1FZJA

Mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
273
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGDYIALNEDLKTWTAADMAALITKHKWEQAGAAEYYRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title The crystal structures of K(bm1) and K(bm8) reveal that subtle changes in the peptide environment impact thermostability and alloreactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 76
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fzjA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fzjA01
4XTRD 4QRRD 2JK5B 1GGBL 2EDWA 3QHZL 2Y9RT 3CDFA 4JFQB 2EECA 2A0LC 5JORA 3M1BB 4RGOL 4FQPA 1FE8L 2P5EA 4LSPH 4HDIB 1CS6A 3MRHA 4X4XB 4PJAE 4PRPA 2IGFH 5JZ7C 3GO1H 1P4BH 5GGRA 3CVIL 3FO0H 4HWUA 3GIVA 1EMTH 5IF0B 1J1XL 5JOEA 1BVKB 1RU9H 5AYQA 1D9KB 3TWCL 3K1KC 3WDHA 3NCFB 5ELIA 1RUQL 4FQXC 4UTAH 4M9OA 2DQTL 5IMLA 5FUOH 5MENB 1X6NA 4YQXH 3MRQB 4TTGA 1B3JA 5CSZB 2MTPA 2BVPA 3QZWG 1JGDA 4XHJD 4DKFL 1TFHA 1TVDA 1WC7B 4HQQH 5DD1L 5ICZB 5K9KB 5I15H 3L1OH 4X7EC 4RA3A 4M3JA 5JPMA 2DF3A 3QWRA 4LK4A 4Y5XA 5FK9A 4BFBD 4PJIE 1FGNH 5E94B 4HWBH 1T6VN 3WUWG 2W0LA 3GSNB 1KC5H 4S1QH 4R4BB 2PXYA 4F2MB 4FQHA 1RJZB 2VLJA 1A6ZB 1OLLA 3MNVB 5DFVD 4JPVH 5ITFA 3F58H 3VMOA 4RMSA 3H0TA 4QGTA 4I5BA 4N9OB 3T0EE 4GRLC 3MV8E 1V7NH 1CD1B 2AJ3A 1CU4L 5GGSA 1KT2A 5D1QA 3RTQA 4FFZL 2H2PC 1B2WL 3CFCH 4UU9A 5CLWA 3MRMA 3CUPA 2BRQA 4M4PA 2PR4L 1A1NA 2ARJB 5IG7A 2C3WA 1TJIH 1WBZA 4PJDB 4NKDB 2V2XB 2G75A 3QUYB 3HNTH 5IEKB 1KB5L 3R06B 4IBLT 4Z78A 3JVGC 3C5JB 4MGXA 1U8QB 4JFOB 2BNRA 1QBML 5DJYA 1CQYA 4G8GB 5J9PA 5DK2B 2P5WD 4U1JB 1U8MA 2CXKA 5DQDH 4FS0A 1U2HA 2Z8RA 5E8NB 2RCSH 4DAGL 3C8DA 2WBJD 2C1OB 4XNYL 1A1OA 1IQDA 3HI5L 4GO6B 1J87A 5AWNH 1A9EB 2OJZH 5DJ6B 4XMLH 5L2JB 3QEGL 4PG2A 1S7TA 3PWPD 2XWJB 3IS0X 5C07A 1XH3B 4XH2B 3KPRE 4LSVL 1S9VB 3ELAT 1QOKA 1QSZA 2HT3C 3F7PC 5DMYA 3U48A 2XACC 3ZTJG 3VXMA 2WLZA 3QP3A 1JHLH 8FABB 2YBRB 1QRNE 3ILPA 1HHJA 2WIMA 2AV7A 3QG6A 3DPBA 4D94A 2FSEB 5BRZA 3QDGA 1JRHI 4P46A 3S34L 4MA7L 1KLGA 1K3IA 1Z9MA 1R0AL 1RV6X 4U31A 1DEEB 1CDYA 1OP5H 1S5IH 4M7ZC 1AGDA 1D9KD 3IAQA 4MNQE 4MQ7A 1T5XA 3H9ZA 4WHYG 3K4ZA 1MQKL 3P0YH 3GSNH 3ZKSD 3DX8B 4WUUA 5CZVL 2C3VB 3DYPA 4L29B 2DN7A 3G5XA 5INCA 5F1NB 1MCCA 1RZGB 1CE6A 1K3ZA 2JB5H 1CXLA 3BGFC 4HULB 5JPNB 4NKOA 3D69B 1RFDL 3L3HB 4KZDL 2IALA 1CICA 3GMLA 2OR9L 5ESQB 1HINH 1HXMB 1EERB 1H3PL 3CXDH 4HS8L 4ZS6C 4HIIB 4OLXL 3VXPA 5F7DB 1A22B 2GHWB 4G9FA 3K8KA 4X5XB 1NMBH 1A7QL 5D6DA 3OX8B 3H9SA 3FCTB 2G5BA 1BX2B 1UKSA 3GGWB 1VFBA 4OF8A 4QF1B 1G6RB 3VXTB 4XBEH 2OXHA 3QRGL 5IFHH 2I60L 2CIIA 5EUOA 2DJ4A 4OV5B 3OKDA 1LP9E 1F11B 4OCXL 2ZSVA 4WWID 1KGCD 1FFPB 4NQXA 4TULL 1CFNB 5C0CE 1G9NH 2YXMA 5DC0A 3BPLC 3LSOB 3DGCR 1IC1A 1IAOB 4X83A 5LGHH 1MFCL 5BS0E 4YHKH 1P7QB 2CDFB 1CYGA 3C8KB 4N8VG 2NXZB 5GS2H 3P4NA 1NBYB 2ZCHH 2Q1EA 4YHYB 3MA9L 4XVUD 1HH6B 4OLZH 2YMXL 1MUJA 5KSAD 3TO4B 4G8GD 4N5UA 2FJHB 2VLRA 4YJZL 1V7ML 3TN0A 5D5ME 3C6SA 2VXSH 5KW9H 1RUAL 1DBBH 4NPYA 1VGKB 3OJ2C 4MMXC 3ARQA 4LDEB 1FVCB 4M6NH 2EDNA 5ACZA 5DMGD 1ITCA 1HQ4A 2I25N 2R4RL 2OL3A 5GS2D 4OZFG 3ZKMD 4OFIA 35C8L 2R23B 4MA8H 1JN6A 3QDJA 2R0ZL 4QHKJ 4GBXB 2F53A 4NP4H 5HHPB 4GW1A 4QRTA 5J6HA 5CP3A 2APVA 5D2NE 2FGWL 3G6JB 4WI3A 4TRPL 5T5NG 4W4OC 1K8DB 2PYFB 4LKCB 1PBYA 2VQ1B 3HZYA 1KNOA 3RIFF 5HBBA 4JAMA 2GFBA 4JQVC 1H5BA 5ISZE 3GSOB 2D03H 5C8JA 3THMH 4MS8A 5CJ8A 1NCWH 2ITDA 3UZEA 2AEPL 3HAEB 1J8HB 2DQIH 1QLEL 3GSUA 5EU3A 1NBVL 3AREC 3GI9L 3I85A 1QBLH 4BFIB 5DMKB 3PHQB 5HHXH 2OQJA 2NMSA 1P6AB 1CGUA 1S7QA 4BJLA 4DGYH 3MODH 1U92A 2DDQH 2B7DT 4G8FA 4M1GL 1HQRA 2BSTB 1W8OA 1JJUA 1I1FA 5T3ZH 1TNMA 1YEDB 4OCYL 3DVFA 3ALXA 3WJJA 2FATL 4R96B 1UACL 3JWOL 3OAUL 3SO5A 1LO2L 3V4UH 1F4HA 5IQ7L 1G6RH 3OJVC 4ZO7A 4YDJB 4F3FB 1D5ZB 4Q2ZB 4Y5YC 4Z8FH 5FYKU 4OCRL 1C5CH 4N0CA 3DECA 3D0VA 2FR4A 3R0NA 2CLVA 4J1UA 1S78C 2ESVA 1UM5L 3GBMH 5HYJE 3DX7A 1U3HB 2ICWI 1YY9D 2DQHH 4IJ3C 5BW7C 1J0YA 3UYPA 1E4WL 4TPRL 4LNRA 3MRJB 3L3JA 5H37H 2HH0H 3RIAF 3LQAH 1NEZB 4JPWL 4YZFF 2R2BB 1QLFA 2HG5A 1EEZB 1Q0XH 2BCKA 2NY4D 3B9KB 3BZ4A 3B2UD 4KKAD 2YHGA 3LQZB 4OD2A 3VG9B 5DRNB 1S5HA 1S9XB 1CLYH 1WVZA 5AAWA 1XF4A 4JJHA 2O61A 2BVTA 1T7XA 4JDVB 3UPRB 4O02H 2A74A 1PX3A 3ZDXE 1N2RA 5J57B 4HAGA 2LVCA 5GRZA 3WKML 3U6RB 5ESVA 4OZGE 3JWDL 3TBTB 6FABL 2HKHH 1IAII 3NIFF 1BBJB 4HGMA 3UTTB 1MCIA 5GSVB 2MQCA 1MNUH 3L5XH 5J4MA 3VXUE 1PLGH 1A4JB 3BFOA 4YUEL 3UJIH 3GMNB 3FFCA 1EHLL 3KYMA 3TO4D 2OJEB 2VNCA 5AEAA 1PSKH 2ITCB 4O2CA 3WS3B 4J7RA 3IJYB 2AEQL 1CGXA 1VCAA 5FB8B 1YEKH 4LSSH 3QULA 4MZ2A 3WFHB 3EDFA 4S2SB 4X99A 5I8OH 4I3RH 5C0AA 3L7EB 4KK8C 4HIJA 2GSIB 4PV8A 1XGYH 3DXAA 4ODUB 1S7UA 3O2DA 4CMHB 2HTLD 3I75B 4WI6A 2B0SL 3K3QA 3CIQA 5JDSB 1HEZA 3HAEH 3TPUA 1KJ2L 3O4LB 4D8PB 1U8PA 7CGTA 5TE6H 4P5MB 5IJKC 2IF7A 2DLEA 2XWTB 4QRPD 5DJCA 2MSPA 4S11A 3SDXA 4L4VE 1RZIA 3BKCH 4FXKA 2HT2D 3OQ3B 4ZUTA 4W6XB 1SEQH 5FA3A 3BIKA 3WXWL 3EFDL 5A3IC 4GKZB 2AV1B 3BDYL 3QDHA 5DYOA 5I16B 1NCCH 2HJKB 2ADIB 2XN9E 5AZ2L 3RUGB 4JB9H 3U79A 2FO4B 4OGZA 2X4QB 4LSRL 2OSLB 3VCLB 4HWZA 2M26A 5L7XH 3WN5C 4DFHA 1NJ9B 