1FZGA

Crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRINOGEN
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzgA00
1FZFA 2FFDC 2OYIA 1LWUB 1N86A 2OYHA 1LT9B 1M1JC 1RF1A 1FZGA 2HODB 3GHGB 1LTJB 1FZAA 2HLOA 1RE3C 1FZCA 1JY3P 1LTJA 1LWUA 1RF0C 2XNXA 3H32B 1FZEA 1FZBA 1RE3A 3BVHA 1LTJC 3GHGC 1W2EA 2A45G 1M1JB 3H32A 1LT9C 1LWUC 1RF0A 1N73A 2Z4EA 2HPCA 2Q9IA 1RE4A 1JY2N 2FFDB 2A45I 3HUSB 3GHGA 1FZCB 2A45H 2HPCB 3HUSA 1N73B 1LT9A 2FFDA 1M1JA 1RF1C 1JY3O 2HODA 2OYIB 2OYHB 2OYIC 1RF1B 1JY2O 1RE4C 2OYHC 1T3UA 1N73C 1JY2P 1FZCC 3E1IA 3HUSC 1JY3N 2H43A
chains in the Genus database with same CATH superfamily
5GTHH 5KJ7A 1VQ4P 1KB9I 1URQA 4UB6H 4DOJA 2E42A 1NTKJ 3L71J 3B5NB 2HFED 1SQQE 1KYOH 2NZ2A 3HTKA 3AEFC 3JCUE 3LIDA 3D71A 1X8YA 2W83C 1FZEA 1G2CA 3L72G 2FXMA 3CX5I 4U3FG 1BGYJ 4WBAA 3TNUA 3BCCE 2FBWC 1KILD 1SQVD 1T6AA 1GK6A 1PPJG 1W2EA 2WZ7A 3M91A 1CI6B 2N1TD 2O1KA 3B8EB 3HE5A 3KHUA 5KKZC 4PD4D 3Q5PA 4YPCA 3GHGA 1PP9J 2A45H 2E5YA 4N78E 3HUSA 1VQ6P 5AW9B 1OW7A 4YXDC 1JO5A 1OWAA 2P10A 1GU5A 1EC5A 3L71G 3CMEP 3I56P 3A0HH 2PFXA 1GD2E 1GMJA 3L73J 1EXJA 2ZYAA 1T3JA 4JYCA 3G4SP 2OYIA 2OYHA 2AEFA 3CWBD 1FZGA 5CCHD 1IO4A 5APUA 3L71E 1NWQA 1EDIA 1NAFA 2W27A 2JDIH 2XNDH 4HB1A 4JYBA 3TGUD 2L91A 1EXIA 2ZT9D 1FOSF 1XTCC 1SQXE 3WUVA 2W6BA 2WSCJ 3Q5SA 1L4AA 4I2LC 3C1LA 2MJZA 3FWNA 4NPDA 1U7JA 3V4QA 2W90A 4TT3H 2P2UA 5BVZA 3GHGC 5CCGA 3AE5C 3CCJP 3M0DA 2A45G 1M1JB 1IFNA 1PGQA 3PH0A 4I1LA 3EFFK 4BWNA 1L0LE 1JOCA 1PP9E 4IL6X 4KT0J 2KZIA 2I1KA 2ITAA 2WSEH 1N73B 2D2CD 1SFCB 3B71A 3BRTB 3RK2D 2YXQB 1VQ8P 1Y47A 1RF1B 2YMKA 4WVZA 3MP7B 1JNMA 3C9IA 3LW5J 3CX5H 1SVFA 3L73E 3O6QB 3VTPC 4IOIH 3S4RA 3AE7C 3BVHA 3WUTA 1ZMEC 1NJIQ 1LT9B 3A3YB 1NU1J 1EDKA 3H1HJ 1DH3A 1EQ7A 1NTME 1BCCJ 2B88A 1NTKK 2HODB 1NH4A 2JEEA 2RKLA 2D2CB 2N9BA 1FC2C 2ZT9C 5AW3B 3CXHI 3WU2H 5KLVE 2C9NY 2BEZF 1LTJA 1NTKD 3RK3C 3WMM0 1QVFO 1Q90D 5M1BA 2G3AA 1NAYA 1PFIA 2E75D 3VMAA 2L5GB 1JMMA 5KLIC 1LTBC 2FXOA 3Q2YA 3H6PA 1QVGO 2QJKC 1L0LJ 1NKZB 2AXTE 2V7QH 4BRYB 2WT7A 1CW5A 1NTMK 2OTJP 3CXHH 4O9BA 2R5DA 3LIEA 3A5TA 4H13B 3H1ID 2AEMA 2BEQD 3HD7A 1P84H 3V6IA 3MUDC 1P84D 4IFMA 3MTUE 2GM4A 2GA1A 4PV1B 5TISH 1HGVA 2B87A 1BSNA 1LP1A 3A0BH 3L72E 3MIWA 2IBZD 2WQYC 1IFIA 1DD3A 5AW6B 3SWYA 4D6TG 3CCQP 1VQKP 3L36A 4DT0A 4I7ZB 1T8ZA 5E79E 2YO2A 1VL2A 3QWOC 1LTJB 1KILB 2KP8A 5C39A 1AJYA 1FZCA 2YKOA 2QE7H 5CCGC 3FWLA 3BATA 3KZIH 2Q6QA 3G9RA 3HE5B 2BCCG 3U1CA 1L0LG 5CJ4A 1KC8Q 1SQVJ 1HWTC 4H44D 5AVSB 1JTHB 4WB4A 1EZVE 1KQGB 3HRNA 1PL5A 5AW5B 5AW1B 3BCCG 3GF7A 1P84E 2ZVNB 5CCHC 1K04A 1HGZA 5AVUB 1K8AQ 3E7KA 2Z4EA 3CD6P 2M5AB 2FYUK 4U3FE 3MGNA 5DJTB 1NTZE 3B5NA 3B5ND 5KAIH 3BRVB 3NTNA 4GKGA 1KQFB 4K3AA 1GU4A 5AVWB 4QMAA 2NPSA 1M56D 4Y99B 3M9QA 1J1DB 5GTIH 2H88C 1PPJE 2E5TA 1QLED 5KJ7D 2JWDA 4AYCA 4MN4C 4C7NA 3Q3DA 4A7PA 2NRGA 1Q2NA 3P7KA 4YTPC 3L70D 1IK9A 1GL2A 5AW0B 4EIJA 1NU1K 1L0NG 2AEJA 2E74B 1PGPA 3RBZA 3K5BA 3T97B 3M9HA 1D7MA 1AQTA 1OZHA 3L35A 3M0AA 4PD4H 5KLVD 1GL2C 2W8ZA 2LXCB 3H1LE 1LGHB 2RN0A 3H1LD 3SSUA 5APXA 1JTHA 1YJ9P 1EZVG 5CCHA 1T2KC 1L0LK 1SLQA 3E1RA 4I7ZC 2KS1B 3I5CA 2NPSB 1NTMJ 2PAJA 1HH0A 3AEGC 5CHXA 3VMZA 1JY2N 2QM8A 3F5HA 1GDTA 1S5LH 4PV1C 2C0WA 3ABVC 1L0LD 1YYCA 1KFNA 2HODA 2HYNA 2KOGA 3Q1MA 1CSBA 1RE3A 2J59M 2R5BA 3E1IA 3FXDA 1JY3N 1PPJD 2LR2A 1WRGA 4PJ0H 1OW6A 4W80A 1FDIA 4IL6E 1VQPP 2O01H 2E76B 3QH9A 5KLVK 1SS1A 1YIJP 1NTZD 1BCCE 3D6ZA 2M5AA 2IX7C 5KLIB 3TGUE 2C9LY 1H0TA 3T97A 2M3EA 2O01J 3L71D 1RF0C 2V7QJ 3NXSA 3W68A 3CWBE 1HF9A 2DW3A 1QEXA 3RK3D 1YTZI 3W67A 2JO1A 1SQVK 1OFCX 3GG2A 2ZT9B 3H1KG 3L70G 3L72J 4L76A 2QSIA 3L37A 1AV1A 3AEBC 1LP1B 3HD7D 3TK1A 3L75D 1LTSC 1LT9C 2P67A 1UIXA 2FYNC 2K3RA 4W7YA 2FYUJ 3V4WA 1J2JB 1OXZA 3H1JE 2ZVOB 1KORA 1PGJA 5APWA 4OGQB 4PD4E 2Y9YA 3TF5A 3CI9A 1SQVE 4LGDE 4BRYA 2WT7B 3LW5H 1FZCC 1IK7A 5AW4B 3HUSC 1AFOA 3PTZA 2NPSD 3IFMA 3AE6C 2R3CA 