1FZJB

Mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
molecule tags Immune system
source organism Mus musculus
publication title The crystal structures of K(bm1) and K(bm8) reveal that subtle changes in the peptide environment impact thermostability and alloreactivity.
pubmed doi rcsb
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fzjB00
2X4PB 4JFDE 4NM8L 4XHQA 2NY5L 1B6DA 2GY5A 1DZBA 2X44D 3WUWA 3OKEB 1NL0L 2C4FT 3S36X 4XCCH 3VXME 2UY7A 3O4LD 5HYIA 3QEQA 1XGUB 2MKWA 4FABL 4QOKB 4TSCL 2DL2A 2HT3D 3BP7A 1N7ML 1QQDA 1G6RA 4Z7QF 5IB4B 2PR4H 1IQWH 4CVZA 3NIFF 1KTLB 4TUJB 1IM3A 1WCBB 5A2JH 1EHLH 2YHGA 1NANH 2Y06H 3H42H 4L4TD 4JRYB 4F37F 1C7SA 5IMKB 3GEWB 2JJUA 5FCSH 4BUGA 4G80A 2FWOA 2VITB 4MQ7B 4R90L 2FYYB 2C3VB 3BXNA 1FCCA 2UWEF 3OXRB 3P4LA 3WHE0 2LQRA 4N0FB 4N8VB 3DMMD 5C7XL 4LEOB 5ICXA 3FFCA 5HHOB 1SVZA 1KYOJ 4XPHH 5IHZB 1KCSH 4N8CL 5HI3D 5J7CC 1O5DT 4NO0B 1IC5H 4M3JA 3BQUA 2YA0A 1XAUA 4NKOB 1IL1A 2CK0L 4MNGA 4WUUE 2HVJB 1IM9D 3EFDL 3GSUB 5D2LE 8CGTA 4MXQD 1I9JH 1NCTA 3B5TA 5FYLD 1A02N 5DYOB 3PWUA 2XWBA 3U36A 4ZD3H 3OKLA 5DR5L 4EIGB 4JFPA 5A2IH 1FPTH 1MCLA 3VFGL 1FZJA 3RNKB 2DQCL 3PGDB 3HMWL 2OL3L 3WN5A 4S0SD 1H0DB 2BZDA 3GMMA 5CEZE 2D7QA 1RD6A 3VXRE 1CQKA 3FO9A 5BCAA 3CIQA 5EU3B 1RIHL 3EJYC 1X5JA 4OFIA 3HS0A 4PBXA 4FQXA 4BH8B 1WEJH 5EC2B 1T21A 3LD8B 4F9LA 2E7LC 1U8OA 4U6XB 3WKMH 5IVOA 1DVFB 2ADJB 3AMKA 4U1NA 2H6PB 5SWSD 3EHBD 3RTQC 1L9MA 2PXYB 4MA8H 1FV1B 3FQTB 1JBJA 1ZOXA 3EOAB 5E95B 4XC3L 5TE4L 4LVOB 3D0VB 4K7FA 2VQUA 4RMSA 3P11L 3EDFA 1Q8MA 4H1LG 4JFQA 4PD4J 2DQGL 2W38A 1CGUA 3QNYB 5HHVL 2OQJB 3ARBA 4JFEB 3BGAA 3M17A 2NY3C 5DMIL 1NCCH 1OAKL 1P4BH 3PJSB 5T1LA 4GRMA 1K4DA 1MRCL 3MLXH 3VG9B 3EDEA 3O8XC 3E3QC 4U6YB 1MPAL 3FB5B 4GKSA 2F5AL 3IRZA 3G6JE 5KANI 4QTHB 2I07A 3O8XD 2F54A 5JOFA 2WZPD 2WANA 4XP1L 3RBSA 4X5XB 4NM4L 1MCBA 5FXCH 2KDGA 1EO8L 1K2DA 1MI5D 4ODTL 4PJGA 4E5XB 5T1KD 5IKCA 3MLTA 2W9LA 1N6VA 2YPLD 4PRAA 2IAMC 3UTOA 2JB6A 5FHAL 3IKKA 5DT1H 3ARDC 4PJIF 4J3UA 1VKXB 3MUGA 4GMSL 4H26B 2XQYG 3QWOB 5E6ZA 2MCPL 1U3HC 3JV4B 4FFVC 2C7UB 4EUPH 3DRQB 2J8UA 3BW9A 1MNUH 4MJIA 2Z4QB 3VFNA 3QEHA 3MYZA 3T4AA 1NGPL 2O5ZL 32C2B 5IVXB 5E24E 5EZLA 4MSWB 4XP4L 1UCBL 3STBA 3VFSB 1W72A 1U8IA 4LCIH 1K85A 5A16B 1CU4H 3IGAB 4I77H 2HMIC 3V4PH 4YBLB 3QHTC 4X6CE 2LU3A 4UTAL 5KZCB 4OCRH 3CX5K 1INDH 1F4XH 2EC9U 2PUQT 3GRWL 1ZGLM 3ULUL 4WI8A 3A6OA 3H9SB 3QQ9C 3RNQB 1A3LL 3MLVH 4WTWA 1PYWA 4JZNB 5E8NB 4UDUB 3T8XB 5BOZG 3C2AH 1QSFE 3H3PH 3U82B 2DICA 1INEH 1E28B 3E0GA 4KTEL 3HNTH 3SE8L 2V5SA 3BEVA 3D18A 4JB9L 4U3CA 5FK9B 5FOBA 4CVWA 2XKNB 1FLTX 4GW5A 3TNMB 1QLFB 4I2XE 1KCUL 5T1DL 1FP5A 4OSUL 3HZVB 3AVEA 4OD3H 5I30H 2AJSH 4OQTL 3GJFH 3HLAA 1F3DH 5K9KA 2R4RL 4LSRL 4TULH 3IGAA 5A1AA 2BJMH 3HRZB 4XCEA 1R3IL 4P3WA 5DRZB 5K9OB 1IC5L 4NUGL 2MTPA 1BMGA 4HKXA 5F6HJ 2R2CA 4IRJC 4U6VH 2VLRB 3LQAL 1DUYA 1PYWB 3T8XA 3CFCH 2IALB 1UXWB 3CXDH 1ZTXL 4MZ3A 1D5ZA 2KKQA 3O4LE 1JWMA 3K2MC 3VXMD 1YEIL 5FO9A 1NLDH 3WMSA 3PWUB 2HT2C 5CWSA 5DHYA 2R0KH 3LRSA 1GGYA 1J1OL 3TNMA 3MRRA 5DS8B 2FATH 5F3HA 3ZDZF 5CKAA 1Y0LA 4LPCA 1M05A 5CZVL 5I1GL 5LG1A 5EH1A 1BVLA 1F13A 3O11B 5DMGC 3GSOA 2ZG2A 3AGVA 3IDIA 3NAAL 4ZMAT 3S4SA 3AY4C 3NN8B 2IBGA 4HGWB 4AMKH 2P49B 2Z4QA 