1FZGA

Crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 23
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzgA00
3E1IA 1JY2N 1N86A 1LTJC 2HPCB 1RF1C 2OYHB 1W2EA 1M1JA 2FFDB 1LWUC 1N73C 3HUSC 2FFDA 1JY3P 1FZFA 1LT9B 1RE3C 2A45G 1FZGA 1LTJA 1RF1A 1FZCC 1JY3O 3GHGB 2OYIB 2OYHC 1N73A 1LWUA 3HUSA 3H32A 1RE3A 1JY3N 1M1JB 2HODA 2FFDC 2A45I 1FZCA 2OYHA 1RE4C 3BVHA 1LT9C 1FZCB 1RF1B 2A45H 2HPCA 1LTJB 2OYIC 1RF0C 1LWUB 2H43A 3GHGC 1FZEA 1JY2P 3H32B 1N73B 1RE4A 3HUSB 2Z4EA 1FZAA 1T3UA 1JY2O 2HLOA 1M1JC 1LT9A 2HODB 1FZBA 2Q9IA 2OYIA 2XNXA 1RF0A 3GHGA
chains in the Genus database with same CATH superfamily
3V2NA 2FYZA 4CPGA 3AE2C 2DW3A 3L72J 4JBZA 1HJ0A 2WZ7A 1LTSC 1KILE 1S5LE 3PRJA 1SQVD 5APXA 1PIXA 1BDCA 3L70E 1GL2A 4HH2A 4PJ0H 3MUDC 4U3FG 4BWNA 1NTKD 2JP3A 3AEGC 4I7ZB 3L74G 3AE4C 3G3ZA 3PHLA 1KMIZ 2M3EA 2IBZD 3IFMA 4YPCA 3AEBC 3CC2P 1OW8A 1SFCA 1BCCG 5APYA 1G1IA 1ZV8A 2OYOA 4IL6E 1M90Q 2PGDA 1L0LJ 3B8EB 5AVQB 3Q2YA 1SQBD 5BU8B 4I7ZC 1NHLA 2FYUD 2I1KA 2N1TB 3B4SA 3QH9A 2R3SA 3LIDA 1LTJA 1HWTC 2XNDH 1Y9BA 3IAOA 2IFMA 2A45I 1S9KE 3HE4A 2E75B 1SQVJ 2Q3EA 2H88C 3H32B 1DD3A 3CC4P 1BE3E 2ZVNB 4KHXA 2O01J 1QEXA 2BCCG 1JUNA 2N1TC 2Y0CA 1NU1K 2ZJSE 3D6ZA 1MZ9A 2A45H 3V2QA 2OGUA 2V7QH 1G2CB 2P7JA 2O3JA 3RL0g 1KV4A 4R4LA 2E75C 2K9JB 1VQ9P 2QSIA 1AFOA 5KKZB 1YJWP 1RHZB 3L75D 1L0LK 1YTZI 1SQXE 2FYUJ 3MIWA 1SS1A 2B87B 2XV5A 1K05A 1T6AA 5CBOA 1H89A 1IK9A 2L5GB 1HH0A 3G9RA 2M5AB 1FDIA 4LGDE 2MKVA 1KILB 1X22A 1JY2P 5KKZC 1SQVK 1ZRTE 3Q5PA 1YJNP 2W6AA 3D70A 2A45G 1Q7YQ 1K73Q 1OFCX 2N1TD 1HBWA 3A0BH 3MHVA 1YJ9P 3H32A 3ITKA 1YIJP 3H1HD 2B9BA 4AUWA 2ZAEB 3E1RA 1KILC 2JWDA 2W6BA 1AV1A 2E75D 3FGAD 1G1JA 3I56P 1PFIA 4C7NB 1NKZB 4WVZA 1H8AA 1USEA 2JO1A 1G2CA 3RK2B 3CWBD 3L75J 3LW5J 1BCCE 5CMZA 2Y9ZA 1BGYD 1SQBK 3TF5A 2NRGA 1NTMG 2FYUK 3SSUA 5C39A 1FZGA 1JM0A 3V5BA 3HUSA 2KP8A 1CSBA 2BEQD 1N2DC 4NPDA 1GW4A 4UB8H 5TJHA 3Q5RA 3RK2C 1PGJA 5B66E 1IZNB 4HJGH 1L0LE 5CHXA 1FC2C 1ZOYC 3M9QA 3H1JE 3CCEP 4WY4B 3H1HJ 3TGUJ 3AE7C 3SFDC 4I1LA 2LXBA 3CCMP 3M0DC 1W2BO 2HODB 4R4MA 1KILD 1NOHA 1KB9E 1OX3A 2XKMA 1PGOA 2M3BA 2JR8A 4TT3H 1NTZE 3L70D 1DEEG 3CWBJ 1RE3A 3Q1MA 1BGYJ 1IFNA 1HTLC 4WY4C 2WITA 4OWFA 1TU3F 1NGMB 1FZFA 1H0TB 2FYNB 1VQ7P 1LT1A 2FBWC 2OTLP 3VN0A 3L71G 3TNUB 3CCRP 1FZCA 2Q6QA 1CZQA 1JY2O 3RK2D 2E43A 1DEBA 4GKGA 2M8RA 2OYHB 1JCDA 3BCCE 3QWOC 2AEFA 3PH0A 1GW3A 4EOTA 2FYNC 1EQ7A 1AQ5A 2L91A 5M1BA 1S9KD 1OXZA 2KS1A 3L70J 3P8CE 3KZIE 3LIEA 2OYHC 1GD2E 1BE3D 3H1KG 4OVNF 1OVVA 1URQB 2IYPA 3CXHI 2FFDA 3D71A 4WY4D 2G3AA 3BASA 4IL6H 2YO3A 1Y47A 1L0NG 1PV3A 1GK4A 5APWA 2IYOA 5AW0B 1S5LX 2Y9YA 2CK3H 2YXRB 2E74B 3P32A 3CXHH 1ZW0A 4UB6H 1URQC 2A06G 5CCGC 1MFTA 1X9VA 1JEKA 1SQXD 3RBZA 1Q81Q 1KYOI 4XA4A 2GUVA 1AJYA 2Z5HA 2PRRA 5AVWB 3HE5B 3RL0C 5KAFH 1BSHA 2PFXA 2WSSH 1GZLA 3HD7B 4EDFA 2BASA 4IL6X 1X79B 5DJUB 3M0AA 2YKQA 3AE1C 2KZIA 2HYNA 1ZRTD 1SQQE 1UIIA 1BE3J 1KYOH 5B5EE 4A7PA 3K5BA 4MN4C 2HFED 4TLFA 1OWAA 1IJDB 1FZEA 1KZUB 2OARA 3G4SP 1T8ZA 1YYCA 1KFMA 1JTHA 2XDJA 3HD7C 5KLVG 3L73G 2ZYDA 4U3FD 3TGUE 1GL2B 1YITP 1P84D 3RBXA 2E42A 2KSJA 3AE3C 2IZ0A 3PP5A 2D2CB 2P58A 1URQD 4Y28J 3KHUA 1BCCD 1SQXJ 3H1IG 2ZYGA 3FXEA 2ZFCA 1EZVI 2WTYA 4W7YA 1SFCB 2LKMA 1K8AQ 3A7OA 1ZR2A 1SQPE 3R4YA 4M3LA 1GL2C 1IFIA 2E74D 3HE5A 1N86A 1HVVA 2D2CC 1J1DB 2R5BA 2KSEA 4I6MC 1L0LD 1LTJB 1SFCC 3H1JD 1FZAA 3GLMA 4KT0J 4ZKUA 4W7ZA 2ITAA 3HE4B 4DJGA 3H1KE 3HD7D 1NKNA 1E79H 4U3FJ 1KB9D 3AEDC 1EC5A 3L74J 5APSA 1AA0A 3VMXA 1VQMP 1NTZD 2WPSA 4PV1B 2G8YA 1OZHA 3C1LA 1VQ5P 1PP9G 4JYBA 1BCCJ 1CW5A 3PTZA 1LTJC 1KTMA 1SQXK 3CCLP 2GM4A 3SWFA 3CCUP 1GL2D 1YQ4C 5BU5A 2HR3A 1EZVG 2ZVOB 2QEXP 1ZR4A 1K9MQ 2WT7A 1FOSF 2Q1KA 1MFZA 1PPJE 3AE5C 2D2CD 2AXTE 4LLHA 1JY3P 3BCCD 2XZRA 2M0BA 1SFCD 3H1JJ 2Z4EA 2IBZI 1VL2A 3H1LE 3S4RA 5AW6B 3H25A 1NU1G 5KAIE 2QJPB 1NTZJ 3CX5E 3P8CD 3TDKA 2O01H 1FJKA 4EYYQ 5CBNA 4PD4E 