1KQLA 3L73G 2WPRA 1IJDB 3FX0A 1YQ4C 1BDDA 3PLNA 5AVRB 2KSEA 5GTIE 3FGAD 1CZQA 3RGUA 1BDCA 2IZ0A 5K5GB 3H1JJ 3G71P 1LWUA 3IR9A 4PJ0E 3HE4A 2O3JA 4HKZH 5CJ0A 3V2QA 1P84I 5AVQB 5GTHE 1GL2D 2J5UA 3IF4A 1JM0A 2E76D 3CC7P 3H1KJ 4NPEA 2O01N 1MFTA 1S5LE 2JP3A 4HJGH 4JF7A 1SQPG 1NTKE 1LWUC 1OX3A 2WPVB 4RKUJ 4DCKA 1VQLP 1RY3A 4N3YB 1L0NE 1DIPA 4H0LC 1NTMD 3AECC 1FU1A 3VOPA 2FFDA 1WT6A 2Q3EA 3CC2P 3CL3D 2R44A 3H1KD 3CWBJ 3AE1C 3BCCJ 1ZR4A 1KD1Q 1YJWP 5E79H 4H0LB 1H8AA 1E79H 1EDJA 2UWJE 4JBZA 1FZFA 2YKQA 1NU1E 5KKZB 1Q82Q 1LWUB 3A7OA 5TISE 5KLVJ 3USSA 2IYPA 3FXEA 1K73Q 2FYUD 3M06A 1MFZA 1NTZK 1N7SD 1PP9D 1N7SA 1SQQG 2K9YA 2KS1A 2XNXA 3L74G 2PGDA 1VQOP 1URQD 1M90Q 2QA4P 2YO3A 1G1IA 2JWAA 5H2FE 5H2FH 1IFDA 2BCCE 3VN0A 1S4XA 2M3BA 3EQ2A 1R8EA 2FY8A 5KAIE 1DX7A 1H88A 1FAVA 1SQBD 1BE3J 1FDOA 3RL0g 1YHQP 3HUSB 3AE4C 1BE3G 1FZCB 4I6MC 1N8RQ 1KILA 1GK4A 4ZKPA 1FS0E 2Q3IA 3L75J 3TDKA 3V2RA 1NU1D 5APVA 4OGQC 4RJTA 2B89A 1JY2P 2AXCA 2WVRA 3KZIE 4OH8B 1GTWA 2FYNB 3H1KE 1KTMA 5AVYB 3VMYA 4GT1A 3OJAB 1YITP 4H44B 2IPPA 1YTZT 1RHZB 3GLMA 4N78D 3HD7B 5AVVB 2FXPA 4GOFA 1BCCG 1SQQJ 4UB8H 3MHVA 4AUWA 1L2PA 2C0XA 2IYOA 5AVZB 1K9MQ 1YI2P 2KSJA 1FJPA 3KDPB 3MZWB 4IFFA 2OTKE 2E76C 3ZDMA 5CBOA 3L4FA 1KQSO 2Y0DA 1PP9G 1SQQD 3CXHE 3G6EP 3CWBG 2WSFH 2GUSA 2OARA 4U3FD 2XU6A 1M1JA 2VRSA 3TSIA 1EZVD 1S3JA 3MD0A 5CCGD 2FFDC 3AEAC 1NGMB 3I55P 5AVTB 3PHLA 2NPSC 1Y8AA 1N86A 3SWFA 1VQMP 1ZR2A 3KQGA 1G2CB 1RF1A 1AVOA 2CPBA 4GOEA 1X22A 1FZAA 3H1JD 3RL0C 1LTAC 4L74A 2XKMA 1NTZJ 3RBXA 2QJPB 3SFEC 5KTBA 2Y9ZA 1HBWA 1GL2B 1JMBA 3L75E 1JB0J 3EFGA 3CCRP 2IBZE 3S1KA 1HJBA 4K35A 2QG4A 4OWFA 2E74C 3RK3E 5B5EH 4XFJA 2WSEJ 2YMYA 1QX8A 5L8RJ 1L0NK 4HH2A 1MV8A 3H1IE 4GODA 1BCCD 1IC2A 3S9OA 2FKWB 1KYOE 3JCUH 1J1DC 1LT9A 4RESB 2Y0CA 4H0LD 4Y99C 4YXWH 4ZNCA 4IL6H 3CCUP 3GW6A 1A02F 1KV4A 4UB6E 3V2PA 1R5SA 3L70J 4Z1MH 3CPWO 1MKMA 2QRXA 4HYTB 4WY4C 3VP8A 3JSVC 2H89C 1PGOA 1JCCA 2KLUA 3GMAA 1SFCA 1MZ9A 2KK7A 2KZJA 1N7SB 3P32A 1LJ2A 1KB9H 1AA0A 1X9VA 3EWKA 4L73A 4B86A 4TLFA 3H25A 1URQB 1VF5B 2A06G 1OVRA 1SQQK 1DEBA 1QGKB 5B66H 3V2NA 1Y9BA 1E5WA 1AQ5A 2O1JA 1KILC 3AE8C 1JCDA 3L73D 1LTJC 2GUVA 2POHA 4D6TD 3H1JG 4EI2A 3CCEP 2P58A 3SWKA 1X79B 1RH5B 1H0TB 1ZRTD 3D70A 3P8CD 1NTKG 1VF5D 3SFDC 1YQ3C 2JR8A 1S72P 2A06E 1LT1A 4WY4A 2OQQA 4C46A 3CLQA 3L70E 2K37A 5CMZA 1VPCA 2BCCJ 2N1TC 1OVUA 4H13C 4DZOA 1QL2A 1T2KD 1SQPD 2I8DA 3AE9C 3HE4B 4BXLA 2QJYB 1VQ5P 1X0TA 2BASA 3CCMP 1ZP0C 2QJKB 1SQXD 2WSSH 1RQVA 1NTMG 4M3LA 4ZMDA 1S1CX 2KUBA 1KFMA 2HLOA 3WUUA 1H89A 3M0DC 1U57A 4GDOA 1CI6A 1TU3F 2V4HA 5APQA 1VQ9P 2WWWA 3R2PA 5APYA 3RK3B 1ZV8A 1QL1A 4ASWA 2J58A 1OVVA 1SQPE 2D2CC 4WWIA 4C7RA 3CCVP 2LXBA 2WSCH 1GZLA 3OA7A 4CPGA 1Q86Q 2QIWA 1FOSE 3CC4P 1BGYG 1DEEG 3HTKB 4GIFA 4U3FJ 4XE5B 1L0NJ 1RE4A 2Q7CA 2A06D 2R3SA 5AW7B 2N1TA 2YKPA 1FDMA 2KXPB 3G3ZA 3P8CE 2OTLP 4R4MA 5BU8B 1RF1C 2OYIB 2W6AA 2OYHB 3RL0D 2OYIC 2JJLA 2ZJSE 4EYYQ 1SFCC 2ZXEB 2OYHC 1N73C 3CX5D 5CBNA 3L72D 1ZOYC 1YBKA 1WMKA 1USDA 3A0BE 1JEKA 1N2DC 1ZLLA 3AE3C 1HUCA 3AE2C 2CPSA 2N9YB 3BCCD 2QEXP 1OIPA 1HVVA 1M1JC 1SQVG 2PP6A 3GHGB 3KPEA 4Y28J 3L74E 3OW2O 2H7HA 2M8RA 2Z5IA 4PD4I 3CCSP 1JUNA 5BU5A 4IFDK 3H1HD 1KMIZ 2WPSA 4R4LA 1SQBJ 2JKVA 1FZBA 2AXTH 2OGUA 3VP9A 2XZRA 2IDBA 1KZUB 1EZVI 1FE6A 1L4AD 2I1JA 5AVXB 2ZYGA 3MUDA 3N7NA 1KB9D 3H32A 1VQNP 2E74D 2FYZA 2IFNA 2IFMA 2ZXXA 2QJYC 1N73A 3OAKA 3H1HE 3P8MC 2XV5A 2A45I 4U7JA 3WU2E 3L74D 1NO4A 3Q5RA 1NTZG 2N1TB 2HPCB 1NHLA 2K9JB 2IZ1A 1JY3O 3F89A 3AEDC 3IAOA 1HJ0A 3KXDA 1RE4C 3M9BA 4NPFX 3H1LG 5B5EE 1IFJA 2MKVA 1DD4A 1LTTC 1S5LX 2Q1KA 3A2AA 1XTGB 1NOHA 1M8OB 3CX5E 5APTA 2W6JH 2H43A 1SQBG 2RH0A 2KIKA 3VMXA 1BE3E 2P7JA 2QVAA 2WMMA 3L74J 1YJNP 3KYQA 3CMAP 2OYOA 2YNYA 1NU1G 3UIAA 5AW8B 1N7LA 2HR3A 5DJUB 1MUUA 2CK3H 1VF5C 1PIXA 1URQC 3B5NC 1FBMA 1AVYA 2WITA 4C7NB 1W5CE 4RO0A 1USEA 4D6TJ 1N7SC 3GF3A 2K9JA 2IBZG 4AQRD 2Z5HA 