1FZHE

Methane monooxygenase hydroxylase, form ii pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
165
structure length
165
Chain Sequence
b'KLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 165
sequence length 165
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fzhE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fzhE02
1XVGE 1XU3E 1XMHE 1MMOG 1FZ2E 1FZ6E 1XVDE 1XMGE 1MTYG 1FZHE 1FZ8E 1XVBE 1FZIE 1XVEE 1FZ5E 1XVFE 1MHYG 1FZ0E 1MHZG 1FZ9E 1FZ1E 1XMFE 1XU5E 1FZ7E 1XVCE 1FYZE 1FZ4E 4GAMC 1FZ3E
chains in the Genus database with same CATH superfamily
1XVGE 2JHPA 1MMOG 3QNNA 1FZ2E 3SPZA 3L2OB 4HCBA 4DTNA 4I6JB 3SVIA 4M3WA 2PFVA 3J2PA 3SQ0A 2B8IA 4IT5A 3OGKB 4EP9A 1MTYG 3NE6A 3SUQA 2OZSA 4KHUA 4M42A 3UIQA 2K5SA 2RCUA 4ADNA 3NDKA 3LD8A 4FJXA 4KHNA 3K2OA 1XVEE 1XVFE 3HGLA 4M41A 1Q9YA 2OZMA 4J2EA 3MKSB 4X5NA 4E3SA 1MHZG 1FZ9E 2VIXA 3WSOA 2DEBA 3SUNA 1IH7A 3CFRA 4X5MA 1JW2A 3C6OB 3QNOA 2P1OB 1FZ4E 1FZ3E 4AKGA 1P22A 3TAEA 2HD0A 1WAFA 3V7DB 3HL8A 5IBKB 4FJMA 4ICGC 3UO2A 1XL3C 4M3XA 4KHYA 3QEXA 4HCCA 2RKHA 4QNDA 4DTPA 3CFPA 1XMGE 3QETA 4M3TA 2B1EA 2P1QB 5H37A 2JQTA 2QXFA 3NCIA 2JHAA 2PFTA 4ADOA 2DY4A 4AKHA 3RWUA 3SPYA 1MHYG 3QEIA 4DTOA 4FVMA 4DU3A 2VJ4A 2OVRB 4EYWA 3LDSA 4FJ8A 4KHQA 3HGKE 1FS1A 1Q9XA 4FJGA 4B08A 3L8BA 2P5GA 4FJ7A 3C94A 1LDKE 3L0MA 3TABA 3LZJA 3RMAA 3QERA 1XU3E 1XMHE 4FJIA 3E4YA 3LDBA 1CLQA 1IG9A 1NEXB 3QEWA 2JH9A 2MMBA 3RMCA 1FPOA 1XVDE 4KI6A 3OGLB 4FJJA 4RG8A 4FJ9A 2P1PB 2MZWB 4KHSA 3J27A 4FK2A 4J2AA 4M3RA 4JRQA 3RMDA 5IZ7A 2P1NB 1XVBE 1FZIE 2H4TA 4FJNA 3N1EA 4M3ZA 2DTUA 4EPHA 3E4WA 3L1NA 4E4BA 4DU1A 2LF3A 2E32A 4RL5A 4RNGA 4FJKA 4KHWA 4I9LA 1XMFE 2OVQB 4FJ5A 4DTUA 4M45A 1XU5E 3C95A 4AKIA 3SQ1A 3CFOA 1FZ7E 1XVCE 4I9QA 1FYZE 4JRPA 4GAMC 4QNCA 4FK0A 3RMBA 3BVOA 4M3YA 3S9HA 3C6PB 3UO3A 4DU4A 2FW3A 4J2DA 4M3UA 3C6NB 1FZ6E 3CQ8A 3SQ2A 3TL8B 3NGIA 3SQ4A 2JHCA 2P5OA 4DTRA 4DTMA 2E31A 1N1CA 1FZHE 3QESA 2FYOA 3TAFA 4AI6A 2JPNA 1FZ8E 3N1BA 4DTSA 2JH8A 3SCXA 3QEVA 4JS4A 2OVPB 3QEPA 1FZ5E 4DTXA 3SUPA 3NAEA 3TAGA 3SI6A 4JS5A 2B7MA 4KI4A 3TJYA 3KD1E 1FZ0E 3NHGA 4FJLA 3SUOA 2ATQA 1FZ1E 3LZIA 2LF6A 3HP9A 2OYQA 4FJHA 4J2BA 3OGMB 1WAJA 5IREA 3SJJA 3SNNA 2P1MB 1FXXA 2VJ5A 4FK4A 2YB5A 3KD5E 4DTJA 2MW2A
chains in the Genus database with same CATH topology