3VFNB 5KG9A 4LHUG 1FE8L 3EYVB 3B3IA 1S8DB 3BKML 4H20H 2HWZH 3ARED 3O41A 4HT1L 2IPKB 1TPXB 1XCQA 1J87A 4G6AD 4D0BA 1NCAH 2EXWC 4TVSa 3PP4H 2PCPB 1SY6L 1MRFL 1KV3A 2MPAL 1BF8A 3TBTA 4PB0H 3H7BB 4HWBH 4PR5B 4X4XB 3MV11 1P4LB 3MBEA 2CRIA 2PW1A 3UTSB 4K8RL 2R0ZH 1Q0YH 5IOPA 1DN0B 4LLMB 1XT5A 3AU1B 3GZKA 2Z31A 1DP0A 5D1XD 5AUMB 5HYEA 4A2LA 1F3DJ 1G7JB 1K5NB 2VZVA 5I8KH 3PWNA 1RMFH 2V7HB 2CLZA 2A6KB 4Q97A 5CEZD 3MLUH 5T33H 1HWGB 2J88H 1CXIA 1R3HB 3SEPA 1LE9A 2YD5A 4MJ2A 2CJUH 1TVDA 3IDGA 4JQIH 2YD7A 1NKOA 3NPZB 3TCLB 5DVNA 3UZEA 4LSSL 1ZHLA 1T0MA 3LH2L 3TBVA 1S5HB 4M62L 1NLBH 5F9DC 4KQ3H 3WNLA 1P6AB 2IAMB 5SWSE 1YQVH 4UQ2A 1T04A 5IV2A 3PHOB 4BQBA 2FJGA 4I0PC 4PRDB 4HMDA 4OGXH 5E8PA 3SCMC 1C1EL 6CGTA 3WXVH 3KYOB 1UJTA 4ZYKA 1T5WB 4RBPK 1F4XL 3MOQA 4I0CC 3U7WL 4UTAH 2DQTH 1M71B 3W5MA 5BZDB 5CFHA 1WT5A 4WHYH 3U46B 2FR4B 5GGSA 1LNUA 4AY0A 4LMQI 1JWSB 3V4UL 2AI0L 2ID5A 4S1RH 5DXWA 3WD5H 5IM7A 5I1DA 3BZEB 3ISWA 1GIGH 2APTA 5SV4A 1CVSC 3KYNA 1KSRA 4Q6YA 2YUWA 2VUOA 4OZIE 1PZ5B 1MJUL 3KJ4C 2QR0A 1U8HA 2YMXL 5ITFA 1I7UA 2BY1A 4OFVA 3VI4E 5AZ2L 1UM6H 4NHUB 4P9MH 4NP4H 4J6RH 3RZWA 2PCPA 4R26H 1X5XA 3ZKSD 2YRLA 1FE8H 1B2WH 4YXLL 5C0CB 4LNRA 5HHMB 3X3GH 2X4SB 4JY5H 4GG6F 2J12B 2VZTA 2FX8H 2J5LC 5HDBE 1KPUA 1IGTB 1N64L 1YEKL 3SDCD 4OF6A 3DX9A 1MFDL 4QRRD 5EBMA 1CR9H 3K8KA 3QZWA 3CSPA 1D9KA 5JW4Q 4M5YL 4H5SB 5F7NC 2ZCLL 1W72L 2D7NA 5EO9B 4JRXD 3C08L 3CGTA 3KLHC 4JFHE 2HYMA 3NCYS 4KVNH 1RJZB 3HPJA 1BWMA 3WFCH 3PWPD 4EN3A 5CAYB 1YJDL 5JW4R 1S7TB 2QR0B 1ACYL 2DQDL 5H2BA 4NHUA 3K46A 2DTML 3FT3A 1YYMH 1UFUA 5EU5B 4G7VL 5AYUH 4QLRA 4WU5A 3UTSE 5AZ2H 3S7GA 4OZIF 2J6EH 5D7JD 3LQAH 1NUNB 1KJ3L 3KNBA 1A2YA 4U1GB 3I6LE 1AD9B 4G3YL 4YK4B 1UG9A 4D94A 1ZLUK 1BBJB 3CU7A 1KN2L 1T89A 2YPVL 3WL9B 1QSFD 5HYJB 2VWEC 1NBVH 4NWUH 4D0DA 4UQ2B 1FO0B 1W0VA 4E9LA 4IOFC 4YDJB 3TZVC 3KPLA 3OR7A 1P5UA 2EYRA 5T1DH 1GOFA 1Q0XL 2XTJE 4D3CH 5DFTA 2Y7QA 2X1PA 1YY8B 5D1QC 3D87B 3IU3B 1MCQA 4Q6IA 5C0DB 4FQLL 4Y2DB 4Z18A 5T1KA 4KQ3L 4XC1L 1YQ2A 3QDAA 35C8H 3QULB 4TVPH 4XCYA 5L2KA 1P4LA 2CMRH 2NTFA 5DHVB 4L8SA 4KJQD 2N56A 3FQUA 1HHGA 5HHPB 4FZ8H 2KZWA 5DQDH 3IF1B 3D2UA 3VD7A 1RHHA 1JV5B 2W9DH 3SDXA 1U8KA 4U49A 4TOYL 5C08A 5T1LB 4FRWA 5J11B 3VMOA 4IRSC 1G7JA 3H9SD 3L7EB 2GJJA 4FQ1H 5I19H 4O5LL 3X14A 4MGXA 1N0LA 4O2EA 5MEOA 1WTGT 5A2LH 4JFZH 4N8CH 4X0KA 5IVXA 2Y7QB 1XF4A 5EG6C 1IEBB 4HUKB 5EORH 3U4AA 1BD2B 1KPUB 2HH0L 3ZKMC 4C4KT 1CFSA 1KACB 3CVHH 2XPGA 1FNEB 3EYUH 3ZYOA 3VFUA 1XGQB 4JY6A 4G8EB 3TZVA 5IVNA 3UDWC 5EO9A 3NVQA 4M7JH 2ERJC 4P2QE 5T5FL 5KSBE 3ESUF 1VFBB 1NMAL 1NEZB 2BRQA 3EJZD 3RVUC 4P59L 3GBML 2ZG3A 1A3RH 1NCAL 3MV8B 4JGJA 5JHDE 1MIMH 3HI5H 2DS4A 2C1OB 2N1KA 1GGIL 3I6KB 5ENWA 4K8RC 4WUKL 3BKYL 4PLNC 4UBDC 3U79A 5IMMA 4TNWK 5KAQF 5EZLB 4NDMB 1A2YB 3DX8A 5BZDA 4R4NC 1FCGA 3PWVB 1BZ7A 1U58B 1BWWA 1HIMH 4NQUA 2F15A 1SY6A 3VFPA 1KC5H 2FH8A 2XWJB 5E0QA 5IROC 3L3JA 2Q3ZA 3SE4C 1EXUA 3UTZB 4K7PL 2D7TL 5C0IA 5DEGA 5KVEH 1E28A 1QRNA 1HE7A 4GRLC 2OJEA 5EN2B 3KPSE 4MAUL 1KELH 5GGVH 1MFBH 3MRDA 4HWEH 1SVCP 4A2MA 3HZVA 4U4BA 1RURH 3KDMB 1TIUA 4UDTA 5F7EH 3GK8L 4AEHH 5GRWA 1FFNB 3ARFC 1AKJA 1NEUA 3QG7H 3NA9H 1P2CA 4Z7OE 1A1OB 2OL3H 4BJLA 2QV2A 2C9AA 3BP6A 4U6HB 2RBLA 5B4MD 5MENA 