5CCHA 2KIKA 3V2RA 2P67A 3WUTA 5AVVB 1KQGB 1KORA 4L74A 1KQSO 4HYTB 1NVOA 5CCHD 1U57A 1JMMA 1WRGA 1NAYA 3JC22 3L35A 2KZJA 1YHQP 4PV1D 2QM8A 4U7JA 5E79H 1UIXA 2UWJE 1Q86Q 3BCCJ 2PAJA 2WVRA 1KD1Q 5KJ7A 1KQLA 1MKMA 2IFNA 3HUSB 1N7LA 1LTAC 1BSNA 1RQUA 4ASVA 2WPVB 3A0HE 1IFPA 3KXDA 5KJ7D 4D6TE 2R5DA 1Q82Q 1NTKG 2Y0EA 3VYIA 1S72P 1VQLP 5GTHH 1FS0E 2IBZG 2P10A 1NTZK 1SQQD 1X0TA 1QVFO 2QRXA 1T3UA 1N7SA 2Z5IA 2FXPA 2RMZA 2C0XA 2H8PD 3HUSC 3OA7A 1ZMEC 3G6EP 2ZXEB 3CCQP 1PP9E 5KLIB 1SQBG 3TGUD 3A2AA 1NTMJ 2FYUG 4XFJA 1GDTA 3ZDMA 3LW5H 4U3FE 5BVZA 1FAVA 1P84E 1J1EB 3L74E 2QVAA 3NMDA 3GHGB 4GIFA 1AVOA 1KC8Q 3IR9A 2E5TA 3OW2O 3VMYA 1SQPD 1FZCB 3O8ZA 5KLIC 1JY2N 2CPBA 3WU2H 1RE3C 1HF9A 4BRYB 1SQQJ 1J1EC 1GMJA 5EFWB 3KYQA 3CCSP 1CI6A 1FOSE 2YNYA 2BEZF 2OYIA 2JEEA 5APVA 5APUA 1DD4A 2XU6A 1HJBA 1FZCC 3FWLA 1N73A 2NZ2A 3H1KD 4PJ0E 2KS1B 2J59M 1LTBC 4H13B 1NH4A 3BRTB 4JQ0D 2FKWB 2GA1A 2AEMA 1OVRA 5GTIH 2BCCE 1EDJA 2FFDB 3JCUE 3L71J 2K1AA 2WPRA 1MUUA 1YBKA 1PGQA 1U7JA 1SQPJ 3T97B 1FE6A 4NPFX 3GHGA 4H13C 1OW7A 5H2FE 2POHA 2H89C 3V2PA 4L73A 1PPJD 3Q5SA 4YTPC 1VQKP 2FFDC 1DX7A 3H1HG 5AVUB 1FU1A 1RF1B 2B88A 2V4HA 1ZP0C 2H43A 1SQQK 3TYYA 1J2JB 2QJKB 1DIPA 1N8RQ 2K88A 4BRYA 1LT9B 1ZXGA 1Q2NA 2Y0DA 3H1KJ 1S5LH 3H1LD 3CWBG 1SVFA 2J58A 3GW6A 1BGYG 1KFNA 3CX5D 3JSVC 3PJSK 1OW6A 1L0NJ 3BRVB 3HTKA 3C8VA 4PD4D 2QJKC 1Q90D 4H44B 2IDBA 1JTHB 1LT9C 1M57D 2QG4A 4WWIA 2HPCA 1L4AB 1QVGO 4H0LB 1GK6A 5KTBA 1SQPK 4K35A 2JJLA 2C9LY 1VPCA 2YIUB 4H13D 3AEFC 5L8RJ 2C9NY 4YXDC 3T97A 5AVYB 3M9HA 1NTME 2KXPB 4H44C 1PL5A 5DJTB 1YQ3C 1FZBA 2LXCB 1RF0A 4JF7A 4OGQB 3OJAB 1MV8A 4H0LC 2FY8A 1RF1A 3H1LJ 2NPSA 3I5CA 2YIUC 1JO5A 3U1CA 4D6TD 3A0BE 1E5WA 2MJZA 2N9BA 1S2EA 2Q5UA 1LT9A 3S1KA 2WSCH 1XTCC 1JNMA 2E74C 2RKLA 2O1KA 5KLVJ 3VTPC 2WSFJ 2GUSA 1S3JA 3C9IA 3L4FA 1YI2P 1RE4A 1PP9D 4DZOA 3TSIA 1QL1A 1LJ2A 1IFJA 3CL3D 1JOCA 3W68A 4L76A 4Y99B 3V4QA 1L4AA 1LTIC 2O1JA 3L74D 1GTWA 4H44D 3WUUA 1LWUB 4LC1A 5AW3B 4NPEA 2QIWA 3USSA 4UB8E 4RESB 1L4AD 3L71E 4H0LD 1BDDA 3MZWB 3AECC 2WT7B 1BE3G 1GU5A 4Z1MH 2K9YA 5CJ4A 4D6TJ 4ZMDA 1P84I 3OAKA 1K04A 1ZLLA 4B86A 1EXIA 4WBAA 5AW2B 1PGPA 3B5NB 3EWKA 4K3AA 4OGQD 1T2KD 3O6QA 1ZN5A 1PP9J 1P84H 4GT1A 3B71A 3II6A 2IPPA 1M56D 1Y8AA 3CC7P 4C7RA 2WSEJ 3NXSA 2BCCD 5K5GB 2AEJA 3FX0A 1NYHA 2E5YA 2JKVA 2LR2A 2W8ZA 3B5NC 1J1DC 4C46A 4DT0A 1FJPA 1VQ8P 1L0NE 4GOEA 4RJTA 1KN7A 4GOFA 2ZT9B 1NWQA 1AVYA 4DOJA 1LWUA 1PZQA 1KB9I 2VRSA 5CCHC 2A06E 5B66H 5AW5B 3BATA 3VMZA 4PV1C 3MGNA 3G71P 3PLNA 2H7HA 5TISE 1NU1J 4XE5B 2FXMA 2RN0A 1EDLA 3L72G 2ZT9C 4BXLA 1M7LA 1KB9H 2YO2A 3RK3E 1U7MA 3JCUH 3B5NA 1VQPP 1D7MA 1N7SB 2BCCJ 5KJ7C 2KUBA 1JB0J 3M9BA 2KLVA 3B5ND 1EDIA 5H2FH 3GMAA 3N4XA 5KLVE 3L73E 3MTUE 2OQQA 2W83C 1FBMA 3CPWO 3CXHE 4UB6E 3SFEC 1LTGC 3GG2A 3AE8C 3MP7B 3MUDA 1JY3N 1JMBA 1QL2A 1L0LG 1N7SC 3H1IE 2WPQA 3H1JG 5KAFE 2E76B 1M8OB 2QJPC 1HGVA 1NTMD 5APQA 2KOGA 1NTKJ 4GODA 2KI7B 4IFDK 1S1CX 4IOIH 1KQFB 1NTZG 2ZT9D 2B89A 4ZKPA 5AW9B 1KYOE 5AW8B 3NTNA 3EFFK 1YTZT 2C0WA 1SQVG 3KZIH 1FDMA 1CI6B 3Q3DA 3VP9A 2E76C 3WUVA 2V7QJ 2OYIB 3CI9A 1IO4A 1SQBJ 3EFGA 2N9YB 2IZ1A 4YXWH 1N73B 2KYVA 2WQYC 2Q9IA 1VQ6P 2JDIH 2AXCA 3VP8A 2W90A 3BCCG 3CCVP 3CD6P 4OH8B 1QGKB 2N1TA 2Q3IA 1N7SD 5AVSB 2OYIC 1R8EA 4W80A 2K37A 4KJMA 1N73C 1LGHB 3P8MC 1OMIA 3MD0A 1JY3O 3RGUA 1NTKK 2YXQB 3F5HA 1VQNP 3BVHA 1EZVE 3L71D 2SPZA 4N78E 3RK3B 3I55P 5B5EH 4ASWA 3L72E 3W67A 2E76D 2WWWA 4JPZB 1RY3A 1IK7A 4I2LC 1RH5B 1T3JA 2IX7C 5AW7B 2K9JA 2KB7P 3GHGC 1JCCA 1NU1E 5APTA 3A3YB 2HG5D 3RK3C 1QLED 5AVRB 2WMMA 3HTKB 2B87A 3L75G 3KDPB 4GDOA 1EXJA 1EDKA 3M06A 5CJ0A 1NTMK 2M5AA 2HPCB 1KILA 1L0ND 3AE6C 3M91A 3KPEA 1SQQG 1NO4A 4ZNCA 3GF3A 1XTGB 4HB1A 1NAFA 2A06D 2ZXXA 1W5CE 1SP4A 1IFDA 1WT6A 2R3CA 3F89A 3HRNA 4AQRD 3A5TA 3CMAP 1SQVE 2J5UA 3IN6A 3TGUG 5AW1B 1M1KQ 1LNQA 2NPSB 4C7NA 3L37A 1NTKE 3N7NA 3RK3D 4DCKA 2IBZE 3E7KA 4IFMA 