4H13D 2ZFCA 3H1IJ 2HPCA 3H1HG 3ITKA 4WY4B 4EDFA 2M0BA 2K1AA 1KN7A 4H44C 3CCLP 3D6YA 2YIUC 3CXHD 2KYVA 1RQUA 1SQXK 3NFQA 1SQPJ 1VDFA 5APSA 5TJHA 5KJ7C 2E75B 1SFCD 3L75G 3H1LJ 1EDLA 3A0HE 4KHXA 3N4XA 1ZW0A 4UB8E 2RMZA 4JPZB 3O8ZA 2XDJA 4OGQD 1LTIC 1ZRTE 2PRRA 2KNCB 4OVNF 1OMIA 1SQBK 3H1IG 4D6TE 1M1KQ 1KILE 2H8PD 1NVOA 3PRJA 1W2BO 1J1EB 1IFPA 1ZN5A 2B87B 2QJPC 4LC1A 1HTLC 3VYIA 1L4AB 3RL0B 5B66E 3NMDA 3C8VA 2KLVA 2ZAEB 1A02J 1KYOI 2FFDB 3IN6A 1SP4A 3RK2C 1FJKA 2FYUG 4ASVA 3U1AA 1SQBE 1LNQA 4JQ0D 4L75A 4W7ZA 1PZQA 5KLVG 1JY2O 1K05A 3II6A 4EOTA 2G8YA 4LLHA 1BGYE 1IZNB 3RK2B 1NKNA 1G1JA 2BCCD 2WTYA 1LTGC 2ZYDA 3U59A 4PV1D 1M7LA 1OW8A 2KNCA 1KYOD 3JC22 1Q7YQ 1L4AC 1R5LA 1S9KD 2QM7A 1RE3C 3BASA 1J1EC 4ZKUA 1JY3P 2FYUE 1GW4A 1PV3A 2K88A 2Q5UA 2SPZA 3AEEC 1BE3D 3H32B 5KAFH 2R32A 2YXRB 2B9BA 1VQ7P 3O6QA 3PP5A 5EFWB 3V5BA 2IBZI 4N6JA 1M57D 3HD7C 3TNUB 3TYYA 2KB7P 5AW2B 1SQXG 1S2EA 2KI7B 4DJGA 2WPQA 1RF0A 3PJSK 5KAFE 2Q9IA 2P1JA 3R4YA 4WY4D 1IFMA 1L0ND 2Y0EA 2E75C 3TGUJ 3B4SA 1S9KE 1NYHA 1UIIA 1ZXGA 2WSFJ 4XA4A 3TGUG 1SQXJ 1Q81Q 1BSHA 2LKMA 1SQPK 1KB9E 1T3UA 2YIUB 4KJMA 1U7MA 2E43A 1GW3A 2HG5D 1BGYD 1Z56A
chains in the Genus database with same CATH topology
5KJ7A 1URQA 4DOJA 2E42A 3B5NB 2HFED 3LIDA 3HTKA 1X8YA 1FZEA 1G2CA 2FXMA 4WBAA 3TNUA 1KILD 1W2EA 3M91A 1GK6A 2WZ7A 1CI6B 2N1TD 2O1KA 3B8EB 3HE5A 3GHGA 4N78E 2A45H 3HUSA 1JO5A 1OWAA 1GU5A 1GD2E 1T3JA 4JYCA 2OYIA 2OYHA 1FZGA 1IO4A 5APUA 1NAFA 2W27A 4JYBA 1FOSF 1XTCC 2W6BA 1L4AA 4I2LC 2MJZA 3V4QA 2P2UA 5BVZA 3GHGC 5CCGA 3M0DA 2A45G 1M1JB 1IFNA 4I1LA 1JOCA 2I1KA 2WSEH 1N73B 1SFCB 3BRTB 3RK2D 1RF1B 1JNMA 3C9IA 1SVFA 3VTPC 1LT9B 3A3YB 1DH3A 1JUNA 1EQ7A 2HODB 2JEEA 1H89A 1NTKK 5AW3B 1NH4A 4DZOA 2N9BA 2C9NY 1LTJA 3WMM0 3RK3C 1PFIA 2L5GB 1JMMA 1LTBC 3H6PA 1NKZB 2WT7A 1CW5A 1NTMK 4O9BA 2R5DA 3LIEA 3A5TA 3HD7A 4IFMA 3MTUE 2GM4A 1HGVA 3SWYA 3MIWA 5AW6B 1IFIA 3L36A 1T8ZA 2YO2A 1LTJB 1KILB 2KP8A 1FZCA 2YKOA 5CCGC 3BATA 3HE5B 3U1CA 5CJ4A 1HWTC 5AVSB 1JTHB 4WB4A 3HRNA 5AW5B 5AW1B 5CCHC 2Z4EA 1HGZA 5AVUB 2FYUK 3MGNA 3B5NA 3B5ND 3BRVB 3NTNA 4GKGA 1GU4A 5AVWB 2NPSA 4Y99B 3M9QA 1J1DB 4AYCA 4C7NA 5KJ7D 3P7KA 1IK9A 1GL2A 5AW0B 1NU1K 3M9HA 3L35A 3M0AA 1GL2C 1LGHB 5APXA 1JTHA 1L0LK 1SLQA 3I5CA 2NPSB 2PAJA 5CHXA 1HH0A 3VMZA 1JY2N 2QM8A 1GDTA 2C0WA 1YYCA 1KFNA 2HODA 2HYNA 2KOGA 1CSBA 1RE3A 2J59M 2R5BA 3E1IA 1JY3N 1WRGA 4W80A 2O01H 5KLVK 2IX7C 2C9LY 3T97A 1RF0C 3NXSA 3RK3D 1YTZI 1SQVK 3BVHA 3L37A 3HD7D 3TK1A 1LTSC 1LT9C 2P67A 4W7YA 3V4WA 1J2JB 1OXZA 5APWA 3CI9A 2WT7B 4LGDE 3LW5H 1FZCC 5AW4B 3HUSC 1AFOA 2NPSD 3IFMA 2R3CA 1KQLA 5AW2B 2WPRA 1IJDB 5AVRB 1CZQA 1LWUA 3IR9A 3HE4A 5CJ0A 3V2QA 5AVQB 1GL2D 4JF7A 1LWUC 1RY3A 4N3YB 1FU1A 3VOPA 2FFDA 1WT6A 3CL3D 1ZR4A 1H8AA 1FZFA 2YKQA 1LWUB 3A7OA 3M06A 1MFZA 1NTZK 1N7SD 1N7SA 2XNXA 1URQD 2YO3A 1G1IA 3VN0A 1IFDA 2M3BA 3EQ2A 1DX7A 1H88A 1FAVA 3HUSB 1FZCB 4I6MC 1KILA 1GK4A 4ZKPA 2Q3IA 3V2RA 5APVA 1JY2P 4OH8B 1GTWA 5AVYB 3VMYA 4GT1A 3OJAB 2IPPA 1YTZT 4N78D 3HD7B 5AVVB 4AUWA 2C0XA 5AVZB 1FJPA 2KSJA 3KDPB 4IFFA 3L4FA 2WSFH 2GUSA 2OARA 2XU6A 1M1JA 2VRSA 3TSIA 3MD0A 5CCGD 2FFDC 5AVTB 2NPSC 1ZR2A 1N86A 3SWFA 3KQGA 1G2CB 1RF1A 2CPBA 3RL0C 1FZAA 1LTAC 2XKMA 5KTBA 1GL2B 3EFGA 1HJBA 2YMYA 1L0NK 4HH2A 1MV8A 1IC2A 2FKWB 4RESB 1J1DC 1LT9A 4Y99C 1A02F 3V2PA 4WY4C 3VP8A 4HYTB 1T2KC 1JCCA 1SFCA 1MZ9A 3P32A 1N7SB 1X9VA 4B86A 1URQB 1SQQK 1DEBA 3V2NA 1AQ5A 1E5WA 2O1JA 1KILC 1JCDA 1LTJC 2GUVA 2POHA 1X79B 3P8CD 4WY4A 4C46A 3CLQA 5CMZA 1VPCA 2N1TC 1QL2A 1T2KD 3HE4B 2BASA 4M3LA 1KFMA 2HLOA 3M0DC 5APQA 1CI6A 2WWWA 3R2PA 5APYA 3RK3B 1ZV8A 1QL1A 2J58A 4C7RA 2WSCH 1GZLA 3OA7A 1FOSE 3HTKB 4GIFA 4XE5B 1RE4A 2Q7CA 5AW7B 2N1TA 2YKPA 1FDMA 3G3ZA 3P8CE 5BU8B 1RF1C 2OYIB 2W6AA 2OYHB 3RL0D 2OYIC 2JJLA 2OYHC 1SFCC 2ZXEB 1N73C 5AW9B 1HBWA 1N2DC 1ZLLA 1HUCA 2CPSA 1HVVA 1M1JC 2H7HA 2PP6A 3GHGB 3KPEA 2M8RA 2Z5IA 