2D03H 3MGTA 3V9FA 3GKZA 4QCIB 1WBZA 5INCA 1B0GB 1E0OB 4MA7H 3LEYL 4KK8D 3PHQB 4J4PA 1UACH 5IK3B 1N59B 1I7TA 4DW2H 4FQQB 2B0SL 4KAQH 1I1FA 2JB5L 5EU5A 3FQTA 2WBJB 3GMQA 4KHXH 4OLVH 5IEHA 1JGUH 3OJVC 5LAXB 2DMKA 3RVVC 4L8BB 2FH6A 3TH2T 5EDXA 3QIBB 1FSKC 4M6NL 1BVLB 3C60A 3HAEA 4PJCE 2H3NB 2O61B 3BGFB 5L88H 2YN5A 5EPMA 4Q2ZA 4PYHA 3RBGA 3EO0A 2EKSB 4F58L 5C7XH 2WINA 3CZJA 1CLOH 4PJHB 1FZKA 3DARA 4JM4L 5INCB 1ORQA 2AQ2A 4OLYL 3DX8B 3WIHH 3Q6GL 3IU3A 1P9MC 1AO7E 3N1FC 2NXZC 2V2TA 3DGCR 1P53A 3HNVH 3AS2A 1KIUA 5ITBL 1GGBL 5D7JA 5FA3B 3SOBL 1KULA 1KTRL 4JRXE 2O5YL 4Y4KB 4PJGB 4YFLI 5D2NE 1CYGA 5DEZA 5F1NB 3REWB 3UX9B 3VFPB 4E5XA 5CJ5A 2DKSA 1S78D 1HXMA 4JDVB 1IM3B 4PJBE 2D0GA 2DD8H 3B2VH 2CXGA 3NFSL 1OHQA 2ARJB 3GIZH 3MOBH 4XP1H 3MREB 3UTSD 4F7EB 2B2XH 3DSNA 5AUMA 5AZEH 4Y16C 2W65B 5I0ZA 1AY1H 2IQAA 3K4AA 4PRBA 3QEHB 3B9KA 3RGVD 3SKJH 5J13C 2BP3A 1QR1A 4DVRH 4WW2F 4HJGB 1J8HD 1DL7H 3CSYB 2EXYC 2BSSB 2AK4E 1JWSA 4C4KO 2Y36L 1NMBH 3QHFL 5HSFA 2PO6B 2H2SC 3RX7A 3TT3L 4PJGF 5J6GB 3P11H 3Q48A 4OLVL 3O81A 2EDXA 4JAMA 3ZL4H 5HPMA 4GXUN 1CZ8L 1T0NA 3B9KD 3RGVA 4OZHA 4WI4A 3PXJA 5JPMA 1KPRB 2JIXB 4L9LA 3V8OA 4H0IA 1UA6L 2YSSB 1LP9F 1BQSA 3U6RA 4KKAC 4P3DB 2ZCHL 4NRZB 5D1QA 4NKIH 5K9JH 4HEME 5A2KH 4EI5A 3FN9A 3BPOC 3B5GA 3ECBB 5CGYC 4L3CB 5EIVA 1PKQE 1MREH 5EZOH 2CIKA 4JFDB 2CDFB 4ZDHB 2FATL 3CVHB 2EKSA 2ICWI 3MA7B 2R0KL 1JPGB 4ELMF 1ES0A 4PGEB 1U8LA 4L8CB 2BOCB 5FO7B 2APVA 3C08H 3FQRB 1TJGL 1DQQA 4X8JA 4OZHB 4JFEE 5E9DE 1AJ7L 5FIEA 3GM8A 2VNCA 4M6OH 4RGOL 4XMPH 1JHTA 5DTFA 2CR3A 5KSUB 4IMKA 1A7OH 3TC9A 2X9WA 3TVMB 1JNJA 4KHTL 4P2QD 3MRRB 5DS8A 3VU2A 5ABDE 1UH2A 1J8KA 4OZIA 1RZGA 2P8MB 2RCSH 5T1MB 4NN6C 2Q6WA 1HILA 1T03H 5EUOA 4CDHA 4M1GH 1IKNA 1BECA 4XPHL 2C26A 5JHDD 5T3XE 4ZFZB 3ARDD 3F7VB 4YZFF 1BLNB 1G9NL 2F58H 2AQ3A 4U6HA 3FONA 2Z92A 3ET9F 3WE6A 5FKAA 4R7DA 3TCXA 4MWFB 4AIZA 1HDMA 4XBEL 5MEND 2I07B 2MNUA 1H3GA 3RVWC 1L9NA 2BNQE 5GSVA 4DEPB 1FO0H 3MJ9H 4LU5H 1DBKL 1E27A 4Z7WF 5JZ7D 4ETYA 3FB6A 3L3KB 1YY9D 2IAND 4FZEL 4MD4B 3BPLB 3KXFD 4LLUA 2UWEE 3CJJA 3O6KL 4Z7VA 2P45B 3SO5A 1WTLA 1OSZB 4C56D 4WUUA 3EYUL 3HR6A 4PGBA 5E4EC 3BVNB 4X4YA 5IEKA 4OLWH 3HFMH 3GKWH 3PWJA 4P23B 4UB0H 5DJYB 4X6FA 4Z6AT 5L2JA 1MHPH 3U7AA 5GGTA 4Z78A 3KPSD 1ZT7B 1AC6A 1N5YL 3BXNB 3OXRA 2PO6D 1JPST 2YXFA 5EU7C 4Q9RH 4UV7H 2EYTA 4DVBB 1R3JB 3HI6H 2E9JA 2VLRD 1DVFA 4WTXA 3LQZB 4HIEA 3CX5J 3VDAA 1EO5A 1WFUA 3X11A 4OF0A 1FYHB 5FYKL 4WU7A 3GSVB 5KSVA 5CIPH 4TNVF 5FO8A 4XMLH 1NGWA 3CFBA 1DN2A 5JMRA 1NC4D 2NTFB 3ILQC 2BOCA 4XC1H 4Y4KC 5I9QC 4M61B 2YK1H 5BO1L 4JHBA 1KB5B 3F58L 1Z2KA 4DGYH 4JFFA 3P4OB 1G6RH 1IAKB 4HLZH 5D7LB 4QRTB 3TNNB 3ZKXC 2V7NB 4YGVB 4PUBH 4JO1H 2H2PD 3WHE1 3FZUC 5C3LD 1RZGB 1KCVL 2D4DA 1BHGA 3D3VD 1F45A 5GGSB 4UV4H 4BYHA 3TZVD 3MLYH 4E41B 5LCVL 1R3LB 4NZTL 3ARGC 5D6CA 4KJWC 3BP7B 5DDHB 3BKMH 4ZUWA 4NT6A 5JPNA 4MB5A 4MQXD 4RISH 4JHWL 2E27H 1QSEA 1YEHH 3UAJD 5C07A 4OUOA 4ONHA 4G6FB 2X4RA 2V17L 2DTMH 3UTZA 4G7YL 1T66C 3CNKA 3P40A 1T03L 3MV8A 4MVBD 3W0WD 1I9RL 1FL3B 4C59B 3GJFA 5FKPB 4OCWH 4OZFG 1RZ8B 1WFOA 2NY2C 3HA0A 2ITDA 2HTKD 1NEZG 1PLGL 4KVNL 3WIFA 1RUQH 4ZFOA 3HZKB 3JWDC 4K7FB 2JIXD 3MBXH 4HFUH 4UIKL 2QADB 2FO1A 4GBXC 1HKLH 5C0FB 2O5XH 2PYEA 4ZO9A 