2B2XL 2P44B 1MREL 3HE6C 4AENA 3TA3D 1YEFL 5DMIH 5L2KA 1MHCA 1LO4L 4OJFL 3KPPB 2Q6WB 2B4CC 2NX5D 4RCAA 1PYWB 3V95A 1WFOA 1MRFH 2ZWLT 3FN0L 5HI3D 3G5YA 1HSBB 5IWLA 1YEGH 4XNXL 2PNDA 2VDMH 2Y06H 4MQXC 4PB9L 4K3EH 2E7CA 1MRDL 1KEML 5SV4A 1OTSD 3HR5B 2BNQB 2ZUSA 5SV3A 3HC4H 4AMKH 1C7TA 5HYFA 5FA4B 5JHDA 4GXUM 4NO2A 4Z95H 5DHYA 4HK0A 1CL7I 1IC7H 3FQTA 4JJ5B 4P2CG 4Z7VB 1NFIA 4JZOA 4YWGH 3LEXB 2DL2A 3D18B 1U3HD 2R9HD 2A9ML 4ONGL 2X9XA 5D5MF 5HDQL 1WIOA 3ILQC 3V0WL 4OT1L 3K0WA 5E2VH 1DCLA 4G80A 1SBSL 4X9BA 2ORBL 5I1KH 1I1YA 1MHPH 4GW4B 5GRVL 5IVXB 5IW6A 2X4SA 2YPLA 1AGBA 3DBXB 4Y7MA 4PB0L 1C5DA 2O26U 3EFFA 4M7KL 5B8CC 2HN7A 3LB6C 3B9KD 4J3XA 5C0NC 5KVGL 1LE5B 1EHAA 3MV11 4PJFE 5C6WH 1U91B 4IOIB 5DVNA 5F97E 2OI9C 4ODWA 3FB8A 1TJHH 4JO3H 4Z7WA 1NGQH 2YR3A 4LP5A 4MDJA 4LOUC 4PJ7A 4YK4B 2OTUA 4NDMB 1T1WA 4JO1L 4QTIL 1LHZA 2EH7H 3UTTD 5E2TH 1A6VH 4YIQB 3LD8B 4AIOA 4XTRC 3ZO0A 2WP3T 3B9VA 5FYJU 4RNRA 3IVKA 4NKIL 2DQGL 3HC0A 1U8NA 3CH8A 4YDIL 3U0TA 3MRBB 1KCLA 4WTXA 4M3KB 3GBNH 3T4YB 4XP5H 5IK3A 1I8LC 5KZCB 1JF6A 4O5LH 1BOGA 4XMKL 2NTSP 1I85A 3MUGA 3GMMB 2UY7A 2A6KA 4MD5A 3LKPA 4RFNC 1KIPB 3MMEA 1JPFB 4L8SC 4OD1L 1WBYA 2AK4E 3G5ZA 3MFGB 1PG7H 4X7FC 3BPNB 1S9WB 4P4RB 4AEIH 4KDVA 5C0BA 2YA1A 3VXOA 1E6OL 2VJXA 5JQHC 2VH5H 1SJXA 2EYTA 4XRCA 5CBAA 2I5YH 2XNAA 2NW3A 2X1QA 4D2NA 5HGAB 2EDBA 1DN0A 4MB4A 4XC3H 3S5LA 4PRNB 4WUKL 4KZEL 3UPAA 1RSFA 3B5HA 4YR6A 1ZS8A 1I8IB 5FUZL 3ZT6A 3QXAA 4G9DB 2CMRH 4XHJC 3S35H 3FB6B 3CX5J 3A67L 1XT5A 2P5EE 5KVFL 4LASH 4OGXL 4F57H 4TOYL 4CKVX 3FFDB 4F80A 4PRPE 4HXBL 5EU6B 4YDVB 1LWRA 1X4ZA 2E7LC 3BE1H 1MRCH 4NM4H 4YO0A 1MCWW 3GRWH 1L4IA 3QT2A 3BZFB 5DFVC 3WDJA 3VWKB 1U8JA 1WZMA 2AXHA 4OB5H 4KHTH 1L0YA 4ZNCD 3H3KA 3CC5A 4OLVH 3SKOA 2XI9A 3BZEA 3B9EA 3VFNA 2YEZB 1YECH 4JM2F 3FQNB 3TNNB 4YDKH 4KMTL 2XKUA 3QO0B 4K23H 1AQKL 4FQXA 3ZDXF 2BNQD 2F5AL 4FP8L 4L8DB 4FN0A 5CZXD 1FVDB 5DJXA 5HYSA 3OKKA 5D1XB 3I02A 4XMPH 5IR1A 4S1RH 2FEEL 2H32A 1C08A 3W39B 2IBGA 4JFHE 1WF5A 2AXGA 2YUXA 3JUYA 2CH8A 1OQOA 1EXUB 2YWZA 1FN4A 2P48B 3NACH 4JQIH 2Z8SA 1EJOL 4M61B 3VE0B 4LEOB 4PGZA 1OD7A 1Q94A 5GJTL 1I7UA 1FJ1B 3S96A 5IB1B 4NUJB 1NBZA 3EYVA 2IQAA 3O3AA 3GMQA 3IF1B 2ZNXA 5TQ2L 5F88B 5I74C 3VFWB 2WBJC 3IU3A 2QL1A 1F4WL 7FABL 5LGKA 3QPQD 1U93A 3G5VB 2AERT 3NA4A 1ADQH 4F7TB 5IROC 2H26A 4J3WA 1ZHNA 2V5SA 2Y72A 1V3KA 3MPCA 5I75B 4L3CB 3FHQA 3RY4A 4F9LC 1OAQH 3VXNA 5BV7H 3ESUF 4NQEB 4XP1L 5TE7L 1JZ4A 3ZE2E 2BNRE 3MA7B 1F8TH 3KJ6H 3EDKA 1IL1B 1QFHA 1CXKA 1FYTB 1J8KA 1DE4B 1SY6A 4XWGL 1ZLWK 3HMXH 4R7NA 1S7RA 3FJTA 1T1XA 2WWMD 3BN3B 1X4YA 1F2XK 2WINB 1INDL 5KZCD 2MKWA 1RZKC 2H6PB 5FM5O 4X98A 3UJTL 2FD6H 2ATPA 4HUXB 1C1EH 4R4FL 3DTXA 4OM1H 5I1LA 3QUKB 3CK0H 4UOW1 1OAYL 3HRZB 3DOSA 4F15B 5C07E 1GJIA 3VFVB 2PYEE 4ZOEA 1KCVL 3C2AH 1EHXA 4KY1H 1S7VB 2GAZB 1J10A 1HXYA 1F4XL 3S36L 2Q86A 3LKRA 1DP0A 5T5FH 4OFKA 1MI5A 2WWKO 4RA0C 2DD8H 3NZ8A 1JYVA 2DM2A 4OD3H 5BRZE 1FAKT 2ICWA 4WTZG 1JMXA 3QDGE 3OKEB 4MAYA 4L5FH 5F3BB 2EDLA 3WFBH 1C8PA 2R29L 5EU6D 5EOCJ 1V05A 1CE1L 5EPMB 3MRIA 1IM9A 4DUWA 4JPIB 5C7XL 3AS2A 4AT6A 1EEYA 1HHGA 4M7JH 2HYMA 1RZ8A 5CSGA 2W38A 5CBEA 4JRXA 3F6IA 3DROB 3P0VL 3L95A 4ISVB 4WUUE 1MF2L 1B0RA 5L0QB 5IVOA 4LGPB 3SJVB 2D0FA 2Z4QB 1WWBX 4HWEL 3AAZA 1RK0B 4JY5H 3MV9E 4HBQA 4MB3A 5D1XD 4NRZA 3S4SB 3SE8L 2M2DA 3S8WA 1CK0L 3CFBA 1WICA 2OYPA 2ADFL 3CH1B 4UAOB 5KTEL 2W91A 1R5WB 4G9FE 3ISWA 3VDCA 4XVUC 1WTLA 3TV3H 5ILTL 4EJ1C 2YD6A 2XQBH 5KSAC 3H9SE 4W68A 1EHNA 4FQ1H 1HZHH 2DLFL 1T04A 1I1AD 1S7SB 5EUOE 4C57C 1F42A 1QO3A 5F6HJ 4PP2A 4MX7A 4EI5B 5DJAB 5DMGC 4PS4L 3KPSA 1ZA6A 3QEUA 4H1LB 3O3UN 2WUCL 1ZXQA 4HIHA 4XGZA 4LCCB 4ZPTA 3ZKMC 3P30H 1JGVL 1NCBH 1OSZA 1TVBB 2NY2B 3FRUA 3RDTC 1OD9A 2OK0H 3MV8B 5J06A 4RAUA 4U3HA 1GIGH 2GJ6A 2HFEB 4DGVL 3OB0H 2UUDH 4RAVA 3BKYL 3MJGX 1VGEH 4P57A 1CIUA 1SHMA 3QIWB 5C2BH 3CFKA 3MV7E 5FYLH 4EN3D 2CGRL 2W60B 5LJYH 8CGTA 1FQ9C 1PD6A 1MCJA 5JXEA 4N1HB 1INEH 3OXRB 5IKCA 1HHKA 1IGJA 1Z5LA 2M1KA 4L9DA 5HHQA 3BP7A 3IKCA 1BZ9A 4NT6A 2ZUYA 5I8EB 4HJ0D 3U4EB 1MH5A 1FAIH 4JDTH 1NL0L 4PJ8C 3IXTA 4PJ9B 3ZT5A 2AEIT 3NIDF 1BVLB 1AQDA 3QDJE 4U0RB 2F53E 1K6QH 3CFJA 3N9GH 4XCFH 4NC1E 1U8IB 5DRZA 5FYLD 3EO1A 5JA8B 3VFMA 4IIQA 4PY8J 2YRLA 4XNZC 2YSSB 3NCEB 4G6KH 3VGBA 2AABH 3HI1B 1UH3A 5TGBB 4RZCB 4X8JA 3PWNB 3O2DL 3QUMA 3SY0A 5IIEB 3KPRB 4XX1G 2YD5A 3CNKA 3ZHLA 4QNPE 4JQVA 4HIEB 3K81A 3L7FB 2A1WL 4ZFOA 2RFXA 4PGCB 3TJHD 4UDUA 2VN7A 4XBPA 4RMVA 2QBWA 1U42A 1B0GA 4KDTC 1YY9C 2E3VA 1CZ8H 1I9EA 1FHGA 3PJSB 1ED3A 4FQQB 3EYSH 3UTQA 4RFEA 4G8EA 4XAWH 2KH2B 3EOTH 3D39B 4ZOBA 3SDCB 2FL5B 3A6BL 3S3JA 4X4YB 2V6HA 3WIFA 2A2QT 3MLRL 1XCTA 5EB9A 4RDQF 1JNLH 4UT6L 2NY4C 4JKMA 4KKAC 4CADA 1AGCA 3H3PL 4PJBA 1EO8L 5HPMA 5GS0L 3E2HB 4O2EB 1CDIA 1NCAH 3BQUA 5CJ5A 3MXVH 1K4CA 1ZVSB 4AEHL 1UWGH 4R0LB 5F1KC 1YJDH 4ZSOB 4P3DB 3IFOB 4H1LH 4NZTL 3T3MF 2ESVE 3KJ4B 4MXQC 1CDGA 1A3LH 3MREA 4Y16B 4Y5YA 2O5ZH 2BOBA 4G6FB 5IBUG 4XI5D 4WDIA 5DD0H 3RWGA 2VL5B 2X6MA 4GS7C 3TO4C 1RIVH 1UM6L 5L8LB 3HI6H 1DSFH 1U6AL 4H20H 1T0NA 2P49B 3SDDA 4YE4H 1BJ8A 3SDAD 4YXLL 