDK A;  5TJH A;  3RL0 g;  3V6I A;  3N4X A;  2FYU K;  2IZ1 A;  1NTK K;  1OVR A;  1BCC E;  1XTC C;  3D71 A;  3SWY A;  1VQP P;  1SFC B;  1N73 A;  2J5U A;  1SFC A;  2ZYG A;  3W68 A;  3HD7 D;  1N73 B;  1BDD A;  2QM7 A;  4H13 D;  2WSE J;  4I6M C;  2FYU E;  2XKM A;  1NU1 G;  1U7J A;  1GW4 A;  1NTZ J;  1RY3 A;  1K73 Q;  2FY8 A;  2AXT E;  2J58 A;  3L74 D;  1KQG B;  1EZV G;  5CJ4 A;  3Q1M A;  2A06 G;  3O6Q B;  2QA4 P;  2KIK A;  1GL2 B;  3ITK A;  3HD7 B;  1T8Z A;  1PL5 A;  4ASW A;  2H43 A;  3FXD A;  3LID A;  2N1T D;  1AVO A;  5K5G B;  2E42 A;  4PD4 I;  3L70 E;  1L0N K;  1BE3 J;  2E76 D;  1K04 A;  1S4X A;  2B87 A;  2R3C A;  4XFJ A;  5KKZ C;  1M1J B;  3RL0 C;  3Q5S A;  1GTW A;  1IFI A;  3TGU D;  3WU2 E;  1PIX A;  2PP6 A;  1GL2 D;  3QWO C;  1QVF O;  4W80 A;  1JM0 A;  2K9J A;  3MIW A;  4MN4 C;  5KLV G;  1YIJ P;  3GF7 A;  4DCK A;  3BRT B;  2BCC D;  3I5C A;  3L73 J;  5AVW B;  4RO0 A;  2QJY B;  5KLV J;  3CCS P;  3Q3D A;  1ZRT D;  1S3J A;  3L75 E;  5AW8 B;  2M3B A;  1MFZ A;  4NPF X;  1NU1 K;  1X22 A;  2AXT H;  2IPP A;  5CCH D;  5KAF H;  1N73 C;  3N7N A;  1CW5 A;  3CCQ P;  3IF4 A;  3GHG A;  1OW6 A;  5TIS E;  2C9N Y;  2KLV A;  1WT6 A;  2W8Z A;  1IFP A;  3GHG B;  3CXH D;  3CWB J;  1NTK G;  3FGA D;  4JQ0 D;  3C9I A;  3JSV C;  3KHU A;  5H2F E;  2CPB A;  2HR3 A;  3H1L J;  4PV1 C;  1CI6 B;  1OXZ A;  1ZOY C;  3AE6 C;  4U3F E;  4ZNC A;  5KLV K;  4EOT A;  4DZO A;  3CCU P;  3RL0 D;  1URQ C;  1JTH B;  1USD A;  2YKO A;  5AVV B;  1IJD B;  1PFI A;  1X0T A;  1FC2 C;  1AQT A;  1N8R Q;  1E79 H;  3RK2 D;  1GD2 E;  1LTJ B;  4QMA A;  2WT7 A;  3R2P A;  1LWU C;  2XND H;  2K9J B;  1VPC A;  4ZKP A;  2HPC A;  1HBW A;  2XNX A;  1AVY A;  1RE3 A;  3G3Z A;  5KAF E;  2VRS A;  1VQK P;  3RK2 B;  3V2P A;  1ZLL A;  3K5B A;  5CCG D;  2FFD A;  2NPS B;  1RF0 C;  3FWN A;  4RKU J;  2I1J A;  2MKV A;  4C7N A;  4WY4 D;  3NFQ A;  2QEX P;  4AUW A;  1YBK A;  2IYO A;  2YMK A;  1NYH A;  2K3R A;  2OGU A;  3LW5 J;  1YQ4 C;  1CZQ A;  1SFC C;  2NPS D;  2NRG A;  3L71 J;  4JYC A;  4BRY B;  2P2U A;  2LKM A;  3CXH H;  2FYN B;  3H1K D;  2LR2 A;  2M0B A;  3A0H H;  1G2C B;  3AEE C;  3H1I E;  1G2C A;  