5E08H 1XEDA 4ZSOB 4CBPA 4CGTA 1J86A 4XNZC 5TFSL 1B2WL 4YXLH 3BRGC 1SQ2N 3DBXA 4DKEH 4HH9B 3QUML 4V2BA 1HSBA 3PIQA 4QRPD 4YEEA 1N0XL 3GMOA 5IR1B 1MEXH 2DWDA 4BSWB 1KIRA 2E6JA 4BUHA 2CUIA 3OKKA 2X1QA 5I15L 4YDLB 4Y16A 5DZOA 1IGMH 2UVEA 1F4YL 4GQPH 4HKZB 1JNHA 5EOTB 1X44A 3I6GA 4RDQF 5J06A 4TRPL 1ZEAH 1OAUL 2X89A 4O9HH 5C2UB 1P4IL 5CD5D 4OD2A 2IBZX 3QI9C 1GAFH 1H5BA 1RUPL 2IFFL 4U1GC 4X8XA 5HVHB 1XF5B 3HG1A 2XYCA 4MDJA 4AENA 2EYSA 3ZKNC 1LO2H 4JN2B 5JORB 2DQTL 3JV6B 2O5XL 5DK2B 1JTTA 5D72L 2BNRD 4OB5L 1VEOA 3GRWH 1INDL 2JCCE 5EC2A 4QXUH 3MRNB 2LU7A 3QIUD 3SGKC 3LB6D 3PL6D 5EFIA 3PWLB 4KROD 4MCYA 3FO2B 3JWOC 5CBEB 1KJ2L 5GGRY 3S96A 4PGDA 1U8PB 1DLFL 1NC2A 4YXKH 4P2OB 2R9HC 3FO0H 3OMZA 4LKXA 3TV3L 5C0RH 3G5ZB 3RQ3A 5J13B 2P7TA 2X70A 1A9EB 4JCMA 3PV6A 4JFED 1P1ZA 5E9DD 1VGEL 2NYYD 5CEYB 5TQ0H 3ARBB 5FGRA 3EYSL 4ZOEA 1U36A 4LIQL 3D69A 1QBAA 3PHSA 1P7QA 5CGTA 5ELIA 5MEPB 3L7EA 2W9EL 3OB0H 3RWEA 3B9KB 1G0XA 5IB2B 3KJ4B 1F4HA 4IRSB 4DK3A 4FQCH 5HVFB 3VGAB 2D3VA 3DWTA 4NQEA 4X5XA 1KB9J 5IVZA 5B38A 2V5RA 5HJ3B 5ID1B 2I9TA 3BKJH 3QIWD 4JE4B 4Y4HA 4BQ8A 1BM3L 1JPSH 3P0YL 3MBEB 4KTYA 3OZ9L 4LHQB 1RK1B 4OZFB 4IRZL 1UT9A 1OAKH 1P4BL 2CH8A 1S9YB 3LPFA 3TGXA 1C5CH 4LHUA 1RJYA 2LE9A 5ETUB 5TDOA 3VRIA 5K59F 2OZ4H 5C0BB 2IANE 3FO1B 3E6HB 1M7XA 1H3WM 3KXFE 4P3DA 4R97B 2GIYA 1OSPL 1JF5A 4BELD 1H5BB 3ZKQD 4C56E 4L4TB 5D7IB 1PG7L 5E5MB 3IETA 3MUJA 1YMHA 3QXUA 4Z95L 5BQ7B 3HFML 1CL7H 1W8NA 3D85D 4XH2B 1H3PH 5I1HH 4HUVB 1UWEL 4OZGA 3LKOA 4ZUSB 4KPHH 5D1XC 3QAZC 2Z91A 1JPGA 5I1CH 3TN0B 4JG1H 3QUXA 1ZHKB 4HIXH 1IAOA 3V6OC 4EXPX 1UZ6F 3HC4L 1Q9OA 4AEHL 5IW6B 1LD9B 1BQHG 3P0GB 3PWLA 4JREC 5D1QD 2X4OA 1JVKA 1QR4A 1QSED 4U6VL 4IJ3C 5E8OB 1U91B 1MJ7H 5EO1A 3QO1B 3EGSB 3O8XB 4N0CC 5AEAA 2HA1A 5JW5A 2ZNWA 4LLDB 4OUUB 3N0PB 3MBED 3ROOA 5GGQL 5HYSG 4LPUA 2HTKC 1OM3H 1G0DA 1CZ8H 1D5IH 3MMEB 1DANU 2EZ0D 3T1FA 3AC0A 4Y5VC 3UC0L 2AJVL 1NUFA 2XICA 5I1EH 1BIIB 4P57B 4JB9H 4LSPH 3RIAF 1HIML 4ELMA 4PTUA 4R7DB 3MLSH 2R2EA 3D3VE 1UZ8A 4L8DB 5FGCE 2ESVB 3O2DH 3MRLA 4I13B 4KI1A 3VI4F 3MA9L 1F4WH 1SJEB 1X5FA 5FO9B 1JI1A 5E8OA 3FB6B 2IH1A 1FDLL 3FRPA 3JWOH 3QEUB 5DFVD 3QPXL 5EU6E 2ORBL 4LCWB 1A6UL 2KPNA 4WEUD 4CVXA 4NSKA 1ZHNB 2MHAA 5DFVC 2HJFB 3S35L 5T1MA 1TVHA 1WAAE 2NW2B 3MR9A 1A7RL 4WI5A 2O61A 3P30L 4RIRB 1V7MH 1WGOA 1V3LA 3U30B 4YHLH 2KUTA 4G6JH 3V7MA 4LSUL 4XCFL 5BW7C 1PG7H 1KBGL 5A3ID 4KK5C 2P5EA 4JG0L 3G6DH 4R3SB 4NNXB 4XBPB 4OZFH 4GMSH 2IEPA 2QQQA 1ZSDB 4AIZB 3RAJH 4H1LA 1FNFA 2AAVA 2QQLL 2Z35B 4JKPH 3P4NA 4LOUC 2GK0A 4FABH 4ODUA 3L6FA 4C56A 3UJTH 3DX7B 4JM4H 2OR9L 4RAUB 5IM7B 3KPTA 5M95B 1QQDB 2F5BL 3L5WA 1XZ0A 1OAZH 1JPFA 1VACA 5ITFB 3WCYA 3JV5A 3O3AB 2F9BT 2GSIA 3PWJB 4P4KD 1ZT4B 3D69B 5TDPA 3O3UN 3PWPB 2IQAB 5I73B 4GRLD 2FYYA 3CPLA 4OIBA 1ZMYA 4IIQB 3RWDA 4HX1B 4P23D 3S8WA 4MHHG 2B0SH 4KAQL 2OXHA 2CXKA 1U8IB 4YBLC 4WFFE 1JNLL 4NQDD 1QBLH 1KEMH 4O2CB 4PJDF 4E0RB 1QVOA 3B43A 4J23A 3CFBB 5ALCH 3D85A 4HW6A 2DIAA 4NNPL 4QRUA 1AIFB 2QSQA 5HPMB 5LQBL 1M7DB 5FM5M 1ZHLB 5D8JL 4NQVB 2YD8A 3KAAA 3SQOL 3TFKC 3U1SH 4L8DA 4JDZA 5EUOF 2HP4A 2ZWLT 1CGTA 4F7MB 3TF7C 2FWOB 1X5HA 3Q1SH 4HWEL 4PJ5B 1X5LA 3U36B 3T0ED 5F7DB 2GI7A 3RVXC 4WI6A 4F58H 2VDPH 2PYEB 5GRUL 1OWRM 1A7RH 