5BU5A 4IFDK 2WPSA 1FZBA 3VP9A 2XZRA 1KZUB 1L4AD 2I1JA 5AVXB 3MUDA 3N7NA 3H32A 2FYZA 2IFNA 2IFMA 1N73A 3OAKA 3P8MC 2XV5A 2A45I 1NO4A 2HPCB 2N1TB 1NHLA 1JY3O 4EIJA 3M9BA 1RE4C 1IFJA 3A2AA 1LTTC 5CCHA 5APTA 5CCHD 1NWQA 1XTGB 1NOHA 2H43A 3VMXA 2P7JA 3KYQA 2YNYA 3UIAA 5AW8B 1N7LA 1MUUA 1URQC 3B5NC 1FBMA 2WITA 4C7NB 1N7SC 4AQRD 2Z5HA 2HPCA 2ZFCA 4WY4B 2KYVA 1SQXK 3NFQA 5APSA 1VDFA 5KJ7C 1SFCD 4KHXA 3N4XA 3O8ZA 2XDJA 1LTIC 1SQBK 2H8PD 1J1EB 1ZN5A 4LC1A 1HTLC 3VYIA 1L4AB 3RL0B 3NMDA 2KLVA 1A02J 2FFDB 1SP4A 3RK2C 1FJKA 3U1AA 4W7ZA 4EOTA 1JY2O 3II6A 4LLHA 3RK2B 1NKNA 1G1JA 2WTYA 1LTGC 3U59A 1M7LA 1L4AC 1S9KD 2QM7A 1RE3C 3BASA 1J1EC 4ZKUA 1JY3P 1GW4A 2Q5UA 3H32B 2R32A 3PP5A 3V5BA 4N6JA 3TNUB 3HD7C 3TYYA 2KB7P 2WPQA 1RF0A 2Q9IA 2P1JA 4WY4D 1IFMA 1S9KE 4XA4A 2LKMA 1SQPK 1T3UA 2E43A 1GW3A 2HG5D 1Z56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZF A;  2FFD C;  2OYI A;  1LWU B;  1N86 A;  2OYH A;  1LT9 B;  1M1J C;  1RF1 A;  1FZG A;  2HOD B;  3GHG B;  1LTJ B;  1FZA A;  2HLO A;  1RE3 C;  1FZC A;  1JY3 P;  1LTJ A;  1LWU A;  1RF0 C;  2XNX A;  3H32 B;  1FZE A;  1FZB A;  1RE3 A;  3BVH A;  1LTJ C;  3GHG C;  1W2E A;  2A45 G;  1M1J B;  3H32 A;  1LT9 C;  1LWU C;  1RF0 A;  1N73 A;  2Z4E A;  2HPC A;  2Q9I A;  1RE4 A;  1JY2 N;  2FFD B;  2A45 I;  3HUS B;  3GHG A;  1FZC B;  2A45 H;  2HPC B;  3HUS A;  1N73 B;  1LT9 A;  2FFD A;  1M1J A;  1RF1 C;  1JY3 O;  2HOD A;  2OYI B;  2OYH B;  2OYI C;  1RF1 B;  1JY2 O;  1RE4 C;  2OYH C;  1T3U A;  1N73 C;  1JY2 P;  1FZC C;  3E1I A;  3HUS C;  1JY3 N;  2H43 A; 
#chains in the Genus database with same CATH topology
 5GTH H;  5KJ7 A;  1VQ4 P;  1KB9 I;  1URQ A;  4UB6 H;  4DOJ A;  2E42 A;  1NTK J;  3L71 J;  3B5N B;  2HFE D;  1SQQ E;  1KYO H;  2NZ2 A;  3HTK A;  3AEF C;  3JCU E;  3LID A;  3D71 A;  1X8Y A;  2W83 C;  1FZE A;  1G2C A;  3L72 G;  2FXM A;  3CX5 I;  4U3F G;  1BGY J;  4WBA A;  3TNU A;  3BCC E;  2FBW C;  1KIL D;  1SQV D;  1T6A A;  1GK6 A;  1PPJ G;  1W2E A;  2WZ7 A;  3M91 A;  1CI6 B;  2N1T D;  2O1K A;  3B8E B;  3HE5 A;  3KHU A;  5KKZ C;  4PD4 D;  3Q5P A;  4YPC A;  3GHG A;  1PP9 J;  2A45 H;  2E5Y A;  4N78 E;  3HUS A;  1VQ6 P;  5AW9 B;  1OW7 A;  4YXD C;  1JO5 A;  1OWA A;  2P10 A;  1GU5 A;  1EC5 A;  3L71 G;  3CME P;  3I56 P;  3A0H H;  2PFX A;  1GD2 E;  1GMJ A;  3L73 J;  1EXJ A;  2ZYA A;  1T3J A;  4JYC A;  3G4S P;  2OYI A;  2OYH A;  2AEF A;  3CWB D;  1FZG A;  5CCH D;  1IO4 A;  5APU A;  3L71 E;  1NWQ A;  1EDI A;  1NAF A;  2W27 A;  2JDI H;  2XND H;  4HB1 A;  4JYB A;  3TGU D;  2L91 A;  1EXI A;  2ZT9 D;  1FOS F;  1XTC C;  1SQX E;  3WUV A;  2W6B A;  2WSC J;  3Q5S A;  1L4A A;  4I2L C;  3C1L A;  2MJZ A;  3FWN A;  4NPD A;  1U7J A;  3V4Q A;  2W90 A;  4TT3 H;  2P2U A;  5BVZ A;  3GHG C;  5CCG A;  3AE5 C;  3CCJ P;  3M0D A;  2A45 G;  1M1J B;  1IFN A;  1PGQ A;  3PH0 A;  4I1L A;  3EFF K;  4BWN A;  1L0L E;  1JOC A;  1PP9 E;  4IL6 X;  4KT0 J;  2KZI A;  2I1K A;  2ITA A;  2WSE H;  1N73 B;  2D2C D;  1SFC B;  3B71 A;  3BRT B;  3RK2 D;  2YXQ B;  1VQ8 P;  1Y47 A;  1RF1 B;  2YMK A;  4WVZ A;  3MP7 B;  1JNM A;  3C9I A;  3LW5 J;  3CX5 H;  1SVF A;  3L73 E;  3O6Q B;  3VTP C;  4IOI H;  3S4R A;  3AE7 C;  3BVH A;  3WUT A;  1ZME C;  1NJI Q;  1LT9 B;  3A3Y B;  1NU1 J;  1EDK A;  3H1H J;  1DH3 A;  1EQ7 A;  1NTM E;  1BCC J;  2B88 A;  1NTK K;  2HOD B;  1NH4 A;  2JEE A;  2RKL A;  2D2C B;  2N9B A;  1FC2 C;  2ZT9 C;  5AW3 B;  3CXH I;  3WU2 H;  5KLV E;  2C9N Y;  2BEZ F;  1LTJ A;  1NTK D;  3RK3 C;  3WMM 0;  1QVF O;  1Q90 D;  5M1B A;  2G3A A;  1NAY A;  1PFI A;  2E75 D;  3VMA A;  2L5G B;  1JMM A;  5KLI C;  1LTB C;  2FXO A;  3Q2Y A;  3H6P A;  1QVG O;  2QJK C;  1L0L J;  1NKZ B;  2AXT E;  2V7Q H;  4BRY B;  2WT7 A;  1CW5 A;  1NTM K;  2OTJ P;  3CXH H;  4O9B A;  2R5D A;  3LIE A;  3A5T A;  4H13 B;  3H1I D;  2AEM A;  2BEQ D;  3HD7 A;  1P84 H;  3V6I A;  3MUD C;  1P84 D;  