1USDA 2W6JH 1M1JB 3KQGA 2CPSA 4N6JA 3D6YA 2KNCB 3UIAA 1RF0C 1SQPG 3M0DA 1R5LA 1RF1C 4QMAA 3SWYA 2NPSC 1WMKA 5KLVD 4EI2A 3L73D 3AE9C 5E79E 1SQBE 3IF4A 3CXHD 1QX8A 1VF5B 2FYUE 2R44A 1IFMA 1X8YA 1GU4A 2HLOA 1OIPA 5TISH 4L75A 1M1JC 2AXTH 4EIJA 4HKZH 1FDOA 3CX5I 3H1ID 4WY4A 4PD4I 3TK1A 1IC2A 2HODA 1RE4C 2JWAA 2YKOA 2I8DA 3R2PA 5AW4B 2O01N 3VOPA 5GTHE 1VF5C 3WMM0 2KK7A 1KYOD 3RL0B 5KAIH 1LP1B 3CX5H 1L4AC 3L70G 3H6PA 4IFFA 4PD4H 2W27A 3ABVC 1L2PA 2WSFH 1VQOP 1VDFA 1S4XA 1H0TA 5AVZB 1DH3A 2XNXA 2P2UA 3O6QB 2ZYAA 1M1JA 3TNUA 4O9BA 3L73J 3U1AA 2NPSD 2KNCA 3L75E 5AVTB 1L0NK 1PPJG 4JYCA 3VMAA 2YMKA 1VQ4P 4OGQC 2OYHA 1T2KC 1NJIQ 3U59A 3AEEC 3H1IJ 4N3YB 2YMYA 2QM7A 1W2EA 1H88A 2OTKE 3WU2E 4AYCA 2WSCJ 3H1LG 2K3RA 3CMEP 3V6IA 3GF7A 2R32A 2KLUA 3A0HH 5AVXB 1VF5D 1SLQA 3FWNA 1EZVD 1A02F 1A02J 1URQA 1HUCA 4N78D 5CCGA 2PP6A 3H1HE 3AEAC 1Z56A 2Q7CA 3L72D 2QJYB 4RKUJ 3FXDA 1LP1A 2QA4P 4Y99C 1AQTA 3EQ2A 5CCGD 3E1IA 1R5SA 1HGZA 1LWUC 3CWBE 1RQVA 2FXOA 5GTIE 5KLVK 1NU1D 3RL0D 2QE7H 1LTTC 1BGYE 3S9OA 3L36A 3P7KA 2WSEH 2YKPA 3CLQA 2P1JA 3V4WA 2QJYC 1SQXG 2I1JA 4WB4A 3SWKA 4RO0A 2RH0A 3HD7A 4D6TG 3CCJP 1OVUA 2OTJP 3NFQA
chains in the Genus database with same CATH topology
1X9VA 1CI6B 3V2NA 3VP9A 2FYZA 2FFDB 4XA4A 2GUVA 2Z5HA 5AVWB 2OYIB 3HE5B 3CI9A 3RL0C 2WZ7A 2WPRA 1LTSC 1IO4A 3EFGA 1MUUA 1N73B 2KYVA 1GZLA 3HD7B 5APXA 2Q9IA 2BASA 1GL2A 3GHGA 1X79B 4HH2A 3M0AA 2YKQA 3VP8A 2POHA 2HYNA 3V2PA 4OH8B 2HFED 2FFDC 1DX7A 2N1TA 3G3ZA 2Q3IA 5AVUB 1FU1A 1N7SD 3IFMA 1RF1B 5AVSB 2OYIC 1OWAA 1SQQK 2H43A 1IJDB 1FZEA 1KZUB 2OARA 3TYYA 4W80A 1J2JB 1T8ZA 1YYCA 1SFCA 1KFMA 1JTHA 5APYA 1G1IA 1N73C 2XDJA 3HD7C 1LT9B 1ZV8A 1LGHB 3P8MC 3MD0A 1JY3O 1GL2B 1NTKK 2E42A 3BVHA 3B8EB 2KSJA 1SVFA 2J58A 5AVQB 3PP5A 4N78E 3RK3B 1KFNA 5BU8B 1NHLA 1URQD 2I1KA 2N1TB 2ZFCA 3BRVB 3HTKA 3LIDA 2WTYA 4W7YA 1LTJA 1SFCB 1HWTC 2LKMA 2WWWA 3A7OA 2IFMA 1JTHB 1ZR2A 1RY3A 2A45I 4I2LC 2IX7C 1T3JA 5AW7B 1S9KE 1LT9C 3HE4A 2KB7P 2HPCA 4M3LA 1GL2C 1JCCA 3GHGC 3H32B 1L4AB 1IFIA 1GK6A 5KTBA 1SQPK 2JJLA 3A3YB 3HE5A 1N86A 1HVVA 1VPCA 5APTA 2C9LY 4KHXA 2HG5D 3RK3C 1JUNA 1J1DB 2N1TC 2C9NY 2R5BA 5AVRB 1NU1K 3T97A 5AVYB 3HTKB 4I6MC 3M9HA 1MZ9A 2A45H 3KDPB 1LTJB 1SFCC 3V2QA 1G2CB 2P7JA 1FZAA 1FZBA 3M06A 1RF0A 4ZKUA 4JF7A 4W7ZA 3HE4B 5CJ0A 1NTMK 2HPCB 3OJAB 1MV8A 1KILA 3HD7D 1NKNA 1AFOA 1RF1A 3M91A 2NPSA 5APSA 3I5CA 3KPEA 3VMXA 1JO5A 2WPSA 3U1CA 1NO4A 1L0LK 1YTZI 1E5WA 2MJZA 1XTGB 2N9BA 2Q5UA 3MIWA 1LT9A 2WSCH 4JYBA 1CW5A 1XTCC 1NAFA 1JNMA 2XV5A 1LTJC 2O1KA 1SP4A 3VTPC 1SQXK 1IFDA 1WT6A 2GM4A 2R3CA 2GUSA 3A5TA 3HRNA 4AQRD 1H89A 1IK9A 2L5GB 1HH0A 4LGDE 1KILB 3C9IA 3L4FA 3SWFA 5AW1B 1JY2P 1GL2D 1RE4A 5BU5A 2NPSB 4C7NA 1ZR4A 1SQVK 1FOSF 2WT7A 4DZOA 3L37A 3TSIA 1MFZA 1QL1A 3N7NA 4LLHA 3RK3D 1JY3P 1IFJA 3CL3D 2W6AA 1JOCA 2A45G 4IFMA 2N1TD 4Y99B 3V4QA 1HBWA 3H32A 1L4AA 1M1JB 2XZRA 3KQGA 1LTIC 2CPSA 2O1JA 4N6JA 1GTWA 1SFCD 3UIAA 1RF0C 1LWUB 4AUWA 2Z4EA 4LC1A 5AW3B 1KILC 2W6BA 3M0DA 4RESB 1RF1C 1G1JA 3SWYA 1L4AD 2NPSC 1PFIA 4C7NB 1NKZB 5AW6B 1H8AA 2WT7B 1GU5A 1G2CA 3RK2B 3P8CD 5CJ4A 1IFMA 2O01H 1FJKA 1X8YA 3OAKA 5CMZA 1GU4A 1SQBK 2HLOA 1M1JC 5CCHA 3V2RA 4EIJA 2P67A 1ZLLA 2FYUK 4B86A 4WY4A 4WBAA 5AVVB 5AW2B 1FZGA 3B5NB 3V5BA 3HUSA 3TK1A 1IC2A 2KP8A 4HYTB 2HODA 1CSBA 1RE4C 5CCHD 1N2DC 1JMMA 1WRGA 1T2KD 1GW4A 2YKOA 3R2PA 5AW4B 3VOPA 1ZN5A 3L35A 3RK2C 4GT1A 3II6A 3WMM0 2QM8A 3RL0B 2IPPA 4C7RA 1L4AC 2PAJA 5CHXA 3H6PA 3NXSA 4IFFA 3M9QA 4WY4B 5KJ7A 1KQLA 2W27A 2IFNA 4I1LA 2WSFH 3B5NC 1J1DC 3M0DC 4C46A 3HUSB 1VDFA 1FJPA 1N7LA 2HODB 5AVZB 1LTAC 1KILD 1NOHA 2XNXA 1DH3A 2XKMA 2P2UA 3TNUA 1M1JA 2M3BA 4O9BA 3U1AA 2NPSD 5KJ7D 2R5DA 1NWQA 5AVTB 1L0NK 4JYCA 4DOJA 1LWUA 1RE3A 3VYIA 2OYHA 2VRSA 5CCHC 1NTZK 1T2KC 5AW5B 1IFNA 1HTLC 1T3UA 1N7SA 3U59A 4WY4C 2Z5IA 3BATA 3VMZA 4N3YB 2YMYA 3MGNA 2QM7A 2C0XA 2WITA 1W2EA 2H7HA 2H8PD 3HUSC 3OA7A 1FZFA 