4HIJB 5F9WC 1GOGA 4RIRA 4P9HH 4Y4HD 1WJ3A 3C6LA 3CDYA 3NCCB 3PL6B 1JUFA 3RVTC 5J1TC 4CN1A 3E2HB 1KJMA 3A6CL 2Q76B 4X99A 5FO7A 4ODWB 3N1PC 2ZSVA 2IQ9L 5E6IB 1PEZA 2EDTA 3RHWK 1LD9A 2WIIB 3MGOA 1L7IH 3VMPA 1J9CT 1JNHB 5EOTA 2AXGB 2FBJL 4PJ5A 3RPKA 1NAKH 3AY4A 1RJCA 4XBGA 5I8CB 3IDMA 4RRPA 1U2CA 3HG1B 2DIJA 4OZGF 1F00I 3O2VH 4YFEA 1A9BB 3FRUB 1BX2B 4X6DE 3T2PA 3PF2A 3VRJB 1ADQA 5M7QA 4H88L 5DC9B 4UOW0 4RMUA 2HMID 2DI7A 4EN3B 5D96C 1I1RA 4F33B 5D6DA 5I1IL 1MWAH 1I8IB 4J1UB 2A9ML 2YEZA 5BMFL 1PQZB 1V3JA 1W2KT 4LOUD 2H45A 1KT2B 5FYJL 5DRNA 2PKDA 3MC0A 3VWKB 1OQXA 1A0QL 1VCAA 2P7TB 2PW1B 2VSCA 2R69H 1KXQE 1L7TL 2W9DL 3DVNB 3P77A 4LPXA 4OGAC 3SDAB 4MD0B 2VN4A 1WT5C 5GIRB 2VISB 4NQXA 4JO4L 5TGBA 1JYWA 2DLIA 2X7LA 4Z78B 1A7QH 2CDGA 2R29H 3RWEB 5ALCL 4P2YA 2FGWH 4MQSB 5IW3A 1B0GA 2VXUH 3BQUD 3V6BR 1GGIH 3D5OF 2ENYA 4Q6IC 1LO3H 3KPQA 3HI5L 3MTRA 1MLBB 3QP3A 3MLUL 5E2WH 1FRGH 1C7TA 4YE4L 2Q7YB 4JHAL 2VXUL 4YHKH 3BP5B 5GZNC 5DD5H 4A6YA 3KLAB 3LKSB 1WCBA 1KJVB 4P2QB 4M7KH 1KF9B 5IQ9A 5CCKL 2P8PB 5DQ9B 2GFBB 5JZ7C 1KPRA 2JIXA 1UWXH 3U4BL 4ZTOL 1I3RA 2QSCH 5GSRA 4JKLA 4DOHB 4APQC 3IDNA 3CVIH 4MS8C 2NW3B 5JR1H 3CDGA 4M3KB 1VFAA 4LKCA 1WAAF 3DLQR 3U46A 2FR4A 2XNAB 4G9FB 4CADB 1A9BA 4YHIB 1QVOB 5JUEL 3WDIA 1GZPA 3RWGB 4LSVL 4YDIH 1CVRA 1J12A 3M1BA 5E94A 2HT4C 3O6FC 3MGTB 3ZYJA 4EI6B 3OSKA 4G6JL 5FECB 3DHJA 4J1UA 2W59A 5FYLL 5D2LF 3HE7D 4P2OC 4TUOA 4JRYE 4FXGA 3LKQB 3GMLA 3VFMA 1XCTA 4S1QL 5IHBA 4OFDA 5F7DA 2W92A 1CDJA 1TPXC 2FIKA 5L9DL 2NY6C 5C0JA 5IB5A 1DJSA 2YD9A 3MJGX 4OI9A 4V1DE 1NBVL 3MOAL 1MCIA 2A0LD 1S7WB 1WBYB 3WNNA 1UM4H 3SN6N 4GG8B 5HHQB 3ZT6A 3RJQB 3I75A 5I1EL 4M6ML 4ELMB 2GCYB 5C9JB 4OFPA 1HDMB 4JRYA 2A83A 4YUEH 2IBBA 3BH8A 1YYML 4WFFD 3BZFB 2VDOH 2VR4A 5EO1B 2A1WL 5EN2A 1MLCA 4JFOB 4P46B 5B3JE 4R0LC 4PYGA 3M8OH 3KNBB 3UPRB 3X12B 2QQKH 1AO7B 5GRYA 2EDBA 4KRLB 4GUPA 4JZOB 4NQCB 4XVTL 2EEAA 3RU8L 3SCMA 3RY6A 4YDJA 1A22B 2NY2B 1LK3H 2JCCA 4X9BA 5D5MF 5LQBH 2JF1A 2BVOB 4YAQA 1I4FA 2APFA 4I3SH 4JG1L 1A1MB 2B7DT 5L7XH 2VXSL 3RZCC 4XBPA 5T5NF 4XMKL 1AI1L 5FUCC 5C0CE 4NNYA 1DQQB 1Q9LA 1XF3B 5IROA 4R26L 3WUWB 4XP6H 3L6FB 4IRZH 3FAXA 5J3HD 1HHKA 5F93C 1QZ1A 3O3BA 3TIDA 1TJIL 1RMFL 5IEHB 1HN1A 4NHCH 2FX9L 5F6IB 4GRLA 2UYLA 4CUCA 3QIBD 1HINH 3L3GB 4OZIB 5EOQL 2RFXA 4M1CD 4JREB 3I9GH 3O4LA 2X1XR 4HJJH 5E9DB 1CE6B 5MI0B 1AE6H 3L5IA 1U93B 4MD0A 4N90E 3HS0B 2ADGB 3P9MA 5IJVB 1RUML 1I7RB 2CGRH 4ELME 4LGPB 1AGBB 1FAIL 3JBG7 1BM3H 1JPSL 5F96L 4PJDA 4EKXA 2VC2H 3O6LL 4TVPE 2GAZA 3SDAD 1OW0C 4OLXL 3GMPB 5J12C 12E8L 1JGLH 1FV1A 1NCNA 1U92A 1T1XB 4I2XA 3KHQA 2BY0A 2BCKB 3BD5A 1A4KA 2AKRA 4NT6B 3DGGA 3ULUD 3WIIL 1S7XA 1X5ZA 2QHRH 2V9QA 4I18C 3DMMB 3G6DL 3W2DL 2I5YH 4KRPD 4RCAA 1LP9E 2FSEA 5ITBH 1OGAD 1KCKA 1IFHH 2DQGH 4MNQD 4TQEH 2VLJD 1CFVH 1C12A 3P30H 4YEFA 2XZQH 4XP5H 3B8SA 2W65A 2BSRA 4RFOL 3VH8G 3PDOA 5LBSL 1OTUC 4JFOA 5GZOD 3NIFE 1NLDL 3STZA 3S88L 4G43B 1YPZB 2RJMA 2R1WA 3CH1A 5EUOB 3MA9H 3DX6A 4UNVA 4GUPB 4JZOA 1S3KH 4X6BB 1OL0A 2FL5A 4LF3A 4G8GB 4Y4FC 1BZ9A 5DURB 4HULB 4FN0A 3OAUL 2J8UE 2VZOA 3IFLH 4E41D 3KYNB 3TN0A 4GQ9L 3FONB 1JHLL 4PRAB 1WUNT 5HXMA 1G7HA 3I2CL 4M8QA 2DBJA 4ODWA 3FN0L 3N06B 1IGML 2IANA 1XF3A 1U6AL 4HV8A 4RGMB 4KKNA 4UU9A 2H6PA 