4IFM A;  3MTU E;  2GM4 A;  2GA1 A;  4PV1 B;  5TIS H;  1HGV A;  2B87 A;  1BSN A;  1LP1 A;  3A0B H;  3L72 E;  3MIW A;  2IBZ D;  2WQY C;  1IFI A;  1DD3 A;  5AW6 B;  3SWY A;  4D6T G;  3CCQ P;  1VQK P;  3L36 A;  4DT0 A;  4I7Z B;  1T8Z A;  5E79 E;  2YO2 A;  1VL2 A;  3QWO C;  1LTJ B;  1KIL B;  2KP8 A;  5C39 A;  1AJY A;  1FZC A;  2YKO A;  2QE7 H;  5CCG C;  3FWL A;  3BAT A;  3KZI H;  2Q6Q A;  3G9R A;  3HE5 B;  2BCC G;  3U1C A;  1L0L G;  5CJ4 A;  1KC8 Q;  1SQV J;  1HWT C;  4H44 D;  5AVS B;  1JTH B;  4WB4 A;  1EZV E;  1KQG B;  3HRN A;  1PL5 A;  5AW5 B;  5AW1 B;  3BCC G;  3GF7 A;  1P84 E;  2ZVN B;  5CCH C;  1K04 A;  1HGZ A;  5AVU B;  1K8A Q;  3E7K A;  2Z4E A;  3CD6 P;  2M5A B;  2FYU K;  4U3F E;  3MGN A;  5DJT B;  1NTZ E;  3B5N A;  3B5N D;  5KAI H;  3BRV B;  3NTN A;  4GKG A;  1KQF B;  4K3A A;  1GU4 A;  5AVW B;  4QMA A;  2NPS A;  1M56 D;  4Y99 B;  3M9Q A;  1J1D B;  5GTI H;  2H88 C;  1PPJ E;  2E5T A;  1QLE D;  5KJ7 D;  2JWD A;  4AYC A;  4MN4 C;  4C7N A;  3Q3D A;  4A7P A;  2NRG A;  1Q2N A;  3P7K A;  4YTP C;  3L70 D;  1IK9 A;  1GL2 A;  5AW0 B;  4EIJ A;  1NU1 K;  1L0N G;  2AEJ A;  2E74 B;  1PGP A;  3RBZ A;  3K5B A;  3T97 B;  3M9H A;  1D7M A;  1AQT A;  1OZH A;  3L35 A;  3M0A A;  4PD4 H;  5KLV D;  1GL2 C;  2W8Z A;  2LXC B;  3H1L E;  1LGH B;  2RN0 A;  3H1L D;  3SSU A;  5APX A;  1JTH A;  1YJ9 P;  1EZV G;  5CCH A;  1T2K C;  1L0L K;  1SLQ A;  3E1R A;  4I7Z C;  2KS1 B;  3I5C A;  2NPS B;  1NTM J;  2PAJ A;  1HH0 A;  3AEG C;  5CHX A;  3VMZ A;  1JY2 N;  2QM8 A;  3F5H A;  1GDT A;  1S5L H;  4PV1 C;  2C0W A;  3ABV C;  1L0L D;  1YYC A;  1KFN A;  2HOD A;  2HYN A;  2KOG A;  3Q1M A;  1CSB A;  1RE3 A;  2J59 M;  2R5B A;  3E1I A;  3FXD A;  1JY3 N;  1PPJ D;  2LR2 A;  1WRG A;  4PJ0 H;  1OW6 A;  4W80 A;  1FDI A;  4IL6 E;  1VQP P;  2O01 H;  2E76 B;  3QH9 A;  5KLV K;  1SS1 A;  1YIJ P;  1NTZ D;  1BCC E;  3D6Z A;  2M5A A;  2IX7 C;  5KLI B;  3TGU E;  2C9L Y;  1H0T A;  3T97 A;  2M3E A;  2O01 J;  3L71 D;  1RF0 C;  2V7Q J;  3NXS A;  3W68 A;  3CWB E;  1HF9 A;  2DW3 A;  1QEX A;  3RK3 D;  1YTZ I;  3W67 A;  2JO1 A;  1SQV K;  1OFC X;  3GG2 A;  2ZT9 B;  3H1K G;  3L70 G;  3L72 J;  4L76 A;  2QSI A;  3L37 A;  1AV1 A;  3AEB C;  1LP1 B;  3HD7 D;  3TK1 A;  3L75 D;  1LTS C;  1LT9 C;  2P67 A;  1UIX A;  2FYN C;  2K3R A;  4W7Y A;  2FYU J;  3V4W A;  1J2J B;  1OXZ A;  3H1J E;  2ZVO B;  1KOR A;  1PGJ A;  5APW A;  4OGQ B;  4PD4 E;  2Y9Y A;  3TF5 A;  3CI9 A;  1SQV E;  4LGD E;  4BRY A;  2WT7 B;  3LW5 H;  1FZC C;  1IK7 A;  5AW4 B;  3HUS C;  1AFO A;  3PTZ A;  2NPS D;  3IFM A;  3AE6 C;  2R3C A;  1KQL A;  3L73 G;  2WPR A;  1IJD B;  3FX0 A;  1YQ4 C;  1BDD A;  3PLN A;  5AVR B;  2KSE A;  5GTI E;  3FGA D;  1CZQ A;  3RGU A;  1BDC A;  2IZ0 A;  5K5G B;  3H1J J;  3G71 P;  1LWU A;  3IR9 A;  4PJ0 E;  3HE4 A;  2O3J A;  4HKZ H;  5CJ0 A;  3V2Q A;  1P84 I;  5AVQ B;  5GTH E;  1GL2 D;  2J5U A;  3IF4 A;  1JM0 A;  2E76 D;  3CC7 P;  3H1K J;  4NPE A;  2O01 N;  1MFT A;  1S5L E;  2JP3 A;  4HJG H;  4JF7 A;  1SQP G;  1NTK E;  1LWU C;  1OX3 A;  2WPV B;  4RKU J;  4DCK A;  1VQL P;  1RY3 A;  4N3Y B;  1L0N E;  1DIP A;  4H0L C;  1NTM D;  3AEC C;  1FU1 A;  3VOP A;  2FFD A;  1WT6 A;  2Q3E A;  3CC2 P;  3CL3 D;  2R44 A;  3H1K D;  3CWB J;  3AE1 C;  3BCC J;  1ZR4 A;  1KD1 Q;  1YJW P;  5E79 H;  4H0L B;  1H8A A;  1E79 H;  1EDJ A;  2UWJ E;  4JBZ A;  1FZF A;  2YKQ A;  1NU1 E;  5KKZ B;  1Q82 Q;  1LWU B;  3A7O A;  5TIS E;  5KLV J;  3USS A;  2IYP A;  3FXE A;  1K73 Q;  2FYU D;  3M06 A;  1MFZ A;  1NTZ K;  1N7S D;  1PP9 D;  1N7S A;  1SQQ G;  2K9Y A;  2KS1 A;  2XNX A;  3L74 G;  2PGD A;  1VQO P;  1URQ D;  1M90 Q;  2QA4 P;  2YO3 A;  1G1I A;  2JWA A;  5H2F E;  5H2F H;  1IFD A;  2BCC E;  3VN0 A;  1S4X A;  2M3B A;  3EQ2 A;  1R8E A;  2FY8 A;  5KAI E;  1DX7 A;  1H88 A;  1FAV A;  1SQB D;  1BE3 J;  1FDO A;  3RL0 g;  1YHQ P;  3HUS B;  3AE4 C;  1BE3 G;  