2WSF J;  1NVO A;  5AVQ B;  3H1H D;  1ZXG A;  3SSU A;  1M7L A;  1OW8 A;  3HE4 B;  1BCC G;  2P58 A;  1VF5 B;  3WUT A;  1SS1 A;  3CCR P;  1Y47 A;  2P67 A;  2JP3 A;  2KB7 P;  2O1K A;  4GOD A;  3V5B A;  3JCU H;  2JR8 A;  1N7S A;  2YO3 A;  3IR9 A;  2C9L Y;  3KZI E;  4H44 C;  3H1J E;  3EFG A;  4U3F D;  1SQV G;  2K88 A;  2YO2 A;  1IK9 A;  1KFN A;  3A5T A;  1H0T B;  2WSC H;  2FFD B;  4H0L B;  2OYH B;  1EXJ A;  1SQX J;  2JO1 A;  3II6 A;  1U7M A;  1FS0 E;  2K37 A;  2KZJ A;  1RE3 C;  1VF5 D;  4GT1 A;  4WY4 C;  5GTH H;  5KLI B;  3GG2 A;  1J1D C;  1LNQ A;  2HG5 D;  1FOS F;  3AE3 C;  3TNU A;  3CLQ A;  5M1B A;  1EDJ A;  3CX5 D;  2WPS A;  1NTM E;  2J59 M;  2XZR A;  3HTK A;  1PP9 G;  1SQP G;  3AE2 C;  3B5N B;  3B71 A;  4H0L D;  1WRG A;  3A0H E;  1VQN P;  2KK7 A;  5B5E E;  3TK1 A;  1JY2 P;  2QVA A;  2ZFC A;  4TT3 H;  3RK3 B;  4GIF A;  5B66 E;  2GUS A;  1PV3 A;  4K35 A;  1FDM A;  3L72 E;  2IFM A;  1KMI Z;  1NTZ K;  3H6P A;  3L73 D;  3B5N D;  5AW9 B;  4KT0 J;  4EYY Q;  1X9V A;  1FZG A;  1SQB J;  4KHX A;  1ZR2 A;  2PAJ A;  1IO4 A;  4ASV A;  1QEX A;  1E5W A;  2Y0D A;  1YJ9 P;  1BGY E;  4TLF A; 
#chains in the Genus database with same CATH homology
 1SVF A;  3P32 A;  3H32 B;  3RK3 D;  1QL1 A;  3KPE A;  3BAS A;  3B8E B;  2N1T A;  1KIL A;  2XU6 A;  1KIL C;  1LTG C;  4WY4 A;  3U59 A;  2JJL A;  3BRV B;  3A7O A;  2IFN A;  1MV8 A;  2XV5 A;  1JMM A;  1N2D C;  4M3L A;  2FFD C;  2BAS A;  1RF0 A;  1CI6 A;  1GW3 A;  2FXM A;  3V2N A;  2A45 H;  1RF1 B;  2KSJ A;  3NXS A;  2CPS A;  2QM8 A;  1JO5 A;  2IX7 C;  5APW A;  5APY A;  1JY2 O;  1KZU B;  2FKW B;  5KJ7 D;  5BVZ A;  3RK2 C;  5APV A;  3V2Q A;  2O1K A;  1URQ D;  1G1I A;  5AW6 B;  1LTI C;  1NHL A;  1GZL A;  2OAR A;  3M0A A;  5AVU B;  3VP8 A;  4AQR D;  3L4F A;  1JY2 N;  5AVX B;  3HD7 C;  1NKZ B;  1URQ B;  3M91 A;  2KP8 A;  1JUN A;  1YTZ T;  2OYI B;  4W7Z A;  1G1J A;  2GUV A;  4AYC A;  2OYI A;  1LGH B;  1L4A D;  4IFD K;  3A3Y B;  2P7J A;  2Q7C A;  2ZXE B;  1L4A B;  2WZ7 A;  1J1D B;  1H88 A;  5CMZ A;  4DOJ A;  3T97 A;  2JEE A;  3NMD A;  1JY3 O;  1FZE A;  2N9B A;  1JCD A;  2Z5I A;  1GL2 C;  1NOH A;  1S9K E;  1FAV A;  