1OM3L 1N2RB 3D6GA 4XB8A 4AL8H 1T7WA 5J8OA 5LXGH 1LE5A 1FIGL 3FKUS 2ZPKL 5EIIA 3LEVL 4NRZA 3BIAX 3GMNA 4IOIB 5DR5H 3QDME 3OJDA 5CZXD 4N0FA 4N8VA 4TRPH 3WDJA 3C5ZB 4KI5D 5ID0B 3O11A 2EO1A 3H3PL 3MNZA 5IFHH 1AQDA 5E08L 1I75A 5TDNB 1MJJB 1CLCA 3MRBA 3BZDA 2ZUQC 3GK8H 5DF0A 5DDHA 1VA9A 5FB8A 3H7LA 4PY7A 4LLAA 3OAUH 2ICES 3MFFA 3V5KB 4NBXB 2E8YA 1E4XH 1UVQB 3MRNA 5H94A 2GAZB 5E8NA 2X4RB 3BFOA 3QI9A 3U0PA 1AR1D 3UTQA 4KZDL 4HK3J 3RHWF 4LCUA 1O7SA 5FKPA 4MAYA 3ILPB 4XPFL 3BN3B 1QPXA 4XAKE 3LRHA 5LBSH 4I5BA 3ZT7A 4FHBD 3MNVA 5I8CA 4ZODA 3G5ZA 4XWGL 3D3VB 1NCBH 2UZIH 3H6JA 4DFIA 3QXAB 4M61A 3LKRA 2BJML 3IF1A 1Y6MR 1YEFH 43CAA 4F7PA 1NQBA 4NWTL 1Q72H 3SO3B 3U30C 3V0VB 3HB3D 4JRYD 1MI5A 3QWOA 4QRTA 1ZE3C 2EYRB 4QHLA 2HFTA 3O0RH 1RUAL 3QUYB 2DQIL 2BY2A 1G6RL 1KIRB 4RGMC 4HG4K 1UA6H 3VW3H 4DGYL 5KW9H 4LLQB 3NMEA 4RGNE 2YK1L 5BO1H 3UDWA 1AXSB 5DJZA 1LO5B 4JO2H 1R3LA 3L3KA 4I4WB 1IQDA 3L7FA 1NGZB 1A6AB 3BKCL 4HS6B 5IMOA 3V95A 3U0WL 4P48A 1JF6A 3K0WA 4A6YB 4PJCB 4GBXD 4HKBA 4YDVA 4PUBL 3SCMD 3MV7E 2VQ1B 1NCCL 4LP4A 4OT1H 4LVOC 4R8WL 5FA4A 3FMGH 2X4QB 3ZSTA 1UENA 1RHHB 1HHHB 2P8LA 1S3KL 4JFEA 4ODVL 1AGFA 1ZK9A 4HV8B 4DUVA 4JN2A 5SX5H 4MHHI 3WJLA 1U93A 3BDYH 4JFYA 4HS3A 1U0QA 4K94L 1Q1JH 5ERWA 3I50H 2F5BH 3S97C 1A1NA 3B3IB 5JA9A 5AZEL 4S2SA 3RUGB 1RULL 3RWJA 5LGJA 5C09D 1H8OA 4D0CB 5D7IA 4PJ9A 5GZOC 5DVLA 2LU4A 4Z7WB 4JPWH 3IJSB 1I9IL 5IQ7H 1MJJA 3QEQB 3T2NH 5A3IC 5HHME 5IG7B 1U92B 2VDRH 1S7RA 3H0TA 4XCEB 1G7LB 3DNKA 5FUOH 4PS4L 5BV7B 2Y25A 4M7ZC 1OGAA 3PGCB 4LRNH 3AB0C 4PJFF 3GMRA 3LSOB 4OM0H 1CXLA 3QXDA 4K2UH 4TVPL 3RKPA 2YXMA 3DTXA 3L3JB 4S1DC 4K8RD 1NFIB 1AHWB 1MHPL 5ANMA 4NBYB 3QI9B 3U0PB 5JPMB 5GGUB 1N5AA 5ILTH 3QCUH 5HYFA 2VXVL 3MUGB 4WW1A 3PV7A 5HI5D 1QRNB 2FEEL 3S37X 1NBYA 5KS9B 1CLOL 3WS6A 1H8SA 5DVOA 2J8UF 1LDSA 1FG2B 4ZD3L 5F3HB 1HI6B 3DYOA 3K1KC 2PTTA 3V79C 2ZOLA 4Z76B 1A47A 4PJ9B 3WDHA 5F1SA 5IB3A 3EDJA 2YC1B 3ARWA 1WC7A 4L29B 3DX6B 4ZS6D 4EDXA 4LU5L 1TTUA 1DQLL 4N90D 5ID1A 4PY8J 3CVHA 3QDGD 2G9HB 2NY6D 1EHXA 4I18A 1PSKL 4MD5B 3I75B 3V7AG 2R56L 3U48A 3GB7B 5TFSH 5E4EB 5KVGH 1HHIA 3UO1H 5KSAB 1P9MA 4KZEL 1EFXD 3A0OA 4FFZH 4DTGH 4EVNB 4NN5B 2MSPA 1WAAA 5C3TA 1C5BH 3WKML 2D03L 4WO4B 1IQDB 3KYOA 3L7FB 5EIIB 3QT2A 5JQ6H 5EU6A 4BM7A 3TBWB 4BKLB 3ULUE 3SDCC 1CD9B 4HKBB 4DCQA 5I8OL 2ZOLB 3WFHB 3J8F7 4PG2C 1IJ9A 3D9AH 1OGAE 5F7FA 5D1ZC 1FFNA 4MNQE 2VLJE 4XTRC 4J3WA 2DM4A 3MLZL 1RY7B 3HCVB 3NCMA 1KELL 5E56A 5GGVL 5GQBA 2PR4L 2GHWB 5IWLA 5EA0L 3JSSA 4JFXB 4RFEB 1Y6KR 1F58L 2NY1C 2VDML 1EBAA 2HKHL 2GCYA 2BXYA 4OLEA 1EIBA 4ZFGH 3SDDA 4WV1C 1T22B 4ODSL 4EVNA 3NIGF 4QRQA 1WSST 3D1MC 2ADFL 1OT1A 4NC1C 5IG7A 1UM5L 3RPIA 1KCVH 4P46A 3L5WB 2DBLH 4Y19E 4JO1L 4KKAD 4RAVB 4HGMA 5DUBB 1DQML 1RK1A 4OZFA 2A6IB 5MEQA 3VXUA 3MOAH 3U0TB 4NZRL 2IG2H 3ARPA 4G5ZH 2FJGB 5J9PA 1U2HA 5DJAA 2ADGA 2EC9T 3P9MB 4OM1L 3AUVA 4OZGE 3QDMD 1IT9H 1NUGA 4CU8A 5ADPL 3INUH 3VXUD 3FL7A 4HWZB 4MNQB 4LLYA 3GIZL 4KI5E 4OGXL 4RA3A 3GSNL 3SY0B 4HJGA 1T22A 2EICA 5BVPH 1CWVA 3MRMA 2IGFL 2EDWA 3G04B 5BQ7A 5C6TL 2QHLA 4ENEC 1JZ7A 4PGDB 3QUZA 2NY0D 3EBAA 3H3BC 4DVRL 1NGWB 4M4RA 1JYXA 5JW4M 3QUXB 4R4BB 1I1AD 1QHOA 1JN6B 2DM3A 4KDVA 3OR6A 5F1KC 4JVUA 4UB0L 2VDNH 4YIQB 1MAJA 5I1JL 