2Y1VA 1HSAB 2WV3A 1ZLSL 4BKLB 3NPSB 4U1LB 2HTLC 5E6IB 1T4KA 3BXNA 3V4VH 2X4TB 2XA8L 1NMAH 2R69L 2DWEA 2Q7YA 2NY2D 3HZMA 1UXWA 1RK1B 3T0ED 3MV8D 3V0AC 4F33B 5CCKL 3C5SA 4ODHL 1HKLL 3EKCA 4RBPK 4K07A 4U1MA 2PETA 2X70B 2EICA 3FFCE 3PP3H 5C0CB 5FO9A 1MFDH 3QIWD 5GGTA 2ZOKB 2YN5A 3U0PB 3REVA 5EFIB 4RGOH 4KJYB 5C0AE 3TVMD 3O6ML 1C16A 4HX1A 4G42B 4K7FB 5J1AB 1CDHA 3AY4C 3DXAE 4NJ9H 3GFUA 5K9QG 4X9FA 5EOCH 1TITA 4YHPA 5HPOA 3MOBL 3RWDA 4PJ9D 3BWAB 5IHLB 5D5MB 4JGUA 1Q8MA 5EOTA 1DBMH 2A6JA 3TA3C 4ZPVB 1H8OA 4BH7B 3SDXE 1HYSD 1MJ7L 1DQML 1SM3H 3I6LD 3TZVB 3FB5A 2J12B 4YLQT 5GGQH 1QSFA 5C09B 4XWOD 1IEBB 2FGZA 3O8XA 4IHOA 1DANT 1FRGL 1OTSC 1XGTB 4IOSD 5INDA 3ZDZE 1VERA 3KPRD 1C12B 2EC9U 3LPGA 3MACH 2PW1B 4R90H 3VD4A 4OI7A 4FZEL 4WU5A 5TF1H 1U3HC 1MCFA 3O2WL 1U8OA 3WFEL 1QRND 1I75A 4N0FB 5ID1B 5L2KE 1KJVB 3AGVA 4AQ1B 3P4OB 4JG1L 3D39D 3SDCD 1GZPA 5DDHB 3WNOA 3WN5A 1PW3A 3H7BB 4WU7A 2BHYA 2VDOL 4MWFB 4HXAL 1B2WH 4OZ4B 1X6LA 3B9KC 1SYSB 4LPUA 4ETYA 1LE9A 4KTDH 4WHTA 4EVNA 1EH9A 3MSPA 4YDLB 1MCEA 1PEZA 4YXHH 5EA0L 1YUHA 4X80H 4JHAH 5FAAA 5JHDE 2D7NA 3MCKB 4XC1L 5IM7B 2BVQB 1BLNB 3DIFB 1KCUL 5KSVA 2LE9A 4N1CA 3KYOB 1A0QL 1UB6B 4EBQH 2KQMA 1LD9B 3WLBA 4U3XA 3BW9B 3DGGA 2X89D 3ULUL 3HPLA 1AD0B 4R26L 1MQ8A 1JGLL 5HDLA 3MLYL 1F58L 3AC0A 1UADC 4PV9A 25C8L 3HI5H 1BIIA 2NY3B 4F58L 1QP1A 4CW1A 3IRZA 4M43L 4OIIH 3P4MA 5E6ID 4ZTPH 4HGWA 3FOLA 3PHOA 4XBGB 1M7IA 4OZHF 1N0XL 4K71C 3QEQA 2X44D 3O4OC 4XPBH 3UTPE 2H8PB 4PJ7E 1JWMA 1WZ1L 1K5NB 1T03L 5EO9B 4QRQB 5IBTH 5E0QA 3CU1A 3H7LA 1JHTB 2IBZX 4NUGH 2Q20A 4ODSL 3RX7A 3RAJH 1RZ7L 1YN7B 5E2WL 4RX4D 5C0CD 1QFWH 1OP3K 3NPZB 3N1QC 3RGVA 3P73A 5GSRB 4JM2B 2OTWB 4F37K 2X9YA 3OR7B 5T1MA 1GCFA 5GRUL 4IDJH 3OKMA 5BS0D 1TVHA 3MGTB 4QXTB 4JCLA 1UZ8A 1GOFA 3MRFB 3ARPA 1KTDB 1XF2A 5EUKA 3E3QC 4QWWD 3BRGC 3RY6A 2VDPH 1R0AH 1ND0B 1N4XH 1JPGA 3EJZD 5DC9B 5C0BE 2Y07L 4MJ5A 2FEDD 32C2B 5BO1H 1DFBL 3KWWB 2A73A 2QKIB 3TZVD 4MD0B 1KEGH 3MLZL 4CNIA 1SY6L 3KPOA 3WFDH 4KDWA 5I1DA 3AMKA 5TPWH 1AE6L 4D0DB 4HPYL 4ZNEE 1NLBL 3QZWA 4O2FA 1MWAA 5CZXC 4KZDH 1A6AB 3STBA 3AB0B 1KPUB 1N3NA 3L3IA 1CFQA 1M05B 4NOBA 2EIZA 5HXMA 2X9WA 1N6VA 3V6OA 1O7VA 3PP4L 4YFLF 1TPXB 4GAYA 4PGEB 1YN6A 4D9QD 5FIEA 1CFVH 1AHWA 1TMCB 1HN1A 1QFUH 3T09A 1HNGA 3MFFB 1BAFH 1ZAGA 2EDQA 1IGCH 3WUWA 2BC4B 1PKQA 4M6OH 5JHLL 2ZCKH 3EYOA 1BREA 4K3HA 3PABB 4Z77A 3RNKB 2AAVA 4Y2DA 2X41A 4NFBA 5LXGH 4X6DA 2C3GA 3AU1B 4Q6IA 1GGUA 4MZ3A 3ULUE 3D2UB 1I1RA 3BP6A 1HOCA 1YMHB 5DJDA 4H8WC 4IS6A 3NN8A 2D7TL 3QPQC 1G7LA 4ZAKB 4G59A 1YNLH 3JBG7 3I9GL 4PRBB 2IBBA 1A47A 5DEZA 1RURH 3RWCA 1IRAY 1I3RB 1GPOH 5F6IB 4J23A 1DQJA 1QKZL 3RRQA 1OGAA 4HBCL 1I9RL 3NCYS 4UIMA 3V5HA 3MBEA 4JANB 1KF9B 3D3VB 4ODXA 2QSQA 2VDRH 5T1KB 1NDGA 1RUAH 4P5TB 1NQBA 4PPTA 4LCYB 4Y4FD 4PRHE 1BM3L 3VGHA 1M6OB 3BKJL 4LBEA 2WWMC 5HYJD 2NY3D 2CLZB 3D48R 5KBNC 1JK8A 4NHUA 1IKNC 3S37X 2YD4A 2AJZB 4FFYL 4RISH 1X5IA 35C8H 4RQQB 3U9UA 4HZLB 2I26N 4CU8A 2YZ1A 2MCPH 3BPNC 4OCNC 4KRLB 1DUZB 4AK1A 5JNYB 1FGVL 4XPFH 4PGBA 3STLB 2XIDA 2OZ4H 5HHOA 2N1KA 5I71B 4Y8DC 2XWBA 4LF3B 1D5BB 3MJ7A 2DRUA 3GMRA 4U33A 4JM2D 1FFNA 5B38B 3O41B 2VDNL 2FJGA 1IEAB 4KKCC 3V0VA 3PIQB 3O3DA 4WO4D 4LGSB 5C0FB 3CFDA 4LHQB 3ARGB 2O5YL 4JFEE 4JR9L 5I76B 1QLEH 3F5WA 3GSWA 1OM3L 1JZ8A 4FABH 3NFPB 3WHE0 3SE3A 4JFXA 1BQLL 3MJ8A 4ZDHA 3G04B 3I6GA 3SKJH 3H9HB 2CK0L 4OUUA 2JELL 3DVNA 5DJ0B 4HEME 4IRSC 4DN3H 3BAEH 2Q87A 4U1SA 2W9DL 3GNML 3OR6A 1WBXB 1YEHL 3MRCA 4OCYH 4DOHE 1BQHB 3T0WA 43C9B 2FATH 3VFPB 2X4OA 1LEIA 5TDOA 3RGHA 1OQXA 4OF7A 2NZ9D 3KPMA 4HG4K 1CGWA 2FH6A 4N90E 2WW8A 3SKMB 3FAWA 4Z7OF 1OCWH 4WY7L 1MI5E 3BH9A 2WQ8A 3QIBA 3EOBB 5LCVL 5C3LD 1EGJA 1A3RH 5D1XC 2IADB 4F7CB 2IAMB 1UM5H 1KLUA 4RFOH 2G60H 3VH8A 3VGAB 3ARWA 3PF2A 2A9NH 4IMKC 5JORB 1WCBB 4OV6F 4JRXE 5GGRY 2P5EB 4KXZI 3R1GH 4K2UL 1FNEA 3MRHB 4P2RA 5ICXA 3IAPA 3F12B 3D2UD 4HSQA 3TYGH 5FGRA 3W0WB 4MVBA 1IC5H 1NUDA 4PRPB 1I1AC 3LKOA 4Z7WF 5GGRB 4HFUH 3QUML 3GIVB 1UWXK 5I19L 1GC1H 5CINH 1FBIL 3MCLH 4PJ7F 5I1CH 2HKFL 4ZAKD 1KBGL 3OKNA 1JNNH 5IBLD 4IRZL 5BVPH 5KANG 4Y1AA 4Y2OA 4NNPH 1XGQB 2VITB 4GG6B 5GS1A 3GEWB 4O00A 5IMLB 4YXKL 2UVFA 3NFNA 1U58A 2X4NA 4Y5VA 4LU5L 1KPVB 4N8VA 2J7LA 1JGDB 5MI0B 1M71A 4NZUH 3D3VD 3WE6B 1KTLB 2AEQH 2VXVL 5T1KD 2UWEE 4P5TD 4DGIL 5JPMB 4HLZH 4EN3C 3BIAX 3P4LA 4Y5XB 5FK9B 5C1MB 3BN9D 4PD4J 5LAXB 4X6CB 1IGFL 3BISA 1Z6JT 5F9JA 2UY6A 1SYVA 2EC8A 1XZ0A 2PXYB 1I3GH 3KPSE 4FQHB 2VLJB 4R2GB 4HJ0C 5JR1H 5ITFB 2DICA 4Y4HA 1FP5A 3C6LA 4WW1A 5C0EA 5E1AA 1UG9A 1XGRA 1ZHLA 4LKXA 1F3DJ 2GJ6E 3QDAA 4F15C 1J0ZA 3HE7D 1KT2B 5JXAL 5D1QB 4LLWA 4I18C 4ZYKB 3DNKA 4UU9B 3CUPB 1MCPL 5IG7B 1A1NB 1JHKL 3QSKB 3ERYA 3WD5L 3RDTA 4APQA 1WBZB 2OR7A 5MERA 4ELMA 4TVPL 3MLVL 5JLZB 4RWYH 1NANI 4S1SL 3ARGD 5SX5K 4P2QA 4LVHB 3IDNB 1PAMA 4FTVA 5ALCH 2B5IB 4ODVH 4Z78B 3MJ9H 3O6FA 1H15A 4RAHA 5DJYB 3TJHC 5JQ6L 2F5BH 1TXKA 1X5AA 1U8MB 2RQ8A 3ULUF 1MAJA 1T89C 5FO8A 5E8DL 5B21A 5JW4N 2J88H 4K3JL 3UZVB 1P7KA 1UGNA 5FXCH 4PJ8A 4QTHA 5GGTL 3TFKC 1N7ML 2VC2L 4U1HB 5EBMB 2R4SL 4N0UB 3BD5A 3TBVA 1MRDH 1S7TB 