1H88A 4XE5B 2FXMA 4AYCA 2ZXEB 3VN0A 3TNUB 1FZCA 1M7LA 2YO2A 2R32A 1CZQA 5AVXB 1JY2O 3A2AA 3RK2D 2E43A 1DEBA 1SLQA 4GKGA 2M8RA 2OYHB 1JCDA 1A02F 1GDTA 1A02J 3B5NA 3LW5H 5BVZA 1URQA 1HUCA 1FAVA 4N78D 1J1EB 5CCGA 1N7SB 2PP6A 3NMDA 3GHGB 5KJ7C 1Z56A 4GIFA 2Q7CA 3M9BA 1GW3A 3IR9A 4EOTA 2KLVA 1EQ7A 1AQ5A 3B5ND 4Y99C 3VMYA 3N4XA 1S9KD 3EQ2A 5CCGD 1FZCB 3MTUE 1OXZA 3O8ZA 3E1IA 1JY2N 1FBMA 2CPBA 1HGZA 3P8CE 1LWUC 1RE3C 3LIEA 1LTGC 2OYHC 5KLVK 3RL0D 1GD2E 1LTTC 3MUDA 1JY3N 1URQB 1QL2A 1J1EC 1N7SC 3L36A 3P7KA 3KYQA 1CI6A 1FOSE 2WPQA 2WSEH 2FFDA 2YKPA 2YNYA 3CLQA 2P1JA 3V4WA 4WY4D 1HGVA 2OYIA 3BASA 2YO3A 2JEEA 5APVA 5APUA 5APQA 2XU6A 2KOGA 1HJBA 2I1JA 4WB4A 1GK4A 1FZCC 5APWA 4IFDK 1N73A 3HD7A 5AW0B 2J59M 4ZKPA 5AW9B 5AW8B 1LTBC 3NTNA 1NH4A 3BRTB 1YTZT 2C0WA 3P32A 1URQC 2FKWB 3NFQA 1FDMA 5CCGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1I A;  1JY2 N;  1N86 A;  1LTJ C;  2HPC B;  1RF1 C;  2OYH B;  1W2E A;  1M1J A;  2FFD B;  1LWU C;  1N73 C;  3HUS C;  2FFD A;  1JY3 P;  1FZF A;  1LT9 B;  1RE3 C;  2A45 G;  1FZG A;  1LTJ A;  1RF1 A;  1FZC C;  1JY3 O;  3GHG B;  2OYI B;  2OYH C;  1N73 A;  1LWU A;  3HUS A;  3H32 A;  1RE3 A;  1JY3 N;  1M1J B;  2HOD A;  2FFD C;  2A45 I;  1FZC A;  2OYH A;  1RE4 C;  3BVH A;  1LT9 C;  1FZC B;  1RF1 B;  2A45 H;  2HPC A;  1LTJ B;  2OYI C;  1RF0 C;  1LWU B;  2H43 A;  3GHG C;  1FZE A;  1JY2 P;  3H32 B;  1N73 B;  1RE4 A;  3HUS B;  2Z4E A;  1FZA A;  1T3U A;  1JY2 O;  2HLO A;  1M1J C;  1LT9 A;  2HOD B;  1FZB A;  2Q9I A;  2OYI A;  2XNX A;  1RF0 A;  3GHG A; 
#chains in the Genus database with same CATH topology
 3V2N A;  2FYZ A;  4CPG A;  3AE2 C;  2DW3 A;  3L72 J;  4JBZ A;  1HJ0 A;  2WZ7 A;  1LTS C;  1KIL E;  1S5L E;  3PRJ A;  1SQV D;  5APX A;  1PIX A;  1BDC A;  3L70 E;  1GL2 A;  4HH2 A;  4PJ0 H;  3MUD C;  4U3F G;  4BWN A;  1NTK D;  2JP3 A;  3AEG C;  4I7Z B;  3L74 G;  3AE4 C;  3G3Z A;  3PHL A;  1KMI Z;  2M3E A;  2IBZ D;  3IFM A;  4YPC A;  3AEB C;  3CC2 P;  1OW8 A;  1SFC A;  1BCC G;  5APY A;  1G1I A;  1ZV8 A;  2OYO A;  4IL6 E;  1M90 Q;  2PGD A;  1L0L J;  3B8E B;  5AVQ B;  3Q2Y A;  1SQB D;  5BU8 B;  4I7Z C;  1NHL A;  2FYU D;  2I1K A;  2N1T B;  3B4S A;  3QH9 A;  2R3S A;  3LID A;  1LTJ A;  1HWT C;  2XND H;  1Y9B A;  3IAO A;  2IFM A;  2A45 I;  1S9K E;  3HE4 A;  2E75 B;  1SQV J;  2Q3E A;  2H88 C;  3H32 B;  1DD3 A;  3CC4 P;  1BE3 E;  2ZVN B;  4KHX A;  2O01 J;  1QEX A;  2BCC G;  1JUN A;  2N1T C;  2Y0C A;  1NU1 K;  2ZJS E;  3D6Z A;  1MZ9 A;  2A45 H;  3V2Q A;  2OGU A;  2V7Q H;  1G2C B;  2P7J A;  2O3J A;  3RL0 g;  1KV4 A;  4R4L A;  2E75 C;  2K9J B;  1VQ9 P;  2QSI A;  1AFO A;  5KKZ B;  1YJW P;  1RHZ B;  3L75 D;  1L0L K;  1YTZ I;  1SQX E;  2FYU J;  3MIW A;  1SS1 A;  2B87 B;  2XV5 A;  1K05 A;  1T6A A;  5CBO A;  1H89 A;  1IK9 A;  2L5G B;  1HH0 A;  3G9R A;  2M5A B;  1FDI A;  4LGD E;  2MKV A;  1KIL B;  1X22 A;  1JY2 P;  5KKZ C;  1SQV K;  1ZRT E;  3Q5P A;  1YJN P;  2W6A A;  3D70 A;  2A45 G;  1Q7Y Q;  1K73 Q;  1OFC X;  2N1T D;  1HBW A;  3A0B H;  3MHV A;  1YJ9 P;  3H32 A;  3ITK A;  1YIJ P;  3H1H D;  2B9B A;  4AUW A;  2ZAE B;  3E1R A;  1KIL C;  2JWD A;  2W6B A;  1AV1 A;  2E75 D;  3FGA D;  1G1J A;  3I56 P;  1PFI A;  4C7N B;  1NKZ B;  4WVZ A;  1H8A A;  1USE A;  2JO1 A;  1G2C A;  3RK2 B;  3CWB D;  3L75 J;  3LW5 J;  1BCC E;  5CMZ A;  2Y9Z A;  1BGY D;  1SQB K;  3TF5 A;  2NRG A;  1NTM G;  2FYU K;  3SSU A;  5C39 A;  1FZG A;  1JM0 A;  3V5B A;  3HUS A;  2KP8 A;  1CSB A;  2BEQ D;  1N2D C;  4NPD A;  1GW4 A;  4UB8 H;  5TJH A;  3Q5R A;  3RK2 C;  1PGJ A;  5B66 E;  1IZN B;  4HJG H;  1L0L E;  5CHX A;  1FC2 C;  1ZOY C;  3M9Q A;  3H1J E;  3CCE P;  4WY4 B;  3H1H J;  3TGU J;  3AE7 C;  3SFD C;  4I1L A;  2LXB A;  3CCM P;  3M0D C;  1W2B O;  2HOD B;  4R4M A;  1KIL D;  1NOH A;  1KB9 E;  1OX3 A;  2XKM A;  1PGO A;  2M3B A;  2JR8 A;  4TT3 H;  1NTZ E;  3L70 D;  