1L4A C;  2R5B A;  1GDT A;  1T3U A;  2MJZ A;  2H8P D;  1SQB K;  3OAK A;  1IFD A;  2A45 I;  2O01 H;  1HGZ A;  1RF1 A;  1RE4 C;  2FYZ A;  3KYQ A;  4O9B A;  1HTL C;  4JF7 A;  4JYB A;  4I2L C;  1J1E C;  4HH2 A;  3MD0 A;  4WB4 A;  1DEB A;  2POH A;  5APU A;  1HGV A;  1FOS E;  2WIT A;  3MTU E;  4GKG A;  2Q9I A;  1IC2 A;  1XTG B;  4N78 E;  1GU4 A;  5APT A;  1N7S D;  3TSI A;  4Y99 C;  4XE5 B;  4Y99 B;  1KIL B;  2N1T B;  1L4A A;  1LTJ A;  5CCG A;  1LTB C;  2I1K A;  1JY3 P;  4N78 D;  3HD7 A;  1N7S B;  1SFC D;  3U1C A;  2Q3I A;  1A02 F;  1KIL D;  2P1J A;  2Z5H A;  3H32 A;  3M9Q A;  1J1E B;  2E42 A;  1W2E A;  2KOG A;  1GK6 A;  2OYI C;  3NTN A;  1MZ9 A;  2YNY A;  5KTB A;  1LTA C;  3LW5 H;  3B5N A;  2E43 A;  2WWW A;  5AVY B;  1URQ A;  1NKN A;  5AVT B;  1M1J C;  3RL0 B;  5CCH C;  3L35 A;  1JCC A;  1NH4 A;  4C46 A;  5BU5 A;  3P8C D;  1FZC C;  1NWQ A;  2WTY A;  1OWA A;  4B86 A;  5AVS B;  1L0L K;  4HYT B;  1A02 J;  2OYH A;  4LLH A;  3HUS B;  1IFM A;  1FZF A;  1ZV8 A;  3HE5 B;  2W6B A;  1NTM K;  1H89 A;  3A2A A;  4IFM A;  4OH8 B;  1IFN A;  1X79 B;  5AVZ B;  2A45 G;  1FZB A;  2NPS A;  2Q5U A;  1GU5 A;  1LWU A;  3OJA B;  1T3J A;  3CL3 D;  1FU1 A;  1FZC A;  2HYN A;  2HPC B;  1FJP A;  2C0X A;  2WPQ A;  1JNM A;  1J2J B;  1LTJ C;  1YYC A;  4WY4 B;  5CCG C;  3HRN A;  4LGD E;  4XA4 A;  3P7K A;  1DX7 A;  3M0D A;  4N3Y B;  5AW7 B;  1LT9 B;  2GM4 A;  1VDF A;  1KQL A;  1RF1 C;  1N86 A;  5AW3 B;  1FJK A;  4EIJ A;  3BAT A;  3VMX A;  1SQQ K;  3M9H A;  3PP5 A;  3IFM A;  3VN0 A;  3B5N C;  1AFO A;  4C7R A;  3OA7 A;  1LWU B;  2HOD B;  4IFF A;  1GL2 A;  1HUC A;  5AW1 B;  3TYY A;  1CSB A;  4W7Y A;  3L36 A;  5APQ A;  1AQ5 A;  1SLQ A;  3HE4 A;  5APX A;  3V4Q A;  5CJ0 A;  3GHG C;  1YTZ I;  3VMZ A;  1JY3 N;  1HVV A;  4LC1 A;  3BVH A;  4N6J A;  1LT9 C;  5AW4 B;  3RK3 C;  1HH0 A;  1JOC A;  3P8C E;  1KFM A;  5CHX A;  3VYI A;  1EQ7 A;  2NPS C;  3TNU B;  2WPR A;  1IFJ A;  1MUU A;  3HTK B;  1X8Y A;  2HOD A;  5KJ7 A;  1Z56 A;  1FZA A;  2YMY A;  1LTT C;  3E1I A;  1H8A A;  5BU8 B;  3VMY A;  3SWF A;  2WSF H;  5AW2 B;  1S9K D;  3WMM 0;  3O8Z A;  5AW0 B;  3M0D C;  4I1L A;  1N7L