3PQYA 2OS7A 1R5VA 3QI9D 1QUNA 1G9ML 4JG0L 4ZOCA 5A40E 2QQQA 3B3IB 5A1AA 4NBXB 5M94B 1RUPL 4UAOC 2F58H 4NQVB 4P9HC 3T0AA 1AR1C 2A38A 4WCYL 4WNQA 3VXMB 5BQ7A 3WS6C 1HHJB 3AM8C 4U0QB 4GKOA 2AV7B 2P5ED 2DJSA 3R8BB 2WSKA 4P46B 3WFCL 1KLGB 4JN1L 4PRPD 2BERA 2DM3A 1YZZA 2VDKH 1OAUL 1UZ6E 3SDAC 1L6ZA 4LRNH 1MJ8H 4PJBE 4UZGA 1AGDB 1NCNA 4MQ7B 3VFRA 3W5NA 4LCCC 1G7HA 3ROOA 4A6YA 5F9WC 1T1YA 1MLBA 2JJSC 3T0EC 2NY2C 2ZPKL 5INCB 4WFEE 4TSAL 1CE6B 2EDHA 2GITA 4HMEA 1GL4B 4OCSL 4YX2H 3SO3B 2YOCA 4O4YL 4NN6B 5E8PA 3JV4A 5EZJA 4NKOB 1XCQA 5J6GA 3NVQA 4S0UC 4KUCD 4PRDB 3EAKA 3QR2A 3QWRD 2IALB 4ZUUA 4HKXB 4HC1H 5DEGA 4TVPE 4LEXL 1IAMA 5FF6A 3BJ91 4LSUH 3ZE1F 3TVMC 4JQXC 5D7KE 2PXYD 4G9FB 1AP2A 1FCGA 2GY7B 2VLJD 4R2GD 2E7BA 4TNWK 3P77A 5DJ8A 1CGSH 3UDWA 4XPAL 4XXDA 4RMTA 4XXCA 4RGMC 5JW5A 2G5BB 2H9GA 4KKBD 5GRJH 3VWJA 1F4YL 1T0PB 4U0RC 1I9IH 4H26B 5D1QD 5DK0A 1HYSC 2ZSVB 2KPNA 3BKML 4I77L 3L9RA 2H41A 1RQ5A 4LAQH 1UH2A 1G7MA 4NYLB 1L7IH 2NW2A 4AQOA 4Y4KA 2Z92A 5KVFH 4RDQG 3GJFK 3WLWD 3P4NB 2WNGA 4TOYH 1P4IL 4HXBH 3LH2H 1ZV5A 3T08A 1TQCB 1E28A 1MUJB 2BNRD 2WLYA 4U6HA 2BY0A 3VRLE 2W1NA 2VLRB 3O6KL 2D4DA 1YY8A 2JIXB 3TN0B 4PLNC 2VSCA 4Z5RB 1BWMA 2WUBH 4NPYB 1G0YR 1A6TB 3VFGL 5CIPB 5IVZB 4UV4L 4C58B 5ACZB 3PNWA 2GYSA 3D5OF 4HEPG 1HQ4B 3LHPL 2Z9TA 1I8KA 4U7KA 2NY5H 1KIRA 2OL3B 3EYFA 1AQKH 2F5AH 3STZA 43CAA 3QDJB 2DQJL 3V2AR 3BDBA 2F53B 4GW1B 4QRTB 2CXGA 2IMNA 4OZHB 5J0BA 1SBBA 4R0LC 5DC4B 4IRJA 4UNTA 1A9BA 2HRPH 4GQPH 4JAMB 3VXMD 5D72H 3WL9A 2GFBB 1H5BB 4MSWB 4UUJB 1ZGLA 3UAJD 3FZUD 5I1EH 3O45B 5BRZD 4AY0A 4P46D 1UENA 3EHBD 3L3KA 1EDQA 1JPTH 2LU7A 1XGUA 3QFJA 1H8NA 2OQJB 5DRWA 1RHHA 2EH8L 2H1PH 5FYKH 5DVLA 4O9HL 1JVKA 1MWAL 1S7QB 4JREC 4MNGA 1ODAA 4MYWB 3NPSC 1JWSB 4LPTA 1U92B 3TH2T 4JHWL 5E6IC 3V79C 4HT1H 2LV4A 2AK1H 4XVTL 1EAPA 4WUUD 1CTOA 5DGRA 4NQSA 3IDYC 5BZDA 5J12C 1OARH 4LHUB 5D7IA 3K46A 3HA0A 4Z7UA 2X1PA 2V2TA 5FHAH 3NTCH 2VISB 3ARYA 5FGBC 5DHVB 5FYKD 3IXAB 5E6YA 4YHZH 3DRQA 1AC6A 5CJQL 4XWGH 5CEYB 1MEXH 5BMFH 1AJ7H 1CICD 2YPVL 3D0VB 3QQ9D 1LO3H 2FR4B 2CLVB 3NABH 5FEBA 3NA9L 3DX7B 4QWWC 2FECL 3Q5YA 3C09B 4G9FD 2YA0A 4GKNA 2FB4L 1RAMA 1BP3B 3H9SD 3RKPA 3EJZC 3L3JB 3GSXA 1OAYH 3QEQE 3HNVH 4GMSH 3RVVD 4K9EH 3IJHA 1GGCL 1AFVL 2FEDC 4WI2A 4EDWL 1QPPA 4XNUL 3SCMA 3BZ4B 3D85B 4I0PA 3KLSA 4NWUH 3K4AA 4OD2B 4PJXE 3TZVC 1UT9A 3P9LA 4KI5E 1S5HB 5FKAB 5JO5B 1OF2A 4NJAL 4K8RL 5CIPH 2C9AA 3ARBC 4H25A 4CMMA 4PGJA 4MXVE 5JMOC 2Y4SA 2A74B 2EE3A 4KJQD 4X7CC 4YC2B 1N2RB 1YNKH 5HGDA 5F7UA 1VENA 2OL3H 5A43C 5ESVB 1NLDL 2P24A 1ES0A 4V1DA 5D96B 5D2NC 3ZKQD 1CE1H 5DLMH 3PDGA 1YA5A 3FFCB 3MGOA 3KYMB 2GSGA 2VLRD 3TN0D 3TT1L 4F7EA 5CP3H 1KN2L 5CMAA 3EDDA 4OLUL 1OB1B 3QULB 4WWKA 3ECBA 1OTUC 4X99B 5K9QI 1TZGL 4BZ2L 4PJBF 3ZTNH 4M02A 4K3DL 2VWEE 2FYYA 3D9AL 1EFQA 5HHMA 5LG1A 3TPUB 2VKXA 4LDLB 1U8PB 3QDJD 4KHXH 4WV1A 2VLKE 3SE8H 2F53D 5SX4H 2HTKD 1A6WH 2R0WH 4ZO6A 5JDJA 4FXKB 1RZJL 1WISA 1QFPA 4ZUTB 3V6OE 1MIML 3BIKB 3HNSH 4GXVL 2UZIL 1MELA 1FFOA 3S97C 4BSWA 4HIXL 1LK2B 4KVCL 1LILA 3MYJA 1PKQE 4JGJA 5ILTH 1YYLH 3HC3H 4MS8D 4BH8A 3CMOL 5C9JA 1BBDL 3A6OA 2EDDA 2BVYA 4X6DE 4HUMB 3EYQD 4Y4FC 5AG9A 3L3DA 3NZHL 1EUUA 4TUOA 5IESL 5E4EB 5DHVH 2NY3C 4FQCL 5DWUH 4LCIL 1EGJL 3ME0A 4LFHD 4P2YA 3U9PH 3HCVB 2AVGA 1I9JL 5SWQA 5L2KB 2E7HA 5D70H 4LFHG 5TE4L 4YNYA 1XR8A 5AYUL 4I13B 5EU4A 1JP5A 1OGAE 4E5XA 5HGGS 3ZDYE 4LQFL 5AZEL 1GGYA 4YBHA 3M17A 3BGAA 5E56A 1UA6H 1RIHL 2EYSB 4XAKE 1U8HA 1PG7W 3PV6B 4N1EA 1JPSH 3PGCA 3ARTA 5JHDB 2P7TA 4NO2B 4N0CD 1J0IA 5LGJA 1A7RL 1J5OH 4WO4C 1I7TB 2ESVD 1NCDH 1NFIB 4JZOB 3RKDD 3WJLA 1M7DB 4NHUE 4KQ3H 3DI3B 3O9WA 1QFOA 5KVEL 5EIIB 1AD9B 2EYRA 3DX9A 4PTTA 4G80B 2AJYH 1I1YB 2PN5A 4TTDD 1IC4L 1MFAH 4G7VL 5IW6B 2YPLB 1AGBB 2XZAH 1C5DB 3FT2A 1KN4H 3EFFB 4OAWA 2EE6A 5FYJH 2CRZA 1AO7A 2HN7B 3HB3C 5DUBA 4HS3B 1OOAA 2I24N 5HHOE 1IKFH 2BK8A 3OKLB 1N5YL 4ODWB 2NZ9C 3RL2A 4FHBD 4Z7WB 4DFIA 4XPTL 2GJZA 4MDJB 1CF8H 3QEHB 1JI1A 2Y5TA 4H0HB 2OTUB 3W9EA 1RJYA 1T21B 1T1WB 3ZYZA 3V4PL 1IGIL 3VW3H 3AB0C 4HZAA 4KPHH 1TZIB 4WTZA 4M7LH 5FYJD 3FFCD 3GJEA 4EUPG 1AH1A 4GKSA 3HC0B 1VSCA 3U0TB 3JWOC 4QXUH 1HWGB 2IH1A 5IK3B 4LCWA 4UQ3A 1ZT4A 3RA7H 2Z35B 1GOHA 1MCQA 1NGZA 1F02I 3RU8H 3MLRH 4BZYA 3GSVA 3MUGB 4UT6H 5K9JH 4IEFB 4IRSA 4M6ML 4OFDA 3N85H 2HVJA 3MMEB 4EI6A 1WBYB 4I0CC 4EKXA 3G5ZB 1JYXA 3VFUA 1XIWA 4X8XA 5JIPA 4ZAKC 3C08H 2J6EA 3VXOB 4ODTH 5IBLC 3REWA 3B9AA 2EYTB 3IDMB 2YD3A 2YS4A 3MRGA 5CBAB 3MOAH 2BSRA 3BT2H 3ZSSA 2IFFL 2XNAB 2NW3B 3O6LH 3H2WA 5F6IC 5KS9A 1X5KA 3GKWL 4IMLA 5FOBB 3S5LB 1ZS8B 3AXLA 1QBBA 3QXAB 5GHWH 5CD5D 4J3TA 4QHLA 4C83A 2FZ3B 2HJLA 3FN9A 5GS0D 2WM0A 4LLQB 4P2RE 3HFMH 4NZRL 2AJVH 3BN9C 1PQZA 2BFVL 3M45A 4FZ8L 4OGYH 2A77H 5I1AA 1MCOL 1DLFH 4CU7A 5L2KD 3JWDC 1U8JB 2LU3A 1IZJA 1FLTX 5I0DA 1F90H 4Y1AE 4ZO8A 5AG8A 5E5MB 3QJFB 1A1MB 3ZSTA 2QSCL 4WW2C 4UT7L 3SKOB 4JDZA 3BZEB 4M62H 3VFNB 3SEPA 3FQUB 3HE7C 5EBWA 2OX5A 1YMMA 4MXVF 2DQDL 2FX9L 3T0DA 4WI4A 4FQXB 5DD6A 1KOAA 4PUBH 5F7HA 4G5ZL 3DMMA 4WFFE 5JHDD 3TBYA 4PLKC 4YPGA 4MMZC 2WIIB 5IR1B 4K7PY 3PWUA 1PG7X 