1DEE G;  3CWB J;  1RE3 A;  3Q1M A;  1BGY J;  1IFN A;  1HTL C;  4WY4 C;  2WIT A;  4OWF A;  1TU3 F;  1NGM B;  1FZF A;  1H0T B;  2FYN B;  1VQ7 P;  1LT1 A;  2FBW C;  2OTL P;  3VN0 A;  3L71 G;  3TNU B;  3CCR P;  1FZC A;  2Q6Q A;  1CZQ A;  1JY2 O;  3RK2 D;  2E43 A;  1DEB A;  4GKG A;  2M8R A;  2OYH B;  1JCD A;  3BCC E;  3QWO C;  2AEF A;  3PH0 A;  1GW3 A;  4EOT A;  2FYN C;  1EQ7 A;  1AQ5 A;  2L91 A;  5M1B A;  1S9K D;  1OXZ A;  2KS1 A;  3L70 J;  3P8C E;  3KZI E;  3LIE A;  2OYH C;  1GD2 E;  1BE3 D;  3H1K G;  4OVN F;  1OVV A;  1URQ B;  2IYP A;  3CXH I;  2FFD A;  3D71 A;  4WY4 D;  2G3A A;  3BAS A;  4IL6 H;  2YO3 A;  1Y47 A;  1L0N G;  1PV3 A;  1GK4 A;  5APW A;  2IYO A;  5AW0 B;  1S5L X;  2Y9Y A;  2CK3 H;  2YXR B;  2E74 B;  3P32 A;  3CXH H;  1ZW0 A;  4UB6 H;  1URQ C;  2A06 G;  5CCG C;  1MFT A;  1X9V A;  1JEK A;  1SQX D;  3RBZ A;  1Q81 Q;  1KYO I;  4XA4 A;  2GUV A;  1AJY A;  2Z5H A;  2PRR A;  5AVW B;  3HE5 B;  3RL0 C;  5KAF H;  1BSH A;  2PFX A;  2WSS H;  1GZL A;  3HD7 B;  4EDF A;  2BAS A;  4IL6 X;  1X79 B;  5DJU B;  3M0A A;  2YKQ A;  3AE1 C;  2KZI A;  2HYN A;  1ZRT D;  1SQQ E;  1UII A;  1BE3 J;  1KYO H;  5B5E E;  4A7P A;  3K5B A;  4MN4 C;  2HFE D;  4TLF A;  1OWA A;  1IJD B;  1FZE A;  1KZU B;  2OAR A;  3G4S P;  1T8Z A;  1YYC A;  1KFM A;  1JTH A;  2XDJ A;  3HD7 C;  5KLV G;  3L73 G;  2ZYD A;  4U3F D;  3TGU E;  1GL2 B;  1YIT P;  1P84 D;  3RBX A;  2E42 A;  2KSJ A;  3AE3 C;  2IZ0 A;  3PP5 A;  2D2C B;  2P58 A;  1URQ D;  4Y28 J;  3KHU A;  1BCC D;  1SQX J;  3H1I G;  2ZYG A;  3FXE A;  2ZFC A;  1EZV I;  2WTY A;  4W7Y A;  1SFC B;  2LKM A;  1K8A Q;  3A7O A;  1ZR2 A;  1SQP E;  3R4Y A;  4M3L A;  1GL2 C;  1IFI A;  2E74 D;  3HE5 A;  1N86 A;  1HVV A;  2D2C C;  1J1D B;  2R5B A;  2KSE A;  4I6M C;  1L0L D;  1LTJ B;  1SFC C;  3H1J D;  1FZA A;  3GLM A;  4KT0 J;  4ZKU A;  4W7Z A;  2ITA A;  3HE4 B;  4DJG A;  3H1K E;  3HD7 D;  1NKN A;  1E79 H;  4U3F J;  1KB9 D;  3AED C;  1EC5 A;  3L74 J;  5APS A;  1AA0 A;  3VMX A;  1VQM P;  1NTZ D;  2WPS A;  4PV1 B;  2G8Y A;  1OZH A;  3C1L A;  1VQ5 P;  1PP9 G;  4JYB A;  1BCC J;  1CW5 A;  3PTZ A;  1LTJ C;  1KTM A;  1SQX K;  3CCL P;  2GM4 A;  3SWF A;  3CCU P;  1GL2 D;  1YQ4 C;  5BU5 A;  2HR3 A;  1EZV G;  2ZVO B;  2QEX P;  1ZR4 A;  1K9M Q;  2WT7 A;  1FOS F;  2Q1K A;  1MFZ A;  1PPJ E;  3AE5 C;  2D2C D;  2AXT E;  4LLH A;  1JY3 P;  3BCC D;  2XZR A;  2M0B A;  1SFC D;  3H1J J;  2Z4E A;  2IBZ I;  1VL2 A;  3H1L E;  3S4R A;  5AW6 B;  3H25 A;  1NU1 G;  5KAI E;  2QJP B;  1NTZ J;  3CX5 E;  3P8C D;  3TDK A;  2O01 H;  1FJK A;  4EYY Q;  5CBN A;  4PD4 E;  5CCH A;  2KIK A;  3V2R A;  2P67 A;  3WUT A;  5AVV B;  1KQG B;  1KOR A;  4L74 A;  1KQS O;  4HYT B;  1NVO A;  5CCH D;  1U57 A;  1JMM A;  1WRG A;  1NAY A;  3JC2 2;  3L35 A;  2KZJ A;  1YHQ P;  4PV1 D;  2QM8 A;  4U7J A;  5E79 H;  1UIX A;  2UWJ E;  1Q86 Q;  3BCC J;  2PAJ A;  2WVR A;  1KD1 Q;  5KJ7 A;  1KQL A;  1MKM A;  2IFN A;  3HUS B;  1N7L A;  1LTA C;  1BSN A;  1RQU A;  4ASV A;  2WPV B;  3A0H E;  1IFP A;  3KXD A;  5KJ7 D;  4D6T E;  2R5D A;  1Q82 Q;  1NTK G;  2Y0E A;  3VYI A;  1S72 P;  1VQL P;  5GTH H;  1FS0 E;  2IBZ G;  2P10 A;  1NTZ K;  1SQQ D;  1X0T A;  1QVF O;  2QRX A;  1T3U A;  1N7S A;  2Z5I A;  2FXP A;  2RMZ A;  2C0X A;  2H8P D;  3HUS C;  3OA7 A;  1ZME C;  3G6E P;  2ZXE B;  3CCQ P;  1PP9 E;  5KLI B;  1SQB G;  3TGU D;  3A2A A;  1NTM J;  2FYU G;  4XFJ A;  1GDT A;  3ZDM A;  3LW5 H;  4U3F E;  5BVZ A;  1FAV A;  1P84 E;  1J1E B;  3L74 E;  2QVA A;  3NMD A;  3GHG B;  4GIF A;  1AVO A;  1KC8 Q;  3IR9 A;  2E5T A;  3OW2 O;  3VMY A;  1SQP D;  1FZC B;  3O8Z A;  5KLI C;  1JY2 N;  2CPB A;  3WU2 H;  1RE3 C;  1HF9 A;  4BRY B;  1SQQ J;  1J1E C;  1GMJ A;  5EFW B;  3KYQ A;  3CCS P;  1CI6 A;  1FOS E;  2YNY A;  2BEZ F;  2OYI A;  2JEE A;  5APV A;  5APU A;  1DD4 A;  2XU6 A;  1HJB A;  1FZC C;  3FWL A;  1N73 A;  2NZ2 A;  3H1K