1XVGE 2JHPA 1MMOG 3QNNA 1FZ2E 3SPZA 3L2OB 4HCBA 4DTNA 4I6JB 3SVIA 4M3WA 2PFVA 3J2PA 3SQ0A 2B8IA 4KHUA 3OGKB 4EP9A 1MTYG 3NE6A 3SUQA 2OZSA 4M42A 3UIQA 2RCUA 4ADNA 3NDKA 3LD8A 4FJXA 4KHNA 3K2OA 1XVEE 1XVFE 3HGLA 4M41A 1Q9YA 2OZMA 4J2EA 3MKSB 4X5NA 4E3SA 1MHZG 1FZ9E 2VIXA 3WSOA 2DEBA 3SUNA 1IH7A 3CFRA 4X5MA 3C6OB 3QNOA 2P1OB 1FZ4E 1FZ3E 4AKGA 1P22A 3TAEA 2HD0A 1WAFA 3V7DB 3HL8A 5IBKB 4FJMA 1XL3C 4M3XA 4KHYA 3QEXA 4HCCA 4QNDA 4DTPA 3CFPA 1XMGE 3QETA 4M3TA 2B1EA 2P1QB 5H37A 2QXFA 3NCIA 2JHAA 2PFTA 4ADOA 2DY4A 4AKHA 3RWUA 3SPYA 1MHYG 3QEIA 4DTOA 4FVMA 4DU3A 2VJ4A 2OVRB 4EYWA 3LDSA 4FJ8A 4KHQA 3HGKE 1FS1A 1Q9XA 4FJGA 4B08A 3L8BA 2P5GA 4FJ7A 3C94A 1LDKE 3L0MA 3TABA 3LZJA 3RMAA 3QERA 1XU3E 1XMHE 4FJIA 3E4YA 3LDBA 1CLQA 1IG9A 1NEXB 3QEWA 2JH9A 2MMBA 3RMCA 1XVDE 4KI6A 3OGLB 4FJJA 4RG8A 4FJ9A 2P1PB 2MZWB 4KHSA 3J27A 4FK2A 4J2AA 4M3RA 4JRQA 3RMDA 5IZ7A 2P1NB 1XVBE 1FZIE 2H4TA 4FJNA 3N1EA 4M3ZA 2DTUA 4EPHA 3E4WA 3L1NA 4E4BA 4DU1A 2LF3A 2E32A 4RL5A 4RNGA 4FJKA 4KHWA 4I9LA 1XMFE 2OVQB 4FJ5A 4DTUA 4M45A 1XU5E 3C95A 4AKIA 3SQ1A 3CFOA 1FZ7E 1XVCE 4I9QA 1FYZE 4JRPA 4GAMC 4QNCA 4FK0A 3RMBA 4M3YA 3S9HA 3C6PB 4J2DA 4DU4A 2FW3A 4M3UA 3C6NB 1FZ6E 3CQ8A 3SQ2A 3TL8B 3NGIA 3SQ4A 2JHCA 2P5OA 4DTRA 4DTMA 2E31A 1FZHE 3QESA 2FYOA 3TAFA 4AI6A 2JPNA 1FZ8E 3N1BA 4DTSA 2JH8A 3SCXA 3QEVA 4JS4A 2OVPB 3QEPA 1FZ5E 4DTXA 3SUPA 3NAEA 3TAGA 3SI6A 4JS5A 2B7MA 4KI4A 3TJYA 3KD1E 1FZ0E 3NHGA 4FJLA 3SUOA 2ATQA 1FZ1E 3LZIA 2LF6A 3HP9A 2OYQA 4FJHA 4J2BA 3OGMB 1WAJA 5IREA 3SJJA 3SNNA 2P1MB 1FXXA 2VJ5A 4FK4A 2YB5A 3KD5E 4DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XVG E;  1XU3 E;  1XMH E;  1MMO G;  1FZ2 E;  1FZ6 E;  1XVD E;  1XMG E;  1MTY G;  1FZH E;  1FZ8 E;  1XVB E;  1FZI E;  1XVE E;  1FZ5 E;  1XVF E;  1MHY G;  1FZ0 E;  1MHZ G;  1FZ9 E;  1FZ1 E;  1XMF E;  1XU5 E;  1FZ7 E;  1XVC E;  1FYZ E;  1FZ4 E;  4GAM C;  1FZ3 E; 
#chains in the Genus database with same CATH topology