3ARGC 5F7EH 2H32B 1C08B 4U1GB 4CVWA 4KQ4H 4LVEA 1FC1A 3OGCB 4N8CH 4B53A 4J4PA 4QCIA 3ARDC 4ZXBA 2AXGB 3MXWH 5GRVK 1U2CA 4A6YL 1WFTA 1DQLH 1A6UH 1FN4B 3T3PE 3TT3L 1PDKA 5C0GB 1J0JA 5K59E 1WGOA 2P43B 2Q76A 5C0RH 5IMOB 2YPLD 1A6PA 1I7UB 2A6IA 2GT9A 5SWZB 5E9DA 3O3AB 1IT9L 5J11B 1IFHH 3GMQB 4MJ6A 1R24A 1DZBA 3GMOA 4ERSL 3IU3B 4Q9QL 2GEEA 4ELME 3QUZC 3QDMB 4NKQB 2R1WA 4XZUA 2H26B 4I18A 4P2QE 1FVEA 4GH7B 4KKLD 4FTVE 3QI9C 1WT5A 4E0RB 3CFEB 3VXNB 4X5WA 1FFQA 2BVOA 2WANA 1OAXL 5LBSL 4X4ZA 5EZLA 4X6DF 4OF5A 1DR9A 1KJ3L 4R7NB 1FYHB 2QEJA 1S7RB 1T1XB 2NZIA 2VUYA 1QQDB 1FZKA 1LEGA 3CZFA 3DSNA 4FG6D 1NDMB 4JZJA 4P49A 4G6AD 4JFPA 4X98B 1FZJA 2HFFA 4L4JA 3D25A 2ATPB 5CJXA 1KXVC 4WENB 3PQYE 4LMQE 5C0BD 2YKLL 1C5BH 1KG0B 3V6FA 2UZXB 3ZDYF 1DTUA 3GB7A 1GGIL 4RIRA 1Q1JH 1N26A 2G2RA 2MHAA 3FO1A 4FQIL 1KFAL 4PJEF 2X1XR 3TNMB 1MPAL 1HXYB 1C7SA 1BD2A 3LKRB 5IFAL 2E27H 2DQUH 2VSDA 1NAKH 3RPIA 1OGTA 5CEXA 3WHXB 2PW2A 4D3CL 5IFJA 3IDXH 2AJUL 2ZNWA 1II4E 9CGTA 2ICWB 5EO1A 4DVRH 4Y5XC 1A2YB 3KPLA 3AM8A 2XRAL 2K1MA 1BVZA 1F6LL 3MRIB 1CXFA 4DCQA 1IM9B 4M43H 4U6YB 2PXYC 4AT6B 3LS5L 1EEYB 2Z8VC 3SKNA 4R2GC 2H32H 1RZ8B 4OCMC 4BK5A 4LVNC 4J6RH 4PJIA 1D6VL 5K33A 5EWIH 1UB5A 3L95B 4K7PH 3RI5K 3ULUD 2IANA 4WGWB 4HH9B 1B0RB 3MUZ1 5D1QC 3RTQC 3T4AA 1ZWIA 4L8BB 5HHNA 5KANI 4FQXD 3AAZB 2JJSA 5L6YH 3FMGH 4HS6A 4NQTA 3E0GA 4NRZB 1ZT1A 4M1DL 4PTUA 4OLYH 3QO1A 1AGFA 4PJ5E 1T2QL 1FL3A 1JF1A 4AM0B 5HYSG 5ECJE 1EJ6A 5CJBA 5KJRH 3WLWC 3SGDH 5ADOL 1JYNA 1D5MA 4PJHA 5MEOA 2NQCA 4BZ1L 2C7UA 1DDHA 4JQXA 3BESR 1YQVL 3WXVH 1UJ3A 1T04B 1T20A 3WSQL 2KKQA 1U0QA 5HVHC 1QO3B 3NFSL 4POZD 5F7FA 3MROA 4MX7B 12E8H 3KPSB 3QEUB 2GK0A 3EO9H 4HIHB 4XGZB 4ZPTB 5HD8D 4JPKL 4PG2C 1ERNA 1OAKL 1KIQB 1FC2D 4NNYA 4M48L 4CDHA 5KAQF 3FRUB 4P4KA 3S6CA 1CXHA 2GJ6B 5BJTA 2J4WL 3BOVA 4KVNL 1T7YA 1U8KB 2CUMA 4KKNA 4FNLL 1E4KA 4Z0XB 4LGRB 3UC0L 4NQDE 2YD8A 1VFAA 5KG9A 1HKFA 1ZANL 5KVDH 3EDEA 5CD3A 1AXSA 4LLVA 1IGJB 4RSVA 4ZUWA 2GTZB 3BP7B 4EOWL 1F00I 3IKCB 5HHQB 4FXGA 4F7MA 4P46C 4NT6B 4V2BA 3EHBC 4PJGA 4M5YH 5C08A 3DV4A 4DJMA 4F9PC 3UTSA 5EZOL 5I73C 4MJ2A 3CSYA 3LS4L 3IXTB 1LVEA 4LCUA 4RGNE 4ZTOH 3MRDA 2XKNA 1AQDB 2DOCA 1FNAA 4M5ZH 4XHQA 3UO1L 1VKXA 3RPKA 1G7PB 3VFMB 1QKZH 3DURB 1BZ7B 4PY7A 5IHUH 2I9LA 4MNQA 1ZHKA 4XP6L 2QHRH 3T77A 2IBZY 3SO3C 5T1DH 1MI5D 2WAHA 3QUMB 4P5KA 3SY0B 3TIDB 2BDNL 1DUYB 1E6JL 4D9LH 4MAYD 2BY2A 4I3SL 4X6BA 2C4XA 5DJZB 1BGXH 1CICC 2FRGP 2V9RA 3QQ9C 4PBWD 3VXSB 1N6QH 2IH3A 4ZFOB 1BECA 3QFJE 2RFXB 3PE9A 4UDUB 5K59F 4XBPB 1IM9D 1B0GB 4GAJL 1IAIH 4MNGE 4X9HA 4MJ4A 3AREB 1ED3B 1L8JA 1AI1H 3LRSA 5D6DC 4G8EB 3O3BA 5FO7A 4JRXD 3OJDA 1DBAH 5IMKA 4OFYA 5IGXH 3RVVC 4HGKC 4OLWH 2A6DA 3WIFB 5D7IE 2HAZA 5F7KC 4Z7UE 1XCTB 5T5NF 4HFWA 3VU2A 1NGYA 4NIKB 4PJBB 4NNXA 3ULSB 4C4KT 3GJFA 4ETQB 1KPRA 1A14L 1K4CB 1LP9A 2AP2A 3GMPA 1IM3A 1HHIA 1SJHB 2O5YH 1OM3H 4KJQC 1LO0H 1R3KB 3QCTH 5JW3L 3IAGC 4Y5YB 4TSCL 3Q48A 2BOBB 2E6JA 1M1SA 1TQCC 4XCEB 2B39A 4GT7A 1N6UA 2HWZL 4CVXB 3OZ9H 2V2WA 2F54B 1IAIM 4NHCH 2G9HB 3TN0C 3SQOL 5F1OB 1LQSR 1NC4A 2YD1A 2DI8A 1T0NB 5E6ZA 3SDDB 4JO2L 4HD9A 2FIKA 2D7QA 2VOTA 3LIZH 1J0KA 3KPSD 3RWJA 5FV2A 3L3GB 4HHAA 4V3DB 3F62A 1QLRB 3QJHA 1T4KB 5IHZB 2DWEB 2Q7YB 3HZMB 5LCVH 5ID0A 2YRPA 4GAGH 2GJ6D 1N64L 5DZLA 4CAGA 3GIZL 1S7XA 4V1DE 1UKQA 3INUH 4NC1C 3ARBA 2BZDA 3LKSA 2B1HL 4U1MB 5B39A 1YEEL 3BSZL 1ORQA 2JK5A 5FO9B 3AS3A 1H5BC 3REVB 4LSQL 5JXED 2X40A 3B5TA 3O0RH 5GGUA 5GXBB 3SE9L 3WNMA 5H35A 4JVPA 3M1BA 3VMPA 4XPHH 1KJMB 4LHJB 4Q0XL 5LVEA 3EYQC 3MRRB 3X11A 2QTEA 5DRXB 1XEDA 1CL7H 1E0OB 1MAMH 3GHBL 5HHME 3QISA 3RWDB 5JOPD 1WFUA 4ZG1A 5IF0A 4GMTL 1BVKA 1D9KA 4HUVA 1RUKH 4YXKH 2NNAA 3GK8H 2NY1B 3WYRA 2RJMA 4MA1C 2FBJL 2X4PA 4PDCE 1FIEA 2N4IA 3WJJC 5MENA 4MD4A 3MRQA 2UUDK 1QSFB 4DVBA 2MJWA 1MIEL 4X6FB 1RUML 3DUSB 2VXVH 4QY8B 4DGIH 3H42H 5K9KA 5ICZA 2ZP0T 2Z31C 4N0CC 2CDGA 3CDGA 1WLHA 1BJ1J 3K7UA 4UTBH 5DFTA 3RKDC 4WU5B 3T04D 2ATKA 3CMGA 5E94A 1B4JH 3C2SA 4OBSA 3C09C 3GSNA 1S9KC 3U46B 1MFEL 4D0BA 1FDLL 4TTDC 4FA8A 2ZCLL 3WN5B 5DT1H 4WU7B 5ITBL 1KLFA 4JKLA 1CD1A 4I3GA 1DQDL 3CVHL 1LE9B 2Y36H 3JXAA 3DVGB 3I50L 4Y19A 2ARJA 3BQUD 1YUHB 1OSPL 4U1KA 4ALAH 4S1SH 4OQ1A 4Q58C 4NKDA 2V2XA 5FUCE 2DWDB 3QUYA 5KSVB 4X7SH 5IEKA 4WFED 4M7LT 3MLWL 1MVUA 3JTTA 3R06A 4OM0H 3WLBB 5D96C 1FG2B 3DGGB 2OCFD 3QCVH 1AIFB 1G84A 1PEWA 4JFOA 3LEYL 5E95B 4U6VL 2DBLL 2EIBA 3SDYL 1KXTB 5LWYL 4OZGA 3IKKA 2VMFA 5DD5H 5DK2A 2AKRA 4U1JA 3WFZA 1ONQB 5GJSH 5L88H 4UT9L 1AO7E 3SDDD 1OHQA 3VXUA 5D7KD 1N7MH 5E8NA 4CW1B 4PG9B 2X1OA 4HAFA 1G7IA 4QRUA 3MOQA 3P4MB 4MQSB 4YAQA 1N8ZB 4HGWB 5DUML 3PHOB 1M7IB 1WK0A 2EXWD 1Q9OB 3OSKA 4LSTL 1P6FA 2BXZA 1JWMB 3IJSB 4JG0H 5I0ZA 4CDGC 3KYKL 5CSBA 2CD0A 2MPAH 4I4WA 3NH7L 2OI9B 3F7RA 4XH2A 2BRRL 1W2KT 4PRIB 1RUPH 2GJJA 3RBGA 1J1OL 2P8MA 4KTYA 2ZUQC 1PX4A 3RGVB 2PTTB 2VLME 5MP6L 1FL6B 4HJGB 1F5WA 4LNVA 4L4VA 3P11L 1TVHB 2YBRA 5C71A 1XF2B 5CD5C 5EUKB 4H88L 4LPCA 3MLXH 1LDPL 5D7LE 4LCWE 5CILH 3J8F7 5GS0C 4Q9RL 1X5YA 4FQJL 5HVFB 5D9SB 5E4EC 4Z7QE 3LMJL 2XN9A 3U0WH 1XR9A 2LFGA 2V17L 5FM8A 