D;  4PJ0 E;  2KS1 B;  2J59 M;  1LTB C;  4H13 B;  1NH4 A;  3BRT B;  4JQ0 D;  2FKW B;  2GA1 A;  2AEM A;  1OVR A;  5GTI H;  2BCC E;  1EDJ A;  2FFD B;  3JCU E;  3L71 J;  2K1A A;  2WPR A;  1MUU A;  1YBK A;  1PGQ A;  1U7J A;  1SQP J;  3T97 B;  1FE6 A;  4NPF X;  3GHG A;  4H13 C;  1OW7 A;  5H2F E;  2POH A;  2H89 C;  3V2P A;  4L73 A;  1PPJ D;  3Q5S A;  4YTP C;  1VQK P;  2FFD C;  1DX7 A;  3H1H G;  5AVU B;  1FU1 A;  1RF1 B;  2B88 A;  2V4H A;  1ZP0 C;  2H43 A;  1SQQ K;  3TYY A;  1J2J B;  2QJK B;  1DIP A;  1N8R Q;  2K88 A;  4BRY A;  1LT9 B;  1ZXG A;  1Q2N A;  2Y0D A;  3H1K J;  1S5L H;  3H1L D;  3CWB G;  1SVF A;  2J58 A;  3GW6 A;  1BGY G;  1KFN A;  3CX5 D;  3JSV C;  3PJS K;  1OW6 A;  1L0N J;  3BRV B;  3HTK A;  3C8V A;  4PD4 D;  2QJK C;  1Q90 D;  4H44 B;  2IDB A;  1JTH B;  1LT9 C;  1M57 D;  2QG4 A;  4WWI A;  2HPC A;  1L4A B;  1QVG O;  4H0L B;  1GK6 A;  5KTB A;  1SQP K;  4K35 A;  2JJL A;  2C9L Y;  1VPC A;  2YIU B;  4H13 D;  3AEF C;  5L8R J;  2C9N Y;  4YXD C;  3T97 A;  5AVY B;  3M9H A;  1NTM E;  2KXP B;  4H44 C;  1PL5 A;  5DJT B;  1YQ3 C;  1FZB A;  2LXC B;  1RF0 A;  4JF7 A;  4OGQ B;  3OJA B;  1MV8 A;  4H0L C;  2FY8 A;  1RF1 A;  3H1L J;  2NPS A;  3I5C A;  2YIU C;  1JO5 A;  3U1C A;  4D6T D;  3A0B E;  1E5W A;  2MJZ A;  2N9B A;  1S2E A;  2Q5U A;  1LT9 A;  3S1K A;  2WSC H;  1XTC C;  1JNM A;  2E74 C;  2RKL A;  2O1K A;  5KLV J;  3VTP C;  2WSF J;  2GUS A;  1S3J A;  3C9I A;  3L4F A;  1YI2 P;  1RE4 A;  1PP9 D;  4DZO A;  3TSI A;  1QL1 A;  1LJ2 A;  1IFJ A;  3CL3 D;  1JOC A;  3W68 A;  4L76 A;  4Y99 B;  3V4Q A;  1L4A A;  1LTI C;  2O1J A;  3L74 D;  1GTW A;  4H44 D;  3WUU A;  1LWU B;  4LC1 A;  5AW3 B;  4NPE A;  2QIW A;  3USS A;  4UB8 E;  4RES B;  1L4A D;  3L71 E;  4H0L D;  1BDD A;  3MZW B;  3AEC C;  2WT7 B;  1BE3 G;  1GU5 A;  4Z1M H;  2K9Y A;  5CJ4 A;  4D6T J;  4ZMD A;  1P84 I;  3OAK A;  1K04 A;  1ZLL A;  4B86 A;  1EXI A;  4WBA A;  5AW2 B;  1PGP A;  3B5N B;  3EWK A;  4K3A A;  4OGQ D;  1T2K D;  3O6Q A;  1ZN5 A;  1PP9 J;  1P84 H;  4GT1 A;  3B71 A;  3II6 A;  2IPP A;  1M56 D;  1Y8A A;  3CC7 P;  4C7R A;  2WSE J;  3NXS A;  2BCC D;  5K5G B;  2AEJ A;  3FX0 A;  1NYH A;  2E5Y A;  2JKV A;  2LR2 A;  2W8Z A;  3B5N C;  1J1D C;  4C46 A;  4DT0 A;  1FJP A;  1VQ8 P;  1L0N E;  4GOE A;  4RJT A;  1KN7 A;  4GOF A;  2ZT9 B;  1NWQ A;  1AVY A;  4DOJ A;  1LWU A;  1PZQ A;  1KB9 I;  2VRS A;  5CCH C;  2A06 E;  5B66 H;  5AW5 B;  3BAT A;  3VMZ A;  4PV1 C;  3MGN A;  3G71 P;  3PLN A;  2H7H A;  5TIS E;  1NU1 J;  4XE5 B;  2FXM A;  2RN0 A;  1EDL A;  3L72 G;  2ZT9 C;  4BXL A;  1M7L A;  1KB9 H;  2YO2 A;  3RK3 E;  1U7M A;  3JCU H;  3B5N A;  1VQP P;  1D7M A;  1N7S B;  2BCC J;  5KJ7 C;  2KUB A;  1JB0 J;  3M9B A;  2KLV A;  3B5N D;  1EDI A;  5H2F H;  3GMA A;  3N4X A;  5KLV E;  3L73 E;  3MTU E;  2OQQ A;  2W83 C;  1FBM A;  3CPW O;  3CXH E;  4UB6 E;  3SFE C;  1LTG C;  3GG2 A;  3AE8 C;  3MP7 B;  3MUD A;  1JY3 N;  1JMB A;  1QL2 A;  1L0L G;  1N7S C;  3H1I E;  2WPQ A;  3H1J G;  5KAF E;  2E76 B;  1M8O B;  2QJP C;  1HGV A;  1NTM D;  5APQ A;  2KOG A;  1NTK J;  4GOD A;  2KI7 B;  4IFD K;  1S1C X;  4IOI H;  1KQF B;  1NTZ G;  2ZT9 D;  2B89 A;  4ZKP A;  5AW9 B;  1KYO E;  5AW8 B;  3NTN A;  3EFF K;  1YTZ T;  2C0W A;  1SQV G;  3KZI H;  1FDM A;  1CI6 B;  3Q3D A;  3VP9 A;  2E76 C;  3WUV A;  2V7Q J;  2OYI B;  3CI9 A;  1IO4 A;  1SQB J;  3EFG A;  2N9Y B;  2IZ1 A;  4YXW H;  1N73 B;  2KYV A;  2WQY C;  2Q9I A;  1VQ6 P;  2JDI H;  2AXC A;  3VP8 A;  2W90 A;  3BCC G;  3CCV P;  3CD6 P;  4OH8 B;  1QGK B;  2N1T A;  2Q3I A;  1N7S D;  5AVS B;  2OYI C;  1R8E A;  4W80 A;  2K37 A;  4KJM A;  1N73 C;  1LGH B;  3P8M C;  1OMI A;  3MD0 A;  1JY3 O;  3RGU A;  1NTK K;  2YXQ B;  3F5H A;  1VQN P;  3BVH A;  1EZV E;  3L71 D;  2SPZ A;  4N78 E;  3RK3 B;  3I55 P;  5B5E H;  4ASW A;  3L72 E;  3W67 A;  2E76 D;  2WWW A;  4JPZ B;  1RY3 A;  1IK7 A;  4I2L