1FZC B;  4I6M C;  1N8R Q;  1KIL A;  1GK4 A;  4ZKP A;  1FS0 E;  2Q3I A;  3L75 J;  3TDK A;  3V2R A;  1NU1 D;  5APV A;  4OGQ C;  4RJT A;  2B89 A;  1JY2 P;  2AXC A;  2WVR A;  3KZI E;  4OH8 B;  1GTW A;  2FYN B;  3H1K E;  1KTM A;  5AVY B;  3VMY A;  4GT1 A;  3OJA B;  1YIT P;  4H44 B;  2IPP A;  1YTZ T;  1RHZ B;  3GLM A;  4N78 D;  3HD7 B;  5AVV B;  2FXP A;  4GOF A;  1BCC G;  1SQQ J;  4UB8 H;  3MHV A;  4AUW A;  1L2P A;  2C0X A;  2IYO A;  5AVZ B;  1K9M Q;  1YI2 P;  2KSJ A;  1FJP A;  3KDP B;  3MZW B;  4IFF A;  2OTK E;  2E76 C;  3ZDM A;  5CBO A;  3L4F A;  1KQS O;  2Y0D A;  1PP9 G;  1SQQ D;  3CXH E;  3G6E P;  3CWB G;  2WSF H;  2GUS A;  2OAR A;  4U3F D;  2XU6 A;  1M1J A;  2VRS A;  3TSI A;  1EZV D;  1S3J A;  3MD0 A;  5CCG D;  2FFD C;  3AEA C;  1NGM B;  3I55 P;  5AVT B;  3PHL A;  2NPS C;  1Y8A A;  1N86 A;  3SWF A;  1VQM P;  1ZR2 A;  3KQG A;  1G2C B;  1RF1 A;  1AVO A;  2CPB A;  4GOE A;  1X22 A;  1FZA A;  3H1J D;  3RL0 C;  1LTA C;  4L74 A;  2XKM A;  1NTZ J;  3RBX A;  2QJP B;  3SFE C;  5KTB A;  2Y9Z A;  1HBW A;  1GL2 B;  1JMB A;  3L75 E;  1JB0 J;  3EFG A;  3CCR P;  2IBZ E;  3S1K A;  1HJB A;  4K35 A;  2QG4 A;  4OWF A;  2E74 C;  3RK3 E;  5B5E H;  4XFJ A;  2WSE J;  2YMY A;  1QX8 A;  5L8R J;  1L0N K;  4HH2 A;  1MV8 A;  3H1I E;  4GOD A;  1BCC D;  1IC2 A;  3S9O A;  2FKW B;  1KYO E;  3JCU H;  1J1D C;  1LT9 A;  4RES B;  2Y0C A;  4H0L D;  4Y99 C;  4YXW H;  4ZNC A;  4IL6 H;  3CCU P;  3GW6 A;  1A02 F;  1KV4 A;  4UB6 E;  3V2P A;  1R5S A;  3L70 J;  4Z1M H;  3CPW O;  1MKM A;  2QRX A;  4HYT B;  4WY4 C;  3VP8 A;  3JSV C;  2H89 C;  1PGO A;  1JCC A;  2KLU A;  3GMA A;  1SFC A;  1MZ9 A;  2KK7 A;  2KZJ A;  1N7S B;  3P32 A;  1LJ2 A;  1KB9 H;  1AA0 A;  1X9V A;  3EWK A;  4L73 A;  4B86 A;  4TLF A;  3H25 A;  1URQ B;  1VF5 B;  2A06 G;  1OVR A;  1SQQ K;  1DEB A;  1QGK B;  5B66 H;  3V2N A;  1Y9B A;  1E5W A;  1AQ5 A;  2O1J A;  1KIL C;  3AE8 C;  1JCD A;  3L73 D;  1LTJ C;  2GUV A;  2POH A;  4D6T D;  3H1J G;  4EI2 A;  3CCE P;  2P58 A;  3SWK A;  1X79 B;  1RH5 B;  1H0T B;  1ZRT D;  3D70 A;  3P8C D;  1NTK G;  1VF5 D;  3SFD C;  1YQ3 C;  2JR8 A;  1S72 P;  2A06 E;  1LT1 A;  4WY4 A;  2OQQ A;  4C46 A;  3CLQ A;  3L70 E;  2K37 A;  5CMZ A;  1VPC A;  2BCC J;  2N1T C;  1OVU A;  4H13 C;  4DZO A;  1QL2 A;  1T2K D;  1SQP D;  2I8D A;  3AE9 C;  3HE4 B;  4BXL A;  2QJY B;  1VQ5 P;  1X0T A;  2BAS A;  3CCM P;  1ZP0 C;  2QJK B;  1SQX D;  2WSS H;  1RQV A;  1NTM G;  4M3L A;  4ZMD A;  1S1C X;  2KUB A;  1KFM A;  2HLO A;  3WUU A;  1H89 A;  3M0D C;  1U57 A;  4GDO A;  1CI6 A;  1TU3 F;  2V4H A;  5APQ A;  1VQ9 P;  2WWW A;  3R2P A;  5APY A;  3RK3 B;  1ZV8 A;  1QL1 A;  4ASW A;  2J58 A;  1OVV A;  1SQP E;  2D2C C;  4WWI A;  4C7R A;  3CCV P;  2LXB A;  2WSC H;  1GZL A;  3OA7 A;  4CPG A;  1Q86 Q;  2QIW A;  1FOS E;  3CC4 P;  1BGY G;  1DEE G;  3HTK B;  4GIF A;  4U3F J;  4XE5 B;  1L0N J;  1RE4 A;  2Q7C A;  2A06 D;  2R3S A;  5AW7 B;  2N1T A;  2YKP A;  1FDM A;  2KXP B;  3G3Z A;  3P8C E;  2OTL P;  4R4M A;  5BU8 B;  1RF1 C;  2OYI B;  2W6A A;  2OYH B;  3RL0 D;  2OYI C;  2JJL A;  2ZJS E;  4EYY Q;  1SFC C;  2ZXE B;  2OYH C;  1N73 C;  3CX5 D;  5CBN A;  3L72 D;  1ZOY C;  1YBK A;  1WMK A;  1USD A;  3A0B E;  1JEK A;  1N2D C;  1ZLL A;  3AE3 C;  1HUC A;  3AE2 C;  2CPS A;  2N9Y B;  3BCC D;  2QEX P;  1OIP A;  1HVV A;  1M1J C;  1SQV G;  2PP6 A;  3GHG B;  3KPE A;  4Y28 J;  3L74 E;  3OW2 O;  2H7H A;  2M8R A;  2Z5I A;  4PD4 I;  3CCS P;  1JUN A;  5BU5 A;  4IFD K;  3H1H D;  1KMI Z;  2WPS A;  4R4L A;  1SQB J;  2JKV A;  1FZB A;  2AXT H;  2OGU A;  3VP9 A;  2XZR A;  2IDB A;  1KZU B;  1EZV I;  1FE6 A;  1L4A D;  2I1J A;  5AVX B;  2ZYG A;  3MUD A;  3N7N A;  1KB9 D;  3H32 A;  1VQN P;  2E74 D;  2FYZ A;  2IFN A;  2IFM A;  2ZXX A;  2QJY C;  1N73 A;  3OAK A;  3H1H E;  3P8M C;  2XV5 A;  2A45 I;  4U7J A;  3WU2 E;  3L74 D;  1NO4 A;  3Q5R A;  1NTZ G;  2N1T