1DEDA 4KK8D 4AZ8A 3QCUH 2DQEL 3ULVL 4LPVA 1L7TH 4ONFL 1Q0YH 5D7IF 4DUXA 4RFNB 1FZMA 1FORH 2O5XH 2NY1D 2O93L 2Y23A 3VGEA 3DX8A 4AIZB 5KS9E 3VDBA 3QXTA 3X13A 4NWTH 4CNIB 4R8WH 1A7OH 3KPOB 4AL8L 5I17B 1QSFD 5AAMA 3DX6A 3WIHL 5I1DB 4NFCA 5ADPL 3O8XD 2X7LA 2NR6D 1RMFH 3RIAK 4QYOA 3QZWB 4AG4L 4MCYA 4MLSA 4O2FB 5A3ID 3BUYA 3KS0H 3D69A 1N3NB 3HZKA 1CFQB 1E4XH 2EIZB 1Z3GH 5DA4A 4U2ZA 3S37L 1IARB 1HXMA 3T2OA 1AHWB 1EEQA 1P9MA 4HIIA 2H3NB 3WUWB 3EYOB 1FNFA 4Y2DB 3PWJA 2CJUL 3VI4E 1MFBH 3CLEH 3ESVF 3RY5A 4X6DB 1OLZA 2APTA 3E8UL 3FCTA 1Z9OA 1BX2A 2C1PB 2E9IA 4QF1A 1HOCB 5SX4I 3EJJX 4IS6B 4HJJH 1FNLA 1YMME 4FQ2H 5I18L 1F11A 1FFPA 4FMFA 1Q9WB 1G7LB 2YK1H 4NGHL 4FXLA 1LMKA 2HFGH 1LO5A 3TBSB 1VDGA 1HH9A 4ZFFA 4PJFA 5I1GL 3ARFC 1DQJB 1CT8B 1P7QA 1OGAB 3IFLL 3RWEA 3C8KA 3MBEB 3DHJA 3NAAL 5J56B 3U7WL 4PJEB 2B4CL 4JCMA 3BP5B 1RVFL 4WEBH 2WY3A 1NDGB 1KJ2A 2FJHA 1QPXA 5I6XC 5HGHB 1ZVHA 3BI9X 3CAFA 2Q7NA 3UTZA 1H9VA 3FO9B 4LBEB 4XP4L 1NSNH 5F89A 1JK8B 1WAAA 1FVCA 3MBXH 5I8CA 2ID5A 2P5WB 3ARZA 1I85C 1K8IB 5DQJB 1KULA 3A6CL 4YFLI 3RHWK 1A7PH 3QEQD 5C0ND 5I74B 1K85A 2C5DC 2R56H 2R23A 1ZLUK 5IB2B 4OUOA 2VXQL 3FONB 1R3IL 1BEYH 4GBXA 3ULVE 1TCMA 3QUZA 4PGBB 4JFZH 2V5YA 5I2IB 2AK4A 3PWPB 4KI5D 4XX1E 3A0OA 2ED8A 3G6JA 2XWBB 3RGVD 3DRTB 3GMRB 4LKCA 1FFNB 4HKJB 2VQ1A 4DZ8A 1JNHB 3SGEH 4BFEA 3V0VB 2UZYB 5C6TL 5E08H 2FDBP 5E03A 3O3DB 3QUXA 1WWAX 5GGVL 2DM7A 3TGXA 1GHFH 1F4AA 3F5WB 2CKNA 3GSWB 1OT1A 1S9YB 3HAEA 1BJ1H 4DTGL 1J8HA 2VXTH 4AYFA 1YEIH 3S88L 5D7JA 4ZDHB 4Z0BL 3S7GA 3I6GB 5HY9B 4HPOL 15C8H 4OUUB 2Q8BH 1EBPA 1NEUA 5ESAB 4G6JH 3HMWL 1DL7L 1B90A 3DV6A 4U1SB 3PL6A 4F37F 2XPGA 4ZFGH 4X6EB 5A16A 3EJYC 3OR6B 3MRCB 4KRNA 1TCRA 2R1XB 4G3YH 2OR8A 2X4OB 3ULUC 1U95B 5TDOB 1PZ5A 3FTGA 2DQCH 3KPMB 2J8UB 1BD2E 1FIGH 2PO6A 1DBJH 4R96A 5IOPA 5EORL 2F8VA 5T33L 3BP4A 5C0IA 2Q8AH 3UP1A 4XCNB 3QIBB 2XTLA 2VAJA 1YPZF 1D5ZA 3FT3B 3KHOA 2IQ9H 2OP4H 3U82B 2ZJSH 1KLUB 4U1GC 4UMGA 3OL2A 2HRLA 3FN3A 3GM0A 2VRAA 1UEYA 5TF0A 2NXYD 4X4MA 1S3KH 3SOBL 2K3TA 4Y2DD 4P3WA 3MRJA 5ICXB 2IANE 5EOQH 4TN9A 2N7AA 4LSPL 3QG7H 5J11C 2R2BA 5KSUA 1T6WA 1EEZA 1TTUA 4POZC 4BSVA 2IGFL 1V8HA 4NC0B 3GO1L 1P4BL 3LQZA 4TYUA 2YWYA 3FO0L 3OKNB 5DRNA 1EMTL 3RZCA 4YHML 1TQBC 1G7QB 4A2MA 5HD8C 1RU9L 5F1SA 1F3JB 1FPTL 1F97A 2UV3A 3C60C 3UPRA 3NFNB 5L9DH 1OGAD 1U58B 2GCYA 4LL9A 4UTAL 4LLMB 3RFZC 5FUOL 3MBED 4LRIC 3TBTA 4N8VB 2EDKA 3QAZC 3PGDA 4PJHE 1M71B 4XAKD 2QR0A 1A4JA 4DW2H 2EO9A 3GMNA 1F2QA 4XNMA 5DS8A 2DS4A 3WS3A 4HQQL 4K8RD 1BQUA 5I15L 4Z7QF 3L1OL 3Q0HA 5F8RC 1REIA 1B6UA 4I2XB 3L7EA 4LIQH 5EZIH 5IB4A 5KSAB 1FGNL 1XZ0B 4FQLH 4O58H 2B20A 1YDPA 3ZTJH 4ODUA 1VFOA 1I7RA 2V5TA 4Q6YA 4Y4HB 4S1QL 5ICYA 4LP4A 3LN5A 1WEJH 3MZGB 1ZHLB 4JPVL 4OGAD 3F58L 4OZFB 4LKXB 4KROB 5E4IA 3O4LA 4D8PA 4UBDD 5KS9F 3QNYB 2RIKA 2XWTA 4LLWB 4BQ6A 1V7NL 1OY3B 1DJSA 5HHOD 4HK3N 1F45A 2UZIH 1RZKH 3RDTB 4QRRE 3CFCL 4PBVC 4JEGB 4WHYH 4PLJD 4UINH 1TJIL 2DQFB 2PYEA 3TF7A 4ZS7H 4P2QB 3GSRA 1FFRA 5HJ3B 5I1HH 1WUNT 4FTVB 1AXTH 2Z0BA 1O0VA 1QA9A 3D87B 3RUGA 3HNTL 5ANMB 2FO4A 2X4QA 4MAYC 4PJGE 4XB7A 1ZEAL 3X14B 2BSSA 2VAAB 5C08E 3UTSE 1O7SA 2XY1A 5IVNA 2YUWA 3ZYOA 2BP3A 4LAJH 1NJ9A 3HHRB 5CFHA 5DQDL 5TE4H 4F9PA 1QR1A 1P7KB 2EEBA 4TSBL 2ZOLA 4PJ8B 2Q6WA 3W9DB 2R39A 2RCSL 2KL6A 1PYWA 3U4AA 4LQFH 1YEJH 2IPKB 5GIRA 5E8OB 3UX9B 4HKZA 3TBVB 5AWNL 4M1CD 2OJZL 3PQYB 4CRPA 4AH2B 1R5VB 3QIBD 4WRLA 4XNZB 1KENH 4QRSA 3QXWA 3UTOA 5F44A 3TCXA 3QQ4B 3EUUA 3GRWA 2GK2A 4JJ5A 4Z7VA 3MV9A 3CCHB 3D18A 1EFXA 4WNQB 5BQ7B 5IV2B 5KAQG 1I7ZA 2Z8WC 3GUTA 1GGTA 3W2DL 2ADGA 3FQXA 3VH8G 3IETA 4P2RD 4GW4A 4MVBD 5IVXA 1I3UA 2AQ2A 3IU4H 1CFTA 2AXJA 1DANU 4G6MH 4D9RD 3VFRB 1U91A 2F74A 4Y1AD 1S5IL 3Q3GB 4IOIA 2IWGA 3ROOB 4CN4A 1A21A 4UB0H 2FNBA 1T1YB 2NY4B 4U7MA 1RZFH 2ADJB 3P0YL 3GSNL 3BDXA 2FJFB 2GITB 3GDBA 3NCJH 3VFTB 4DQOH 2Q3ZA 4OZFH 1HWHB 4CBPA 5E8PB 4YIQA 4W81A 5EZJB 5J6GB 1QSVA 4WFFD 3B2VH 2JB5L 3BRFA 1U8LB 3TPKA 3FRPA 4G7YH 2B1AH 3VXQB 4EDXA 4ZUUB 5JXEC 5DEGB 3MRBA 5JOFA 5FF6B 1FNSH 1T2JA 3H9YA 4KMQA 2CUHA 2LU4A 1HINL 4GS7B 4JFYA 3T4YA 3TESA 3Q5OA 1ADQA 1AP2B 2MQ0A 3MV7A 3M8OH 3P77B 4MHHG 5HGBB 4Y4HD 3C6LD 3QIUA 4PJAF 5D93C 4XXDB 5CWSA 1KIPA 3QXUA 1NMBL 2CKBA 2H9GB 4KROD 3VWJB 3ORJA 3WCYA 1MCBA 1IE5A 1PKOA 4FOMA 3RVWC 1E27A 4IM8A 2XOTA 2Y6SD 2ZKHL 5DK0B 4Z7NE 5IFHL 2QQNL 2NY0C 4XBEL 2IFFH 3E6FB 4IIQC 3VJ6A 3L9RB 3O2VH 1QYGH 3RDTD 4APQD 2R2CA 2ERJB 3MTRA 3AFLA 2VIRA 2NW2B 4QRPB 2WWKT 1G9NL 3NGBC 3SGDI 4P2QD 3LY6A 2Z92B 4FTVD 4EQ3A 1G9EA 3H3BC 3FB6A 1IBGH 3UJJH 4AJ0A 5LGHL 3O6FD 3TJEH 4YHKL 4HF5H 4NZRH 1VADA 5HVGB 2ZCHL 4PJIF 4OLZL 4YDVA 3P9MA 1X5HA 1N5AB 5BOPA 2C4FT 2VXSL 3VWKA 5KW9L 1CXEA 1DBBL 3K4DA 5H94A 4PJ8D 3HR6A 3BPCA 3QFDA 4KUZH 5IUSA 4BK4A 5MENE 1KIRB 1Q9LA 2YXFA 3TA3B 2R2EA 4N0YH 2YEZA 4KC3B 3FQNA 5FHBH 4DZBA 3LKQA 1JNJA 2D9QB 3PQYD 2N56A 5D8JH 4UNVA 2NX5B 5F96H 2MFNA 4NSKA 1JWUB 3S98A 3BQUC 4MA8L 3MUY1 3WV0A 3P0GB 2CUIA 5JMRA 4NP4L 4IRJB 4JO4H 1A9BB 1FLRH 4PJHF 4AIXA 3W39A 4U1IB 3WL9B 3TT3H 1ZGLB 2Z31A 2AXFA 2D03L 4NZDA 4LEOA 3THML 1QRKA 4XVSH 3DO3A 