C;  1RH5 B;  1T3J A;  2IX7 C;  5AW7 B;  2K9J A;  2KB7 P;  3GHG C;  1JCC A;  1NU1 E;  5APT A;  3A3Y B;  2HG5 D;  3RK3 C;  1QLE D;  5AVR B;  2WMM A;  3HTK B;  2B87 A;  3L75 G;  3KDP B;  4GDO A;  1EXJ A;  1EDK A;  3M06 A;  5CJ0 A;  1NTM K;  2M5A A;  2HPC B;  1KIL A;  1L0N D;  3AE6 C;  3M91 A;  3KPE A;  1SQQ G;  1NO4 A;  4ZNC A;  3GF3 A;  1XTG B;  4HB1 A;  1NAF A;  2A06 D;  2ZXX A;  1W5C E;  1SP4 A;  1IFD A;  1WT6 A;  2R3C A;  3F89 A;  3HRN A;  4AQR D;  3A5T A;  3CMA P;  1SQV E;  2J5U A;  3IN6 A;  3TGU G;  5AW1 B;  1M1K Q;  1LNQ A;  2NPS B;  4C7N A;  3L37 A;  1NTK E;  3N7N A;  3RK3 D;  4DCK A;  2IBZ E;  3E7K A;  4IFM A;  1USD A;  2W6J H;  1M1J B;  3KQG A;  2CPS A;  4N6J A;  3D6Y A;  2KNC B;  3UIA A;  1RF0 C;  1SQP G;  3M0D A;  1R5L A;  1RF1 C;  4QMA A;  3SWY A;  2NPS C;  1WMK A;  5KLV D;  4EI2 A;  3L73 D;  3AE9 C;  5E79 E;  1SQB E;  3IF4 A;  3CXH D;  1QX8 A;  1VF5 B;  2FYU E;  2R44 A;  1IFM A;  1X8Y A;  1GU4 A;  2HLO A;  1OIP A;  5TIS H;  4L75 A;  1M1J C;  2AXT H;  4EIJ A;  4HKZ H;  1FDO A;  3CX5 I;  3H1I D;  4WY4 A;  4PD4 I;  3TK1 A;  1IC2 A;  2HOD A;  1RE4 C;  2JWA A;  2YKO A;  2I8D A;  3R2P A;  5AW4 B;  2O01 N;  3VOP A;  5GTH E;  1VF5 C;  3WMM 0;  2KK7 A;  1KYO D;  3RL0 B;  5KAI H;  1LP1 B;  3CX5 H;  1L4A C;  3L70 G;  3H6P A;  4IFF A;  4PD4 H;  2W27 A;  3ABV C;  1L2P A;  2WSF H;  1VQO P;  1VDF A;  1S4X A;  1H0T A;  5AVZ B;  1DH3 A;  2XNX A;  2P2U A;  3O6Q B;  2ZYA A;  1M1J A;  3TNU A;  4O9B A;  3L73 J;  3U1A A;  2NPS D;  2KNC A;  3L75 E;  5AVT B;  1L0N K;  1PPJ G;  4JYC A;  3VMA A;  2YMK A;  1VQ4 P;  4OGQ C;  2OYH A;  1T2K C;  1NJI Q;  3U59 A;  3AEE C;  3H1I J;  4N3Y B;  2YMY A;  2QM7 A;  1W2E A;  1H88 A;  2OTK E;  3WU2 E;  4AYC A;  2WSC J;  3H1L G;  2K3R A;  3CME P;  3V6I A;  3GF7 A;  2R32 A;  2KLU A;  3A0H H;  5AVX B;  1VF5 D;  1SLQ A;  3FWN A;  1EZV D;  1A02 F;  1A02 J;  1URQ A;  1HUC A;  4N78 D;  5CCG A;  2PP6 A;  3H1H E;  3AEA C;  1Z56 A;  2Q7C A;  3L72 D;  2QJY B;  4RKU J;  3FXD A;  1LP1 A;  2QA4 P;  4Y99 C;  1AQT A;  3EQ2 A;  5CCG D;  3E1I A;  1R5S A;  1HGZ A;  1LWU C;  3CWB E;  1RQV A;  2FXO A;  5GTI E;  5KLV K;  1NU1 D;  3RL0 D;  2QE7 H;  1LTT C;  1BGY E;  3S9O A;  3L36 A;  3P7K A;  2WSE H;  2YKP A;  3CLQ A;  2P1J A;  3V4W A;  2QJY C;  1SQX G;  2I1J A;  4WB4 A;  3SWK A;  4RO0 A;  2RH0 A;  3HD7 A;  4D6T G;  3CCJ P;  1OVU A;  2OTJ P;  3NFQ A; 
#chains in the Genus database with same CATH homology
 1X9V A;  1CI6 B;  3V2N A;  3VP9 A;  2FYZ A;  2FFD B;  4XA4 A;  2GUV A;  2Z5H A;  5AVW B;  2OYI B;  3HE5 B;  3CI9 A;  3RL0 C;  2WZ7 A;  2WPR A;  1LTS C;  1IO4 A;  3EFG A;  1MUU A;  1N73 B;  2KYV A;  1GZL A;  3HD7 B;  5APX A;  2Q9I A;  2BAS A;  1GL2 A;  3GHG A;  1X79 B;  4HH2 A;  3M0A A;  2YKQ A;  3VP8 A;  2POH A;  2HYN A;  3V2P A;  4OH8 B;  2HFE D;  2FFD C;  1DX7 A;  2N1T A;  3G3Z A;  2Q3I A;  5AVU B;  1FU1 A;  1N7S D;  3IFM A;  1RF1 B;  5AVS B;  2OYI C;  1OWA A;  1SQQ K;  2H43 A;  1IJD B;  1FZE A;  1KZU B;  2OAR A;  3TYY A;  4W80 A;  1J2J B;  1T8Z A;  1YYC A;  1SFC A;  1KFM A;  1JTH A;  5APY A;  1G1I A;  1N73 C;  2XDJ A;  3HD7 C;  1LT9 B;  1ZV8 A;  1LGH B;  3P8M C;  3MD0 A;  1JY3 O;  1GL2 B;  1NTK K;  2E42 A;  3BVH A;  3B8E B;  2KSJ A;  1SVF A;  2J58 A;  5AVQ B;  3PP5 A;  4N78 E;  3RK3 B;  1KFN A;  5BU8 B;  1NHL A;  1URQ D;  2I1K A;  2N1T B;  2ZFC A;  3BRV B;  3HTK A;  3LID A;  2WTY A;  4W7Y A;  1LTJ A;  1SFC B;  1HWT C;  2LKM A;  2WWW A;  3A7O A;  2IFM A;  1JTH B;  1ZR2 A;  1RY3 A;  2A45 I;  4I2L C;  2IX7 C;  1T3J A;  5AW7 B;  1S9K E;  1LT9 C;  3HE4 A;  2KB7 P;  2HPC A;  4M3L A;  1GL2 C;  1JCC A;  3GHG C;  3H32 B;  1L4A B;  1IFI A;  1GK6 A;  5KTB A;  1SQP K;  2JJL A;  3A3Y B;  3HE5 A;  1N86 A;  1HVV A;  1VPC A;  5APT A;  2C9L Y;  4KHX A;  2HG5 D;  3RK3 C;  1JUN A;  1J1D B;  2N1T C;  2C9N Y;  2R5B A;  5AVR B;  1NU1 K;  3T97 