B;  2HPC B;  1NHL A;  2K9J B;  2IZ1 A;  1JY3 O;  3F89 A;  3AED C;  3IAO A;  1HJ0 A;  3KXD A;  1RE4 C;  3M9B A;  4NPF X;  3H1L G;  5B5E E;  1IFJ A;  2MKV A;  1DD4 A;  1LTT C;  1S5L X;  2Q1K A;  3A2A A;  1XTG B;  1NOH A;  1M8O B;  3CX5 E;  5APT A;  2W6J H;  2H43 A;  1SQB G;  2RH0 A;  2KIK A;  3VMX A;  1BE3 E;  2P7J A;  2QVA A;  2WMM A;  3L74 J;  1YJN P;  3KYQ A;  3CMA P;  2OYO A;  2YNY A;  1NU1 G;  3UIA A;  5AW8 B;  1N7L A;  2HR3 A;  5DJU B;  1MUU A;  2CK3 H;  1VF5 C;  1PIX A;  1URQ C;  3B5N C;  1FBM A;  1AVY A;  2WIT A;  4C7N B;  1W5C E;  4RO0 A;  1USE A;  4D6T J;  1N7S C;  3GF3 A;  2K9J A;  2IBZ G;  4AQR D;  2Z5H A;  4H13 D;  2ZFC A;  3H1I J;  2HPC A;  3H1H G;  3ITK A;  4WY4 B;  4EDF A;  2M0B A;  2K1A A;  1KN7 A;  4H44 C;  3CCL P;  3D6Y A;  2YIU C;  3CXH D;  2KYV A;  1RQU A;  1SQX K;  3NFQ A;  1SQP J;  1VDF A;  5APS A;  5TJH A;  5KJ7 C;  2E75 B;  1SFC D;  3L75 G;  3H1L J;  1EDL A;  3A0H E;  4KHX A;  3N4X A;  1ZW0 A;  4UB8 E;  2RMZ A;  4JPZ B;  3O8Z A;  2XDJ A;  4OGQ D;  1LTI C;  1ZRT E;  2PRR A;  2KNC B;  4OVN F;  1OMI A;  1SQB K;  3H1I G;  4D6T E;  1M1K Q;  1KIL E;  2H8P D;  1NVO A;  3PRJ A;  1W2B O;  1J1E B;  1IFP A;  1ZN5 A;  2B87 B;  2QJP C;  4LC1 A;  1HTL C;  3VYI A;  1L4A B;  3RL0 B;  5B66 E;  3NMD A;  3C8V A;  2KLV A;  2ZAE B;  1A02 J;  1KYO I;  2FFD B;  3IN6 A;  1SP4 A;  3RK2 C;  1FJK A;  2FYU G;  4ASV A;  3U1A A;  1SQB E;  1LNQ A;  4JQ0 D;  4L75 A;  4W7Z A;  1PZQ A;  5KLV G;  1JY2 O;  1K05 A;  3II6 A;  4EOT A;  2G8Y A;  4LLH A;  1BGY E;  1IZN B;  3RK2 B;  1NKN A;  1G1J A;  2BCC D;  2WTY A;  1LTG C;  2ZYD A;  3U59 A;  4PV1 D;  1M7L A;  1OW8 A;  2KNC A;  1KYO D;  3JC2 2;  1Q7Y Q;  1L4A C;  1R5L A;  1S9K D;  2QM7 A;  1RE3 C;  3BAS A;  1J1E C;  4ZKU A;  1JY3 P;  2FYU E;  1GW4 A;  1PV3 A;  2K88 A;  2Q5U A;  2SPZ A;  3AEE C;  1BE3 D;  3H32 B;  5KAF H;  2R32 A;  2YXR B;  2B9B A;  1VQ7 P;  3O6Q A;  3PP5 A;  5EFW B;  3V5B A;  2IBZ I;  4N6J A;  1M57 D;  3HD7 C;  3TNU B;  3TYY A;  2KB7 P;  5AW2 B;  1SQX G;  1S2E A;  2KI7 B;  4DJG A;  2WPQ A;  1RF0 A;  3PJS K;  5KAF E;  2Q9I A;  2P1J A;  3R4Y A;  4WY4 D;  1IFM A;  1L0N D;  2Y0E A;  2E75 C;  3TGU J;  3B4S A;  1S9K E;  1NYH A;  1UII A;  1ZXG A;  2WSF J;  4XA4 A;  3TGU G;  1SQX J;  1Q81 Q;  1BSH A;  2LKM A;  1SQP K;  1KB9 E;  1T3U A;  2YIU B;  4KJM A;  1U7M A;  2E43 A;  1GW3 A;  2HG5 D;  1BGY D;  1Z56 A; 
#chains in the Genus database with same CATH homology
 5KJ7 A;  1URQ A;  4DOJ A;  2E42 A;  3B5N B;  2HFE D;  3LID A;  3HTK A;  1X8Y A;  1FZE A;  1G2C A;  2FXM A;  4WBA A;  3TNU A;  1KIL D;  1W2E A;  3M91 A;  1GK6 A;  2WZ7 A;  1CI6 B;  2N1T D;  2O1K A;  3B8E B;  3HE5 A;  3GHG A;  4N78 E;  2A45 H;  3HUS A;  1JO5 A;  1OWA A;  1GU5 A;  1GD2 E;  1T3J A;  4JYC A;  2OYI A;  2OYH A;  1FZG A;  1IO4 A;  5APU A;  1NAF A;  2W27 A;  4JYB A;  1FOS F;  1XTC C;  2W6B A;  1L4A A;  4I2L C;  2MJZ A;  3V4Q A;  2P2U A;  5BVZ A;  3GHG C;  5CCG A;  3M0D A;  2A45 G;  1M1J B;  1IFN A;  4I1L A;  1JOC A;  2I1K A;  2WSE H;  1N73 B;  1SFC B;  3BRT B;  3RK2 D;  1RF1 B;  1JNM A;  3C9I A;  1SVF A;  3VTP C;  1LT9 B;  3A3Y B;  1DH3 A;  1JUN A;  1EQ7 A;  2HOD B;  2JEE A;  1H89 A;  1NTK K;  5AW3 B;  1NH4 A;  4DZO A;  2N9B A;  2C9N Y;  1LTJ A;  3WMM 0;  3RK3 C;  1PFI A;  2L5G B;  1JMM A;  1LTB C;  3H6P A;  1NKZ B;  2WT7 A;  1CW5 A;  1NTM K;  4O9B A;  2R5D A;  3LIE A;  3A5T A;  3HD7 A;  4IFM A;  3MTU E;  2GM4 A;  1HGV A;  3SWY A;  3MIW A;  5AW6 B;  1IFI A;  3L36 A;  1T8Z A;  2YO2 A;  1LTJ B;  1KIL B;  2KP8 A;  1FZC A;  2YKO A;  5CCG C;  3BAT A;  3HE5 B;  3U1C A;  5CJ4 A;  1HWT C;  5AVS B;  1JTH B;  4WB4 A;  3HRN A;  5AW5 B;  5AW1 B;  5CCH C;  2Z4E A;  1HGZ A;  5AVU B;  2FYU K;  3MGN A;  3B5N A;  3B5N D;  3BRV B;  3NTN A;  4GKG A;  1GU4 A;  5AVW B;  2NPS A;  4Y99 B;  3M9Q A;  1J1D B;  4AYC A;  4C7N A;  5KJ7 D;  3P7K