3GSQA 5F9OH 1XGUB 1FJ1A 2DQIL 3SDDC 5DRWB 1RHHB 3MNWA 1QBLL 3IF1A 1HIMH 5HHXL 4MNGB 3EGSA 2KQNA 3T8XA 4Y19E 5I30H 3FO2B 3G5VA 3ZL4L 3MODL 2DDQL 2EXWC 1A5FH 4KRPC 4F7TA 4PYGA 4DEPB 5BZDB 2W0FB 5D7IB 3RX8A 4NO0A 5T3ZL 5D71H 3QNZB 5CHNB 3QNXA 1BPVA 2KZWA 2XT1B 3F6LA 3V4UL 2D7PA 2HA1A 4NQEA 5CZKA 4MXQD 4YBLC 3DRQB 1G6RL 4PJGF 4EUPA 1JGEA 1KTKE 1FYTA 4Z8FL 2CO7B 2J8HA 3OAZH 1C5CL 3SPVB 5JUEH 3ES6A 3OGOE 4LQ1A 3PXHA 4GKNB 1G9MC 3GBML 2M8XA 4YGVA 3VWJD 2ZUXA 3QUKA 1D5XB 2Z91A 5DD3H 2HH0L 3BPOC 4DWHA 3HRZA 4CN6A 3LQAL 3SCMB 5HHVH 3HS0A 4IOFD 1LDSA 1X3DA 1ZKAA 2NY1C 5DK3A 4Q9CA 4JKPH 3EBAA 1Q0XL 4K71B 3P9LB 3O4OB 3T0BA 1H8SA 4H25B 4CMMB 3VD5A 2P8PB 2EKJA 4TNWF 1CLYL 2QLVB 3NOIA 4Y4KD 4D3CH 2AJUH 3O8XC 5JW4R 2NR6C 5HGDB 1JE6A 1ZVYA 1DQQB 4O02L 1ES0B 1CLZH 2EZ0C 2XRAH 1CLCA 5F3BA 2BJMH 1V5JA 3MGOB 2GSGB 1RULL 1MNUL 3L5XL 2XQYG 1PLGL 5B3JE 5CMAB 3UJIL 2VN4A 3BH8A 3OPZH 1PSKL 4WWKB 1D6VH 2RR3A 4K94L 5DSCB 2IG2H 1YEKL 1B9ZA 3BRDA 4LLUA 4LSSL 1BZQK 5I8OL 4I3RL 3DUUB 2FYYB 1XGYL 5GQBA 3B6SB 3QQNA 4RGND 1LP9F 3SJVA 2Z4QA 3U2SB 1KB9J 4WV1B 1HNFA 2JJVA 4PGDB 2DTMH 2XTJE 3HLAA 3S4SA 4IRJD 3I2CH 2XZCH 1TTFA 4X0KA 3BKCL 3CH1A 1FFOB 4BSWB 1SEQL 3Q1SL 1QNZH 1IGMH 3O3EA 5T3ZE 4BZ1H 3BZDA 4E41B 1YQVH 3HZVA 4GFTB 3S36X 5IMMB 4JB9L 2AEWA 2HMID 3QFJD 3NFSH 5FFLA 2K7QA 4ODBD 1T66C 1K2DA 4NN7C 1ZGLM 2ENSA 5L7XL 4EI5A 5DJAA 2FWOB 1MLCB 2P45B 1PY9A 3OBAA 5FV1L 2W9LA 5IEHA 1NKOA 5FGCB 4Z7NF 2YC1B 5DMIL 4YNYB 3V5DA 3R4DA 1XR8B 5F7NC 3HN3A 1B4RA 3VRJA 1MRFL 1DQTA 1KCSH 3V6ZA 3T1FB 3UC0H 1PZUB 2BHZA 1Z2KA 4KMLB 1UJTA 1YEGL 4KI5C 2AI0H 2VDML 2Y06L 1U8HB 4F7PA 1CR9L 1F13A 3RGVC 1BFVH 3ARFA 4K3EL 4M4RA 1Z0NA 1QHOA 5F21B 2W65A 3QIWA 3HC4L 4K3GA 4AMKL 5LGJB 3VFSA 4EOWH 3PWLB 4JVWA 3VA6A 1CGVA 3ZYIA 4Z95L 1WAAE 1T83A 1YPZB 3N06B 2JJUA 1IC7L 2VR5A 1JZ5A 5IT2H 3RY6C 3G6AA 3ZT7A 1X5JA 2V9QA 3LS4H 3DX9B 3CGTA 4PTTB 2YRZA 5CEZH 3CLFH 1MCNA 5E2VL 1BVLA 5I1KL 1MHPL 1UH4A 2VDLH 3SCMD 1NCTA 4I0PD 2SEBB 4KXZH 1U8IA 2F19H 3U1SH 3T2NH 3G6JE 2FBOJ 4U3CA 4KWUA 1UWEH 3HI1A 2GJZB 1TJHL 5TGBA 1ACZA 1NGQL 3W9EB 1NFDA 3PWNA 5CEZD 4V1DD 4JY4A 1L0XA 2FHBA 5IIEA 1J8HE 3V6OC 5LQBL 3N50A 2EH7L 4HIEA 5E2TL 4ZNEA 1CG9B 1XF1A 3GI8L 4OI9A 1AHWC 3TM6A 4GKSB 1ETZA 3ZE0E 4XP9L 4WWKD 1EZVY 1OW0A 5E1HB 3TC9A 5E5UB 2NXYC 1BIHA 3PJSA 4QOKA 1S7WA 4Y2DC 3LZFH 4L3EA 1A4KB 4UQ3B 1ZT4B 4JM4L 3GBNL 4Q6IC 3SDCA 2J5LC 4XP5L 2FL5A 3GSVB 3IGAB 4DKEH 4IRSB 5HHMD 2HVJB 3JV5A 4EI6B 2YPKA 4P99A 3VFUB 1XIWB 4YEFA 2X1WL 5FDWB 1JV5A 1W72A 3MR9A 3IFPB 1PG7L 2XYCA 1ZOXA 3X3FL 4AEIL 3SBWC 3MRGB 1ZVSA 2VH5L 1QACA 5TFSL 1ZTXH 5KS9B 3IFOA 3VD7A 4KTEL 4IMLB 4ZUSA 2I5YL 3VD3A 4PYHA 4OZGF 4H8WH 4Y16A 3MBEC 3AXLB 1OP3H 1ACYH 2AQ1A 3WIIH 4X4ME 4E41D 4QHLB 4C83B 5I1IH 2HJLB 4OSUH 2VL5A 2CMRL 1NANH 3S35L 3RWIB 2QQKH 4K8RC 1CI5A 5TDPA 1JYWA 5ALBH 4LASL 4F57L 2ICCA 1VHPA 1PQZB 1CD8A 4OF6A 5I8KH 3WO4C 2HVKA 5I1AB 4J3VA 5I66B 3TCLA 1VPOH 4PRHA 4UIKH 3BE1L 1MRCL 3GHEH 3L3OA 5DGQA 4NM4L 1HE7A 3GRWL 1I1AB 5EO0A 3LKNB 4ONOA 4OB5L 4OGAC 2X4TA 4KHTL 4UBDC 1RK1A 1UC6A 3LEVH 2WZPD 5EBWB 1FV1A 2L7UA 4MJIA 3F7VB 4WIQA 1HDMB 1YECL 1DVFA 3VFOB 4YDKL 4E42A 1E4XI 5E00A 3C60A 3IRPX 4K23L 1SMOA 1VEMA 2X70A 5BVJB 1DBKH 1IQWH 4PRAB 3SGJA 4PLJC 5A2JH 4LRIA 5AD0B 4XMPL 5I1JH 4S1RL 5B3JF 3O9WD 4ZXBB 4K7FA 5GRYA 4P9MH 3SE3C 1KCRH 4EN3B 3K2UH 4LARH 3FAXA 1TTGA 2DM4A 1RZJC 4JFEA 3HRPA 4NO3A 5HYQA 2Q76B 4KAQH 3OMZA 4HCRH 3NACL 4GMTH 1SVZA 3BWAA 4JQIL 2A6IB 5EU5A 3O4LE 1ZLVK 2GT9B 2R1YA 4YHLH 1AO7D 1PJ9A 5E9DB 5K9OA 4MJ6B 1UFUA 3PHSA 1VACA 1CDJA 1R24B 3OAYK 1SEBB 4ZPVA 4BH7A 2EO1A 1RUMH 1CBVH 3V7AE 2R1WB 4I18B 4M1CC 5C09A 5HI4D 1IEBA 1ADQL 1CLOH 2C26A 3QIBC 3ZZ1A 3RUGE 3E3QE 3MRKB 2DYPA 1CWVA 4KKCD 2D2OA 3Q6GH 4WEMB 5MEQB 2J6EH 2CKBL 2BVOB 4H0GA 5CP7A 1OAQL 4JVUA 2VLMD 1RJLA 5MEPB 5BV7L 5EZLB 2VZUA 1F8TL 3KJ6L 3ARUA 2VB5A 1FDLH 1FZKB 1P1ZA 4JHBA 4CN1A 4LCWD 4JZJB 3HMXL 1IMHC 4WW2F 4JFPB 2HFFB 3KLAA 3T2QA 4MVBC 4P59H 5DDHA 3K2MC 1D5IH 1JZ7A 4IRSD 3LV3B 5MHSE 4MWFA 3PWVB 3MLUH 3WDIA 3LOWA 2FD6L 1XIWD 3F8UB 4XCCH 1C1EL 4FFVC 4KFZC 4PJFF 5F7WC 4OM1L 3CK0L 4JE4B 4PJAB 2EE9A 3RBSA 3GB7B 1KXQE 3IDIA 3MCKA 3SGEI 4PREA 5GS1C 5TDNB 2CIKA 1BLNA 2MHAB 2BXYA 3BHBB 3FO1B 4JN2B 3C2AL 4Z7VE 4KY1L 3BD4A 4HV8A 4Y5VC 5DR5H 1LD9A 1P84J 4IDLA 4UILH 1F6AA 2ZZUT 3QPXH 5CEXB 3ARSA 3BW9A 2PW2B 5T5FL 3SDYH 5IBUB 1WAAF 5EO1B 2I9TA 2DD8L 1AD0A 2ENYA 3OF6A 3OHXA 4UT9H 4URTB 5IVXE 4OD3L 2BNUA 3KPLB 4L5FL 4I48A 3C8HA 3G6DH 4DCQB 4XPGH 3S3PA 3WFBL 2UWEA 4YHOH 3ZHKA 5DUMH 2AJSH 4MB5A 1KELH 3O11B 4RRPA 1YNTA 4Y4HC 3C6LC 4PJIB 5IB3B 4M7JL 3QHFL 3UZQA 3SDAB 3KYKH 1JGUL 5FECA 4KROC 2IANB 3TYFA 3G6JF 5EIVA 2HJFB 5H2BA 1NAMB 4TQEH 3AUVA 2Y6SC 4QRQA 2FX8H 3RWHA 1YMMD 3T4AB 1ZWIB 4LSDA 5HHNB 1JHTA 1XF5B 5F9WB 1MCRA 5E99H 4P2OA 5IW3A 5TH2A 3ZKXB 1TJGH 3T0EB 4APQC 1YN7A 3DMMD 2FECI 2E9WA 1R3LA 4JY5L 5GSRA 2ZG1A 2QV2A 3OR7A 3QO1B 2OBGA 1AGFB 4WFGD 1FL3B 4QXTA 3U7AA 1LDPH 5DTFB 3MRFA 4J4PD 1OPGH 1J1PH 4ZXBD 3O6FC 3P3YA 3WHE1 2V17H 6CGTA 1D5MB 5MEOB 2VZOA 2C7UB 1DDHB 3TVMB 3TV3L 5DQ9B 5SWSA 3PDOB 