A;  1JTH A;  2HLO A;  1RE4 A;  1ZN5 A;  2WSE H;  1GK4 A;  4C7N B;  2H7H A;  1NO4 A;  1LTS C;  4WBA A;  5AW5 B;  1N7S C;  3HUS C;  3L37 A;  2W6A A;  2R5D A;  2C0W A;  2O1J A;  3LIE A;  3CI9 A;  1FZC B;  1NAF A;  3MUD A;  3VTP C;  2YKQ A;  3KDP B;  3MGN A;  3VOP A;  5APS A;  1QL2 A;  2W27 A;  5AVR B;  3M06 A;  1LT9 A;  2M8R A;  1SP4 A;  2HFE D;  3HUS A;  3P8M C;  3HE5 A;  1M1J A;  5CCH A;  2N1T C;  5KJ7 C;  2XDJ A;  3EQ2 A;  4RES B;  3M9B A;  2L5G B;  1SQP K;  3V2R A;  3VP9 A;  4ZKU A;  3KQG A;  1SQX K;  3UIA A;  1ZR4 A;  2OYH C;  2Z4E A;  2KYV A;  1FBM A;  2YKP A;  3U1A A;  3V4W A;  1HJB A;  1SQV K;  1DH3 A;  3N4X A;  2FYU K;  1NTK K;  1XTC C;  1N73 C;  3SWY A;  1SFC B;  1N73 A;  1SFC A;  1N73 B;  3HD7 D;  2QM7 A;  4I6M C;  2XKM A;  1GW4 A;  1RY3 A;  2J58 A;  5CJ4 A;  1GL2 B;  3HD7 B;  1T8Z A;  2H43 A;  3LID A;  2N1T D;  1L0N K;  2R3C A;  1GTW A;  1M1J B;  3RL0 C;  1IFI A;  2PP6 A;  1GL2 D;  4W80 A;  3MIW A;  3BRT B;  3I5C A;  5AVW B;  5AW8 B;  2M3B A;  1MFZ A;  5CCH D;  1NU1 K;  2IPP A;  1CW5 A;  3N7N A;  3GHG A;  2C9N Y;  2KLV A;  1WT6 A;  3GHG B;  3C9I A;  2CPB A;  1CI6 B;  1OXZ A;  4EOT A;  5KLV K;  4DZO A;  3RL0 D;  1URQ C;  1JTH B;  2YKO A;  5AVV B;  1IJD B;  1PFI A;  1GD2 E;  3RK2 D;  1LTJ B;  2WT7 A;  3R2P A;  1LWU C;  1VPC A;  4ZKP A;  2HPC A;  1HBW A;  2XNX A;  1RE3 A;  3G3Z A;  2VRS A;  3RK2 B;  3V2P A;  1ZLL A;  5CCG D;  2FFD A;  2NPS B;  1RF0 C;  2I1J A;  4C7N A;  4WY4 D;  3NFQ A;  4AUW A;  1CZQ A;  1SFC C;  2NPS D;  4JYC A;  2P2U A;  2LKM A;  1HWT C;  1T2K D;  1G2C B;  3V5B A;  1G2C A;  5AVQ B;  1M7L A;  3HE4 B;  2P67 A;  1T2K C;  2KB7 P;  1N7S A;  2YO3 A;  3IR9 A;  2C9L Y;  3EFG A;  3A5T A;  2YO2 A;  1IK9 A;  1KFN A;  2WSC H;  2FFD B;  2OYH B;  3II6 A;  4GT1 A;  4WY4 C;  1RE3 C;  1J1D C;  2HG5 D;  1FOS F;  3TNU A;  3CLQ A;  2WPS A;  2J59 M;  2XZR A;  3HTK A;  2WT7 B;  3B5N B;  1WRG A;  3TK1 A;  1JY2 P;  2ZFC A;  3RK3 B;  4GIF A;  2GUS A;  1FDM A;  2IFM A;  1NTZ K;  3H6P A;  3B5N D;  5AW9 B;  1FZG A;  1X9V A;  4KHX A;  1ZR2 A;  2PAJ A;  1IO4 A;  1E5W A;  2R32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...