A;  1IK9 A;  1GL2 A;  5AW0 B;  1NU1 K;  3M9H A;  3L35 A;  3M0A A;  1GL2 C;  1LGH B;  5APX A;  1JTH A;  1L0L K;  1SLQ A;  3I5C A;  2NPS B;  2PAJ A;  5CHX A;  1HH0 A;  3VMZ A;  1JY2 N;  2QM8 A;  1GDT A;  2C0W A;  1YYC A;  1KFN A;  2HOD A;  2HYN A;  2KOG A;  1CSB A;  1RE3 A;  2J59 M;  2R5B A;  3E1I A;  1JY3 N;  1WRG A;  4W80 A;  2O01 H;  5KLV K;  2IX7 C;  2C9L Y;  3T97 A;  1RF0 C;  3NXS A;  3RK3 D;  1YTZ I;  1SQV K;  3BVH A;  3L37 A;  3HD7 D;  3TK1 A;  1LTS C;  1LT9 C;  2P67 A;  4W7Y A;  3V4W A;  1J2J B;  1OXZ A;  5APW A;  3CI9 A;  2WT7 B;  4LGD E;  3LW5 H;  1FZC C;  5AW4 B;  3HUS C;  1AFO A;  2NPS D;  3IFM A;  2R3C A;  1KQL A;  5AW2 B;  2WPR A;  1IJD B;  5AVR B;  1CZQ A;  1LWU A;  3IR9 A;  3HE4 A;  5CJ0 A;  3V2Q A;  5AVQ B;  1GL2 D;  4JF7 A;  1LWU C;  1RY3 A;  4N3Y B;  1FU1 A;  3VOP A;  2FFD A;  1WT6 A;  3CL3 D;  1ZR4 A;  1H8A A;  1FZF A;  2YKQ A;  1LWU B;  3A7O A;  3M06 A;  1MFZ A;  1NTZ K;  1N7S D;  1N7S A;  2XNX A;  1URQ D;  2YO3 A;  1G1I A;  3VN0 A;  1IFD A;  2M3B A;  3EQ2 A;  1DX7 A;  1H88 A;  1FAV A;  3HUS B;  1FZC B;  4I6M C;  1KIL A;  1GK4 A;  4ZKP A;  2Q3I A;  3V2R A;  5APV A;  1JY2 P;  4OH8 B;  1GTW A;  5AVY B;  3VMY A;  4GT1 A;  3OJA B;  2IPP A;  1YTZ T;  4N78 D;  3HD7 B;  5AVV B;  4AUW A;  2C0X A;  5AVZ B;  1FJP A;  2KSJ A;  3KDP B;  4IFF A;  3L4F A;  2WSF H;  2GUS A;  2OAR A;  2XU6 A;  1M1J A;  2VRS A;  3TSI A;  3MD0 A;  5CCG D;  2FFD C;  5AVT B;  2NPS C;  1ZR2 A;  1N86 A;  3SWF A;  3KQG A;  1G2C B;  1RF1 A;  2CPB A;  3RL0 C;  1FZA A;  1LTA C;  2XKM A;  5KTB A;  1GL2 B;  3EFG A;  1HJB A;  2YMY A;  1L0N K;  4HH2 A;  1MV8 A;  1IC2 A;  2FKW B;  4RES B;  1J1D C;  1LT9 A;  4Y99 C;  1A02 F;  3V2P A;  4WY4 C;  3VP8 A;  4HYT B;  1T2K C;  1JCC A;  1SFC A;  1MZ9 A;  3P32 A;  1N7S B;  1X9V A;  4B86 A;  1URQ B;  1SQQ K;  1DEB A;  3V2N A;  1AQ5 A;  1E5W A;  2O1J A;  1KIL C;  1JCD A;  1LTJ C;  2GUV A;  2POH A;  1X79 B;  3P8C D;  4WY4 A;  4C46 A;  3CLQ A;  5CMZ A;  1VPC A;  2N1T C;  1QL2 A;  1T2K D;  3HE4 B;  2BAS A;  4M3L A;  1KFM A;  2HLO A;  3M0D C;  5APQ A;  1CI6 A;  2WWW A;  3R2P A;  5APY A;  3RK3 B;  1ZV8 A;  1QL1 A;  2J58 A;  4C7R A;  2WSC H;  1GZL A;  3OA7 A;  1FOS E;  3HTK B;  4GIF A;  4XE5 B;  1RE4 A;  2Q7C A;  5AW7 B;  2N1T A;  2YKP A;  1FDM A;  3G3Z A;  3P8C E;  5BU8 B;  1RF1 C;  2OYI B;  2W6A A;  2OYH B;  3RL0 D;  2OYI C;  2JJL A;  2OYH C;  1SFC C;  2ZXE B;  1N73 C;  5AW9 B;  1HBW A;  1N2D C;  1ZLL A;  1HUC A;  2CPS A;  1HVV A;  1M1J C;  2H7H A;  2PP6 A;  3GHG B;  3KPE A;  2M8R A;  2Z5I A;  5BU5 A;  4IFD K;  2WPS A;  1FZB A;  3VP9 A;  2XZR A;  1KZU B;  1L4A D;  2I1J A;  5AVX B;  3MUD A;  3N7N A;  3H32 A;  2FYZ A;  2IFN A;  2IFM A;  1N73 A;  3OAK A;  3P8M C;  2XV5 A;  2A45 I;  1NO4 A;  2HPC B;  2N1T B;  1NHL A;  1JY3 O;  4EIJ A;  3M9B A;  1RE4 C;  1IFJ A;  3A2A A;  1LTT C;  5CCH A;  5APT A;  5CCH D;  1NWQ A;  1XTG B;  1NOH A;  2H43 A;  3VMX A;  2P7J A;  3KYQ A;  2YNY A;  3UIA A;  5AW8 B;  1N7L A;  1MUU A;  1URQ C;  3B5N C;  1FBM A;  2WIT A;  4C7N B;  1N7S C;  4AQR D;  2Z5H A;  2HPC A;  2ZFC A;  4WY4 B;  2KYV A;  1SQX K;  3NFQ A;  5APS A;  1VDF A;  5KJ7 C;  1SFC D;  4KHX A;  3N4X A;  3O8Z A;  2XDJ A;  1LTI C;  1SQB K;  2H8P D;  1J1E B;  1ZN5 A;  4LC1 A;  1HTL C;  3VYI A;  1L4A B;  3RL0 B;  3NMD A;  2KLV A;  1A02 J;  2FFD B;  1SP4 A;  3RK2 C;  1FJK A;  3U1A A;  4W7Z A;  4EOT A;  1JY2 O;  3II6 A;  4LLH A;  3RK2 B;  1NKN A;  1G1J A;  2WTY A;  1LTG C;  3U59 A;  1M7L A;  1L4A C;  1S9K D;  2QM7 A;  1RE3 C;  3BAS A;  1J1E C;  4ZKU A;  1JY3 P;  1GW4 A;  2Q5U A;  3H32 B;  2R32 A;  3PP5 A;  3V5B A;  4N6J A;  3TNU B;  3HD7 C;  3TYY A;  2KB7 P;  2WPQ A;  1RF0 A;  2Q9I A;  2P1J A;  4WY4 D;  1IFM A;  1S9K E;  4XA4 A;  2LKM A;  1SQP K;  1T3U A;  2E43 A;  1GW3 A;  2HG5 D;  1Z56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...