 1XVG E;  2JHP A;  1MMO G;  3QNN A;  1FZ2 E;  3SPZ A;  3L2O B;  4HCB A;  4DTN A;  4I6J B;  3SVI A;  4M3W A;  2PFV A;  3J2P A;  3SQ0 A;  2B8I A;  4IT5 A;  3OGK B;  4EP9 A;  1MTY G;  3NE6 A;  3SUQ A;  2OZS A;  4KHU A;  4M42 A;  3UIQ A;  2K5S A;  2RCU A;  4ADN A;  3NDK A;  3LD8 A;  4FJX A;  4KHN A;  3K2O A;  1XVE E;  1XVF E;  3HGL A;  4M41 A;  1Q9Y A;  2OZM A;  4J2E A;  3MKS B;  4X5N A;  4E3S A;  1MHZ G;  1FZ9 E;  2VIX A;  3WSO A;  2DEB A;  3SUN A;  1IH7 A;  3CFR A;  4X5M A;  1JW2 A;  3C6O B;  3QNO A;  2P1O B;  1FZ4 E;  1FZ3 E;  4AKG A;  1P22 A;  3TAE A;  2HD0 A;  1WAF A;  3V7D B;  3HL8 A;  5IBK B;  4FJM A;  4ICG C;  3UO2 A;  1XL3 C;  4M3X A;  4KHY A;  3QEX A;  4HCC A;  2RKH A;  4QND A;  4DTP A;  3CFP A;  1XMG E;  3QET A;  4M3T A;  2B1E A;  2P1Q B;  5H37 A;  2JQT A;  2QXF A;  3NCI A;  2JHA A;  2PFT A;  4ADO A;  2DY4 A;  4AKH A;  3RWU A;  3SPY A;  1MHY G;  3QEI A;  4DTO A;  4FVM A;  4DU3 A;  2VJ4 A;  2OVR B;  4EYW A;  3LDS A;  4FJ8 A;  4KHQ A;  3HGK E;  1FS1 A;  1Q9X A;  4FJG A;  4B08 A;  3L8B A;  2P5G A;  4FJ7 A;  3C94 A;  1LDK E;  3L0M A;  3TAB A;  3LZJ A;  3RMA A;  3QER A;  1XU3 E;  1XMH E;  4FJI A;  3E4Y A;  3LDB A;  1CLQ A;  1IG9 A;  1NEX B;  3QEW A;  2JH9 A;  2MMB A;  3RMC A;  1FPO A;  1XVD E;  4KI6 A;  3OGL B;  4FJJ A;  4RG8 A;  4FJ9 A;  2P1P B;  2MZW B;  4KHS A;  3J27 A;  4FK2 A;  4J2A A;  4M3R A;  4JRQ A;  3RMD A;  5IZ7 A;  2P1N B;  1XVB E;  1FZI E;  2H4T A;  4FJN A;  3N1E A;  4M3Z A;  2DTU A;  4EPH A;  3E4W A;  3L1N A;  4E4B A;  4DU1 A;  2LF3 A;  2E32 A;  4RL5 A;  4RNG A;  4FJK A;  4KHW A;  4I9L A;  1XMF E;  2OVQ B;  4FJ5 A;  4DTU A;  4M45 A;  1XU5 E;  3C95 A;  4AKI A;  3SQ1 A;  3CFO A;  1FZ7 E;  1XVC E;  4I9Q A;  1FYZ E;  4JRP A;  4GAM C;  4QNC A;  4FK0 A;  3RMB A;  3BVO A;  4M3Y A;  3S9H A;  3C6P B;  3UO3 A;  4DU4 A;  2FW3 A;  4J2D A;  4M3U A;  3C6N B;  1FZ6 E;  3CQ8 A;  3SQ2 A;  3TL8 B;  3NGI A;  3SQ4 A;  2JHC A;  2P5O A;  4DTR A;  4DTM A;  2E31 A;  1N1C A;  1FZH E;  3QES A;  2FYO A;  3TAF A;  4AI6 A;  2JPN A;  1FZ8 E;  3N1B A;  4DTS A;  2JH8 A;  3SCX A;  3QEV A;  4JS4 A;  2OVP B;  3QEP A;  1FZ5 E;  4DTX A;  3SUP A;  3NAE A;  3TAG A;  3SI6 A;  4JS5 A;  2B7M A;  4KI4 A;  3TJY A;  3KD1 E;  1FZ0 E;  3NHG A;  4FJL A;  3SUO A;  2ATQ A;  1FZ1 E;  3LZI A;  2LF6 A;  3HP9 A;  2OYQ A;  4FJH A;  4J2B A;  3OGM B;  1WAJ A;  5IRE A;  3SJJ A;  3SNN A;  2P1M B;  1FXX A;  2VJ5 A;  4FK4 A;  2YB5 A;  3KD5 E;  4DTJ A;  2MW2 A; 
#chains in the Genus database with same CATH homology