2XG4A 3QRFM 1GXEA 4OLUL 2NZ9C 1P84K 3CSBA 2NY1B 3LS5H 5CJQL 7FABH 3IDNB 3F5WA 1A1NB 1MELA 5F9JB 4BZ2H 4OBRA 2CGRL 4D9QE 4KJPC 3SY0A 2ICEB 4NQEE 5F7HA 5E5UB 5CP7A 25C8H 3NPSC 3FB7A 4QOKA 1D9KB 2R0ZL 1EA9C 5C09B 3ULVL 1U8QB 4LGSB 4QWWC 2I26N 3HPJB 4R6UA 1HINL 4HEPG 1SBSL 3HRPA 1VENA 4FQHA 4XI5C 4LVHC 2FX9H 2FSEB 4R96A 4X6DF 2W0PA 5C92A 3WXWH 5FFLA 4YHPB 3MXVH 5L8KB 5ETUA 5HDOA 5TDOB 3VRIB 4R97C 3EZ8A 5KOMC 3OKOA 2DQJL 3PDOB 4M6NH 1NANI 5FOBB 4Y2DC 5D1QB 2VXSH 4HFWA 1JGUL 5J1SC 4U0RB 2J8OA 4JPIB 1NFDF 2R1YB 1N8ZA 4GMTL 3BPNB 4G8IB 5KOVC 4MYWB 4F8QA 5F7EL 4Z7UF 3FRUA 4LF3B 4PJAF 4KK8C 1MVFA 3MGAA 3BAEL 5DEFB 1EUUA 3H3KA 2I9LA 3O9WA 3OR7B 3TJHD 3A6CH 1F6LL 3QUMH 2Z91B 4PV9B 2AW2A 3KLHD 3ARZA 2EDLA 3ARUA 3BESR 4BSWA 5KJRL 4IEFB 1EGJH 2Z35A 4DKFL 1AP2A 1YJDH 1KXTB 2FHCA 4X7DC 3QUZB 4G6AC 5I1IH 1FZJB 4M6MH 2MOVA 3B9EA 4KRPC 3G5XA 4MB3A 4MNGE 1DBJH 4IOFD 2VZSA 4FFZL 4MMXC 3ARSA 5EBGA 4OV6F 1ZS8A 4M1DH 4OD3L 2FO4A 4FQIH 4NNPH 3FOLA 4GRMB 4HHAA 4MA1B 1S9WB 1EZVY 3E3QE 2OJZL 5BVJB 4KDTC 1RFDL 4ZYKB 5F9JA 4J6RL 1WBXB 1A3RL 1B0WA 1DQLH 1UZ8B 2CKBL 3L95A 1EGJA 1BEYL 1FNHA 1HEZB 2A0LC 2GUOA 4Y5XC 3SGEI 1NMAH 3E6FB 3OKMB 4X7CC 4QHKJ 1WVZA 3T2QA 3MLRH 4I5BB 3WFDL 3HR5B 2P5ED 3LQAC 3RVXD 3LKNA 3WD5L 1HXMB 1FG9C 3H2WA 4QRUB 3UTSA 2VQ1A 5CSBA 1A8JH 2PNDA 3GSRA 4OLZH 5CEXA 4KROB 1I7UB 1ONQA 1QFWH 2P8PA 3AU1A 1QUNA 4F7CA 4TSAH 5T5NG 1Z9OA 2IMMA 2VDQH 3NZHL 3VXMA 3AB0B 1UKQA 4D9LH 2EH8H 4LQFH 3VD4A 5D9SA 4JKWA 2VDNL 3ILQD 3UJJH 1UJ3C 2KQMA 1I1FB 4S10A 3EYFB 4DZBA 4Q9RL 3WIHL 2N4IA 4G9DB 1S78C 3T3PE 1KT2A 4UT9L 3JZ7A 4U1LA 3ROLA 3WFBH 4MXWL 1S7XB 2CRZA 1T2QH 2AEPL 4MA1C 3X3FH 1QG3A 1R3KA 1T0NB 3VH8A 3WNKA 1Z3GH 3HUJA 3D2UB 1S9YA 2DM7A 1KGCE 2JLLA 4Y5YA 2P43B 2F8XC 3F12B 2A6DB 5DEGB 5L88L 4L3AA 1FL3A 1JYNA 4UBDD 5F97E 5I8KL 1YEEL 3CPLB 3FB8A 5I2IB 4X9IA 4Y19D 4PJBF 2ESVE 2OX5A 3BKCH 4B53A 5F7LB 5HVGB 4JZJB 5DLMH 4I0PD 4X5WB 4N9GB 1T0PB 2VJXA 4L29A 1ZLSH 4P5KB 4JY6B 4P4KA 1FFRA 2Q7YA 2XWTB 3LRGA 3TM6A 4PREB 3O45A 4WFHD 5JPNB 1UM5H 3Q6FB 5CEZH 1HH9A 3U7YH 4PV8A 3CFJB 4K3GA 3RNQA 4WCYH 3WNPA 3VXUE 1H8NA 2VL5B 4ZS6C 5GHWH 3OGOE 2V2WA 3CFIC 5F7MC 4MA8L 4N0RA 3EOBA 2HLFC 2IMNA 1Q72L 2HWZL 5IBLD 1A6TB 2DQDH 3UBXB 4M9PA 1MRDL 1BVZA 4XNYH 5FGBA 2ZKHL 2FDBP 2EE2A 5EZIL 1FG2A 2Z0BA 5IMMB 1A7OL 3DUUB 3TJEL 2WMPA 4MAUH 1JE6A 3BEWA 3NCEB 3Q0HA 4OIAA 4OQ1A 1QLEH 4LHUD 5JIPA 4AH2A 3GSWB 2X1WL 1E4WL 2OCFD 4YNYA 4R2GD 2I24N 3VWJB 4JEGB 5GIRA 4HGWA 1KJMB 2CUHA 3QIWA 5B39A 1I1CA 3BAEH 4L4TE 3L5HA 1XCQB 2AV7B 4YDKL 1I9JL 2EDHA 4PLJD 1OP9A 1MJUH 4WENB 1TQBB 3DYPA 4DZBB 3KXFB 1A64A 1MFCL 5C0AB 4PLJC 1FORL 1HKFA 4PJHF 2WWKO 2BOBA 4LEXH 1CDBA 4P5MB 2UWEB 4EI5B 3WJJA 1C5CL 3GSOB 5E9DA 5I30L 3O9WC 3MXVL 3IFNL 1C16B 1GSMA 5F9OH 1I3RB 1CXFA 3OZ9H 3CAFA 3GBMH 5DK2A 1FL6B 4G6FD 5DJAB 2CD0A 4LASH 2OMBA 3I2CH 5ACLA 2XZAH 2MQCA 4LLWB 4U6YA 5KTEL 3PP3H 5GPRA 4UINL 3QHZH 2UZXB 3LD8C 3Q1SL 3OKEA 2HAZA 2WP3O 4L1HA 2F8VA 4DKAA 2EDEA 3LQZA 4PLOB 1AXSA 1N3NB 5FYLE 2G60L 4LIQE 1YDPA 2HH0H 4WY7L 2DDQH 1MLCB 4QTIL 4HIXL 2XWJA 4I77L 5L2KB 5JA8B 5JHLL 3AM8C 1T6WA 2B2XL 2X42A 1R5IB 4U6TA 3VXRD 4D8PB 4NN5C 4JPWL 2D7MA 4N1EA 3PABA 3MO1B 5D4QA 4L9LB 5IJKC 5IV2B 1NGPH 2O5ZH 5JXEA 3C87A 1J1PH 2X6MA 