4ONFH 2XQBL 1UJ3B 1Q72H 5E9DD 1T20B 3KNBA 4FQ1L 4B0MM 1HZHL 2QQLH 3MROB 4EEEA 4WI8A 5GISL 3ALPA 4RGMB 3RWFA 1ORSB 1URLA 2GK0B 1UWXH 4GG8B 2V7HB 2VDQH 5E2UH 1U3ZA 3VXRA 3P30L 4D0CA 1NCBL 4P23A 3ULVD 2OK0L 1A6AA 1GIGL 3LPFA 4KJPD 4KUCF 1YYMH 3IDGB 3DSFH 4K7PX 4I8DA 3RQ3A 3RNQA 1Y6KR 4PGEA 3UYRH 4WJ5A 1BHGA 4UI2A 1VGEL 4YHIA 1AXSB 4LLVB 2CJUH 5FYLL 1QEWA 2JF1A 4ZUWB 3PABA 4MAUL 4QXGH 4F7MB 1INEL 3RNKA 3QWOA 4PJGB 1VB9A 1LQVA 1JF5A 3U4BH 2W9EH 1A8JH 5C08B 1QRNB 4OF0A 2VQTA 3UTSB 2XQYK 3MNZB 2WBKA 1JCKA 3CSYB 1LK3H 4P9HH 3LN4A 3MRDB 4MNHB 2R8SH 1FAIL 3TFKD 3V52H 3EZJB 2I07A 3IDJA 4PRBA 1VKXB 4WI9A 3N9GL 5DI8B 4XCFL 3QXVA 1X9QA 2I9LB 4MNQB 1BD2D 3FQRB 1ZHKB 4Z18A 5D2LA 2DI7A 4G6KL 4JANA 5DUPH 1NAMH 3ZE2F 3D3VA 2RB8A 2AGJH 1AR1D 4X6BB 3EYUH 3MCG1 2KZ1B 4OFPA 5SX5H 3MLTA 1P4LA 5IJVB 4XP4H 2EDOA 3J7HA 2IH3B 2D3VA 5CLTA 1M6OA 4C55A 4P3CH 2CLZA 2OXGA 4UV7H 5DJ2B 2AJZA 3N1GC 3UDWC 4FMKA 1CZ8L 1H0DB 3O3BB 5FO7B 4RMUA 4OQTH 4HZLA 4XXCC 5IMKB 1GZQB 3EYSL 2IAND 3VWJC 3EZ8A 4JREB 3KR3H 1KB5B 3EOTL 2NTFB 1DUZA 5DXWA 4UOJA 4HFWB 3DETD 4IOFC 2IPTH 3VG0L 4WI7A 1JNLL 4NNXB 4NQEE 4R4ND 2ERJC 3GJFB 3IDYB 5C6TH 1JZ3A 4KV5E 5J12B 4LF3A 1KPRB 1LP9B 3GMPB 1IEAA 1NCAL 3MRPB 1FYTE 4Y4KC 1GGBH 3QHZH 5E2JA 3MXVL 1UWGL 4BM7A 3RI5F 1YJDL 5I76A 2V9TA 3PGFL 4OTXL 4M03A 3RL1B 1A3LL 5BS0B 2O5ZL 2V2WB 1FE8H 3KPTA 3G04A 2VE6B 2UYLB 1FSKB 2W92A 5DD0L 2DMBA 1EVUA 5DJ0A 1QVOB 1RIVL 3CVIH 3KXFA 3HI6L 4H20L 2FIKB 4MHHI 1J1XH 5A2LH 2V5RA 1WBXA 5FYLE 3RWJB 1BQHA 43C9A 4JLRB 3TWCH 1VFUA 3VFPA 4ACPA 1AKJA 1RUQH 2QSTA 4RGNC 2LABA 3FQWA 3HPJB 2DQTH 4P4KD 5ID0B 1QSEA 4WVRA 4J12A 3V4VL 4JZNA 1J05A 1Z9SA 4OZIA 1NMAL 1S7XB 3EOBA 2FLBT 3WEXB 3ARBB 3I6KA 2E6QA 2IADA 3LKSB 4IRJC 4DKFH 5B39B 2IAMA 1ORQB 5DD1H 2X4UA 1FO0A 3ZLQC 4WHDA 3CFIC 5IVXF 1MFDL 3SOBH 5D2NB 3V8OA 1J0HA 1SQ2N 2Y5EA 5GGUB 3UCRA 3JUZA 5H35B 1WCBA 3E6HB 3X11B 5C08D 2JB6A 3FKUS 3KDMA 5EIQA 5ISZB 3UTSD 3F12A 2HMIC 1UYWL 3W0WA 4NJ9L 3TBWB 5EUOF 5EOCL 3SJVE 4YHMH 1BFTA 1CU4H 1HI6A 4HUVB 4FFZH 3QXDA 1FPTH 3JTSB 1DBML 3BO8B 1NGXB 2NNAB 2PR4H 1XGQA 2VITA 4GG6A 4DEPC 2X4PB 3ZKNC 1FNGB 4C56A 4MNQD 5F3HA 4MD4B 3UROR 3DI2B 2YD7A 1SM3L 4R7DA 4DVBB 5GGQL 1KPVA 5DO2D 3MQIA 2VABA 4LMQI 1KB5H 2EEAA 5EC1B 3WE6A 1KTLA 2VZTA 2DKSA 2CDGB 3CDGB 4OIBA 4I9WE 1QBMH 3GJFH 3MACL 2ATKB 1BFOB 1DLHA 4X6CA 5LAXA 1W72L 1JTTA 4R90L 5TF1L 4Y4FB 2E5EA 4DAGH 3T0VA 4D0BB 4XNYH 2XZQL 5HYJB 4OFYD 4YHNA 2BMKA 2J3SA 5FKPA 3CDCA 4HKBA 3QEGH 3SCMC 4I0PC 1ZA3A 4ZYKA 4Y19B 4HC1A 4NZJA 4KTDL 5ETUA 2XICA 4LSVH 4U1KB 3SN6N 5JLZA 4YXHL 4C4KO 4X80L 4JHAL 5IB5A 4PJXA 1OAZL 3IDNA 3LDBC 1MVUB 1ZEAH 3JTTB 1IAKA 3CX2A 5DZNA 3BMWA 3NIGE 4QXWA 4EBQL 4QNPF 4WO4B 5TQ0L 3S34H 4MA7H 4OZGB 3OXSB 2AKRB 1NC4D 4BQ8A 1CXIA 1V3LA 4WWKC 1H3GA 1L9MA 2XFXA 2VZ1A 4EXPX 3VXUB 4OIAA 4TSBH 4M8QA 3CXHJ 2MCG1 1G7IB 4QRUB 5BXFA 4YAQB 4U1HA 5EBMA 3I6LE 4YZFE 1MQKH 4N0UA 1LNUB 4OIIL 4ZTPL 5CZVH 2HLAA 3KYAA 3VRIA 1ZSDB 4WV1C 5CGYC 4N9GA 1NFDE 4I4WB 4XPBL 4NO5B 3ARBD 1H3TA 1H3UA 4L1DA 5IBTL 4ORGB 3B3IA 3MRLA 4NUGL 2P8MB 3RAJL 2VLKA 1RFDH 4NQVA 2VLLA 1QFWL 2OR9H 5B39G 4L4VB 3NIFE 3W2DH 1U9KA 2NY6B 1H3PH 3OV6A 4QOKE 4HS8H 1ZT7A 4IDJL 4W6YB 4OLXH 4L3EE 1A7NL 3OB8A 2AS5M 5F70A 3D39E 2W0PA 5ISZD 1A7QH 2EIDA 2XN9B 2FIRT 1XR9B 1OTUD 5T3XL 2VDPL 5C2UB 4G8IB 3QRGH 5EULV 2I60H 1N4XL 2DKMA 4OCXH 1FZMB 1R3HB 5BO1L 2E6PA 4TULH 3LRHA 4ZSOE 3X13B 1X5GA 3CD4A 5MEND 4KV5F 3B83A 1KEGL 3BGMA 3DX6B 3FB7A 1T5WA 3QB7C 3SBWA 5GRWA 1MFCH 2X7LB 4GW5B 3WFDL 4QYOB 4MCYB 5TPWL 2XTJB 3BUYB 1Y18A 3HZKB 5C0DB 2IEPA 3MA9H 5T1LB 4PRDA 5D6CB 5FUCC 2YMXH 3EW3B 3R0MA 3MUHL 4HKXA 2JE8A 4QEGA 2D31B 3WJLC 1V7MH 5A2FA 3O9WC 1BF2A 3ARXA 1ZE3C 1CFVL 3BEVA 5D1ZC 1QFUL 1BAFL 4ESKA 1IGCL 2ARWA 3PWJB 4JRYA 4M6OL 2ZCKL 3EOYG 2ZKHH 2VXUL 2R4RH 2QQNH 5LXGL 2OLDA 4L9LC 4H26A 3UXFA 4MJIE 3SDXF 2MQ3A 1UXSA 4WW2B 1X44A 5JW4M 4Y19D 2R0ZH 4LLDB 1WZLA 1UQSB 2C3HA 2E7MA 4NYLA 1LO5B 3HE7B 1YNLL 2FGWH 4GRMA 3QUYD 4TRPH 5HI4C 1HH9B 3V5KA 4ZFFB 2JLLA 3DWTA 4PJFB 4MA3A 1RURL 3RWEB 4Y88A 3ZDZF 3AVEA 1GPOL 3OKOA 2AEPH 4GUPB 4Y89A 4RWHA 1KJ2B 2EKSA 1NBVH 3GI9H 1WITA 2JIXA 3ARDB 4Z5RA 2VDRL 3UTZB 1S8DB 2X42A 3B8YA 3VXUD 1A6TA 2IPUK 5F89B 5CIPA 5I8CB 5IVZA 3B8SA 3WBDA 4M1GH 1HHHA 1NMCC 3HB3D 4RISL 2YUZA 2LAGB 5C09E 5T3XE 1XIWC 3QA3A 1UACH 3JWOH 3OAUH 2MCPL 1LO2H 5IQ7H 3QUZB 1AGEB 2AK4B 4OZHA 3SGKA 1D7FA 3JV6B 3C9NA 4XPFL 1MCLA 4OCRH 4R97C 5CS7A 2OZ4L 3QI9B 3D6GA 4D9QE 4DZ8B 2DBJA 4L4VD 1INQA 3S3SA 3QUXB 2NY6D 4MSWA 4UUJA 1VEPA 2R0LL 3O45A 2YUVA 4JY6A 2R0KL 1E4WH 5E8EA 4TPRH 4NKMA 2XN9D 5D7JB 4FABL 2L7JA 5DEFA 1CVSC 1U36A 4JPWH 3SKJL 2CLRA 3ZL4H 3DV6B 3F7YA 3PL6B 1JWSA 2XPGB 5A16B 4N5EA 4OI8A 4DN3L 1TCRB 3BAEL 3TLRA 4W6WB 4BQBA 2ZUVA 3FT4A 1PZ5B 2EDXA 3FTGB 4LHUA 2PO6B 5FCUL 5IOPB 4OKDA 3MX0A 3KAAA 2DL9A 3BP4B 1YC7A 1UCBL 1P5VA 5C0IB 4HUKB 3WKMH 4NCC2 3CPLA 2VISA 1CD0A 3DMMC 3JWDH 2XTJD 1OCWL 2HFTA 6FABH 5DHVA 4WI5A 3IXAA 5T1LD 5C9KA 3NIGF 4JHZA 5CEYA 1A3RL 5F7LB 2BOCA 2BVPB 4YUEH 3UBXA 3DUHA 1EHLH 3JZ7A 4J4PC 1CDCA 4ZXBC 4RFOL 5T3ZD 2G60L 4HUWA 1CFSA