 1XVG E;  2JHP A;  1MMO G;  3QNN A;  1FZ2 E;  3SPZ A;  3L2O B;  4HCB A;  4DTN A;  4I6J B;  3SVI A;  4M3W A;  2PFV A;  3J2P A;  3SQ0 A;  2B8I A;  4KHU A;  3OGK B;  4EP9 A;  1MTY G;  3NE6 A;  3SUQ A;  2OZS A;  4M42 A;  3UIQ A;  2RCU A;  4ADN A;  3NDK A;  3LD8 A;  4FJX A;  4KHN A;  3K2O A;  1XVE E;  1XVF E;  3HGL A;  4M41 A;  1Q9Y A;  2OZM A;  4J2E A;  3MKS B;  4X5N A;  4E3S A;  1MHZ G;  1FZ9 E;  2VIX A;  3WSO A;  2DEB A;  3SUN A;  1IH7 A;  3CFR A;  4X5M A;  3C6O B;  3QNO A;  2P1O B;  1FZ4 E;  1FZ3 E;  4AKG A;  1P22 A;  3TAE A;  2HD0 A;  1WAF A;  3V7D B;  3HL8 A;  5IBK B;  4FJM A;  1XL3 C;  4M3X A;  4KHY A;  3QEX A;  4HCC A;  4QND A;  4DTP A;  3CFP A;  1XMG E;  3QET A;  4M3T A;  2B1E A;  2P1Q B;  5H37 A;  2QXF A;  3NCI A;  2JHA A;  2PFT A;  4ADO A;  2DY4 A;  4AKH A;  3RWU A;  3SPY A;  1MHY G;  3QEI A;  4DTO A;  4FVM A;  4DU3 A;  2VJ4 A;  2OVR B;  4EYW A;  3LDS A;  4FJ8 A;  4KHQ A;  3HGK E;  1FS1 A;  1Q9X A;  4FJG A;  4B08 A;  3L8B A;  2P5G A;  4FJ7 A;  3C94 A;  1LDK E;  3L0M A;  3TAB A;  3LZJ A;  3RMA A;  3QER A;  1XU3 E;  1XMH E;  4FJI A;  3E4Y A;  3LDB A;  1CLQ A;  1IG9 A;  1NEX B;  3QEW A;  2JH9 A;  2MMB A;  3RMC A;  1XVD E;  4KI6 A;  3OGL B;  4FJJ A;  4RG8 A;  4FJ9 A;  2P1P B;  2MZW B;  4KHS A;  3J27 A;  4FK2 A;  4J2A A;  4M3R A;  4JRQ A;  3RMD A;  5IZ7 A;  2P1N B;  1XVB E;  1FZI E;  2H4T A;  4FJN A;  3N1E A;  4M3Z A;  2DTU A;  4EPH A;  3E4W A;  3L1N A;  4E4B A;  4DU1 A;  2LF3 A;  2E32 A;  4RL5 A;  4RNG A;  4FJK A;  4KHW A;  4I9L A;  1XMF E;  2OVQ B;  4FJ5 A;  4DTU A;  4M45 A;  1XU5 E;  3C95 A;  4AKI A;  3SQ1 A;  3CFO A;  1FZ7 E;  1XVC E;  4I9Q A;  1FYZ E;  4JRP A;  4GAM C;  4QNC A;  4FK0 A;  3RMB A;  4M3Y A;  3S9H A;  3C6P B;  4J2D A;  4DU4 A;  2FW3 A;  4M3U A;  3C6N B;  1FZ6 E;  3CQ8 A;  3SQ2 A;  3TL8 B;  3NGI A;  3SQ4 A;  2JHC A;  2P5O A;  4DTR A;  4DTM A;  2E31 A;  1FZH E;  3QES A;  2FYO A;  3TAF A;  4AI6 A;  2JPN A;  1FZ8 E;  3N1B A;  4DTS A;  2JH8 A;  3SCX A;  3QEV A;  4JS4 A;  2OVP B;  3QEP A;  1FZ5 E;  4DTX A;  3SUP A;  3NAE A;  3TAG A;  3SI6 A;  4JS5 A;  2B7M A;  4KI4 A;  3TJY A;  3KD1 E;  1FZ0 E;  3NHG A;  4FJL A;  3SUO A;  2ATQ A;  1FZ1 E;  3LZI A;  2LF6 A;  3HP9 A;  2OYQ A;  4FJH A;  4J2B A;  3OGM B;  1WAJ A;  5IRE A;  3SJJ A;  3SNN A;  2P1M B;  1FXX A;  2VJ5 A;  4FK4 A;  2YB5 A;  3KD5 E;  4DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...