A;  5AVY B;  3HTK B;  4I6M C;  3M9H A;  1MZ9 A;  2A45 H;  3KDP B;  1LTJ B;  1SFC C;  3V2Q A;  1G2C B;  2P7J A;  1FZA A;  1FZB A;  3M06 A;  1RF0 A;  4ZKU A;  4JF7 A;  4W7Z A;  3HE4 B;  5CJ0 A;  1NTM K;  2HPC B;  3OJA B;  1MV8 A;  1KIL A;  3HD7 D;  1NKN A;  1AFO A;  1RF1 A;  3M91 A;  2NPS A;  5APS A;  3I5C A;  3KPE A;  3VMX A;  1JO5 A;  2WPS A;  3U1C A;  1NO4 A;  1L0L K;  1YTZ I;  1E5W A;  2MJZ A;  1XTG B;  2N9B A;  2Q5U A;  3MIW A;  1LT9 A;  2WSC H;  4JYB A;  1CW5 A;  1XTC C;  1NAF A;  1JNM A;  2XV5 A;  1LTJ C;  2O1K A;  1SP4 A;  3VTP C;  1SQX K;  1IFD A;  1WT6 A;  2GM4 A;  2R3C A;  2GUS A;  3A5T A;  3HRN A;  4AQR D;  1H89 A;  1IK9 A;  2L5G B;  1HH0 A;  4LGD E;  1KIL B;  3C9I A;  3L4F A;  3SWF A;  5AW1 B;  1JY2 P;  1GL2 D;  1RE4 A;  5BU5 A;  2NPS B;  4C7N A;  1ZR4 A;  1SQV K;  1FOS F;  2WT7 A;  4DZO A;  3L37 A;  3TSI A;  1MFZ A;  1QL1 A;  3N7N A;  4LLH A;  3RK3 D;  1JY3 P;  1IFJ A;  3CL3 D;  2W6A A;  1JOC A;  2A45 G;  4IFM A;  2N1T D;  4Y99 B;  3V4Q A;  1HBW A;  3H32 A;  1L4A A;  1M1J B;  2XZR A;  3KQG A;  1LTI C;  2CPS A;  2O1J A;  4N6J A;  1GTW A;  1SFC D;  3UIA A;  1RF0 C;  1LWU B;  4AUW A;  2Z4E A;  4LC1 A;  5AW3 B;  1KIL C;  2W6B A;  3M0D A;  4RES B;  1RF1 C;  1G1J A;  3SWY A;  1L4A D;  2NPS C;  1PFI A;  4C7N B;  1NKZ B;  5AW6 B;  1H8A A;  2WT7 B;  1GU5 A;  1G2C A;  3RK2 B;  3P8C D;  5CJ4 A;  1IFM A;  2O01 H;  1FJK A;  1X8Y A;  3OAK A;  5CMZ A;  1GU4 A;  1SQB K;  2HLO A;  1M1J C;  5CCH A;  3V2R A;  4EIJ A;  2P67 A;  1ZLL A;  2FYU K;  4B86 A;  4WY4 A;  4WBA A;  5AVV B;  5AW2 B;  1FZG A;  3B5N B;  3V5B A;  3HUS A;  3TK1 A;  1IC2 A;  2KP8 A;  4HYT B;  2HOD A;  1CSB A;  1RE4 C;  5CCH D;  1N2D C;  1JMM A;  1WRG A;  1T2K D;  1GW4 A;  2YKO A;  3R2P A;  5AW4 B;  3VOP A;  1ZN5 A;  3L35 A;  3RK2 C;  4GT1 A;  3II6 A;  3WMM 0;  2QM8 A;  3RL0 B;  2IPP A;  4C7R A;  1L4A C;  2PAJ A;  5CHX A;  3H6P A;  3NXS A;  4IFF A;  3M9Q A;  4WY4 B;  5KJ7 A;  1KQL A;  2W27 A;  2IFN A;  4I1L A;  2WSF H;  3B5N C;  1J1D C;  3M0D C;  4C46 A;  3HUS B;  1VDF A;  1FJP A;  1N7L A;  2HOD B;  5AVZ B;  1LTA C;  1KIL D;  1NOH A;  2XNX A;  1DH3 A;  2XKM A;  2P2U A;  3TNU A;  1M1J A;  2M3B A;  4O9B A;  3U1A A;  2NPS D;  5KJ7 D;  2R5D A;  1NWQ A;  5AVT B;  1L0N K;  4JYC A;  4DOJ A;  1LWU A;  1RE3 A;  3VYI A;  2OYH A;  2VRS A;  5CCH C;  1NTZ K;  1T2K C;  5AW5 B;  1IFN A;  1HTL C;  1T3U A;  1N7S A;  3U59 A;  4WY4 C;  2Z5I A;  3BAT A;  3VMZ A;  4N3Y B;  2YMY A;  3MGN A;  2QM7 A;  2C0X A;  2WIT A;  1W2E A;  2H7H A;  2H8P D;  3HUS C;  3OA7 A;  1FZF A;  1H88 A;  4XE5 B;  2FXM A;  4AYC A;  2ZXE B;  3VN0 A;  3TNU B;  1FZC A;  1M7L A;  2YO2 A;  2R32 A;  1CZQ A;  5AVX B;  1JY2 O;  3A2A A;  3RK2 D;  2E43 A;  1DEB A;  1SLQ A;  4GKG A;  2M8R A;  2OYH B;  1JCD A;  1A02 F;  1GDT A;  1A02 J;  3B5N A;  3LW5 H;  5BVZ A;  1URQ A;  1HUC A;  1FAV A;  4N78 D;  1J1E B;  5CCG A;  1N7S B;  2PP6 A;  3NMD A;  3GHG B;  5KJ7 C;  1Z56 A;  4GIF A;  2Q7C A;  3M9B A;  1GW3 A;  3IR9 A;  4EOT A;  2KLV A;  1EQ7 A;  1AQ5 A;  3B5N D;  4Y99 C;  3VMY A;  3N4X A;  1S9K D;  3EQ2 A;  5CCG D;  1FZC B;  3MTU E;  1OXZ A;  3O8Z A;  3E1I A;  1JY2 N;  1FBM A;  2CPB A;  1HGZ A;  3P8C E;  1LWU C;  1RE3 C;  3LIE A;  1LTG C;  2OYH C;  5KLV K;  3RL0 D;  1GD2 E;  1LTT C;  3MUD A;  1JY3 N;  1URQ B;  1QL2 A;  1J1E C;  1N7S C;  3L36 A;  3P7K A;  3KYQ A;  1CI6 A;  1FOS E;  2WPQ A;  2WSE H;  2FFD A;  2YKP A;  2YNY A;  3CLQ A;  2P1J A;  3V4W A;  4WY4 D;  1HGV A;  2OYI A;  3BAS A;  2YO3 A;  2JEE A;  5APV A;  5APU A;  5APQ A;  2XU6 A;  2KOG A;  1HJB A;  2I1J A;  4WB4 A;  1GK4 A;  1FZC C;  5APW A;  4IFD K;  1N73 A;  3HD7 A;  5AW0 B;  2J59 M;  4ZKP A;  5AW9 B;  5AW8 B;  1LTB C;  3NTN A;  1NH4 A;  3BRT B;  1YTZ T;  2C0W A;  3P32 A;  1URQ C;  2FKW B;  3NFQ A;  1FDM A;  5CCG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...