1P7KA 4OCYH 2I5YL 3OL2A 4UNTA 2Q8BL 2NTSP 1A1MA 4YR6A 4LLVB 2J7LA 3HNVL 4X7FC 1DQDL 3S36L 2ZCKH 3EKCA 2DYPD 3QFJA 4JFDA 3SO3C 2FL5B 4X6DA 4KRNA 1RUKL 3R06B 4ODTH 3PGCA 5DJ6B 2DYPA 3LHPL 1PZUB 4OM1H 4ONGL 1M7IB 4NM4H 4HUUB 1MHHA 1OW0A 4QHMB 1MCHA 4NZRH 3QZWG 2HRPL 1JIBA 4W4OC 4PFEA 1IEHA 3BZFA 2BVQA 1MCWW 5CSZB 3WFDH 3F5WB 3RNKA 4P5TC 3VWJD 1JHKL 1QR1B 2HFGH 1YC8A 3OPZL 2FIRT 4J8RB 1MRFH 1RVFL 4YDKH 3KLSA 4BK5A 3FB7B 1ED3B 1EHAA 5LWYH 1YUHA 3C6LB 1QLRA 4P4KB 2XA8L 5GZND 3B2UD 5EUOE 4LCWD 2QQNH 3QDJE 3WLWD 4P9HC 43C9A 3BGMB 1MHCA 2BHZA 3QG7L 3WKNA 2H1PH 3GI8H 5A43C 4Q0XL 1EO7A 1T7VA 3UMTA 1LK3L 4OFYD 4MXVE 4Y5YC 3T65A 5GS0L 4XVTH 4QY8A 5JHDB 5SWSA 1FNAA 1HHKB 3X17A 2XACC 3ZKND 1DLHA 4TNVK 1OVZA 2XTLA 4MD4A 4KC3B 3FQXA 5C2BH 3DUUA 3Q5TA 4YC2B 2Z93A 3MQIA 3DO3A 3OQ3B 4PJAE 4PGBB 1BGXL 2FLBT 1T6VN 4NP4L 1H3UA 3MLPA 3PNWA 1ADQL 2CLRA 4QOKE 4WHCA 3ZTNL 2DQCH 4NQTA 3O6FD 1TMCB 1FPTL 4HPOL 5MENB 1HHJB 1RZIB 3HNTL 1A6VH 3ARFD 3MYJA 5DZNA 3MSPA 3P4MB 2BXZA 3T65B 3CSYA 3BO8B 4FTVE 4GMTH 5DI8A 5F44A 4TYUA 1AD0A 5I15H 3QEUA 2MJWA 3HC4H 2WBJD 4PGCB 3KPSA 3L5XL 1EX0A 3G08B 3IS1X 4RRPG 4WFHE 4WUKH 5DRNB 3T0EA 3AS3A 4RAVA 1QRNE 2Z8VC 4GLRH 2WWKT 2DI8A 4FG6D 4HUUA 1ODAA 2IF7A 2H3NA 5TDNA 4NN6B 2EIZA 3LZFL 2DKUA 3P4OA 3QDJA 4CRPA 1ORSB 1OLLA 4ZFZA 3K81A 4BQ9A 1GYAA 5ERWB 4LMQE 2CDGB 4NJ9L 2VZ1A 3V4PL 3F6LA 1HQ4A 3RGVC 3FFCB 3ECBA 1PVHA 5FHAH 4PLKC 4DUXA 2GITA 4JO3L 2B20A 2EH8L 3EYFA 1YNLL 2V17H 4B50A 1XGQA 3RUGE 1XIWB 4FFYL 5JIIA 3RKDD 5CJQH 4HWUA 3VE0B 4CAGA 1AC0A 3T0EB 3D85B 3ZKMD 3L3GA 2Y72A 5EO0B 1HHGB 5HHPA 2ZNXA 4K3DH 5L8JB 4AENB 2DLHA 1LK2A 5DK0B 3L3IB 5LCVH 3IDXL 1BFVH 2BNRB 1EJOL 1OT2A 2FLRT 2VAJA 1HCFX 1MPAH 2W07A 4YPJA 1YYLL 3PJSA 1I8MB 1UWGL 5F96H 4K8RH 1FHGA 3RWIB 5GGTH 3TA3D 3N85L 2W9EH 5TF1L 2IGFH 1CGVA 1F6FB 2BK8A 2CKBH 3E8UH 3BE1L 3IS0X 4HJJL 5DUMH 4NO0D 2PXYC 3VD5A 2NR6D 5EOQH 2VZUA 5KW9L 4I4WA 3KR3H 1RZ7H 3I02B 4D3CL 3ZDXE 4PY7B 3RY5A 5J6GA 2G5BB 4PJFA 1VFBA 2CRMA 3TV3H 4NO3A 1TZIB 4R4ND 1ZLUH 3ZTJG 2EDRA 3MLXL 2P24B 4QO1A 1MHHB 1T21B 2VAAA 5FYKH 5CD3A 2FEDD 2XKSA 4YPGA 3ALPA 4NWTH 3TT1L 3IKCB 1E27B 2DQEH 1J0HA 2BC4B 3R8QA 2G75A 3D48R 3EOAA 3L3DB 3RI5K 1S7QA 3AS1A 2IPTL 1ZLVH 4NYLA 4S2SB 4B0MM 2DAVA 4NCDA 4LLDA 3U4EA 1HOCA 4HCRA 4NKQB 4XPFH 3IDMB 1YPZA 3C5SB 4WI3A 4Z7UB 5ICZA 4ZAKC 2XI9A 5GXBB 3LCYA 4OD1L 2QQKL 2BFVH 2YRPA 3WJLC 1CFBA 4H5SA 1F58H 3HMWH 1HYSD 2I9TB 2WQ8A 3VI3F 2Q86A 1IC7L 4O2FA 1ZT7A 1M6OB 1RHFA 1HNGA 3C8KB 5GRVK 3CCHA 1YC7A 1E4XI 3FQWB 1MCPH 1DSFH 4YGAB 4ODBD 5IW1A 4ZXBC 1F4YH 5CD3B 1Z3GL 4PJ5E 1CICC 4KK6D 5DJZB 4BQCA 1QYGH 1A7NH 3FT4A 4WO4C 2CKNA 4RWHA 3TWCH 1Z0NA 5DRWA 4HPOH 1OF2B 5IKCB 2P8MA 1YN6B 3RA7H 1FN4A 5EIQA 3VXUB 3UJJL 1WC7B 5TE7H 1CFNA 4Y2DD 1F3JA 1SBSH 4NRYB 3GUTA 3TNNA 2D31B 1EEZB 1F2QA 5C2BL 5I18H 4I18B 3A6BH 4R90H 1XIWD 1IMHC 4V1DA 2ED9A 1NGQH 5DJ2A 3T4AB 2HTLC 3IJYB 5IB2A 4CVUA 4LCCC 4NN7C 4HWZA 3QFDB 3H9ZA 1G0YR 5KSAA 1SBBA 3SE4A 2EIBA 3P4NB 1UXSA 4PJAA 4AIOA 1J0YA 5DMYA 3KYKL 5HDQH 3D39E 3LB6C 4QF1A 3QUMA 3FRPG 1E4KA 3GHEL 2GJ6E 3I6GB 3NTCH 5D7JB 3LV3B 3CFDA 2H1PL 4LCWE 3G08A 3RWFB 3GSQB 4ODHL 4CDGC 1WWCA 1D6VH 3B4NA 3DSFL 3NCBB 4QHUB 1UEMA 1P84J 3OR6B 1BEYH 3W9DA 4MDJB 1YNKH 5IBLC 3BGFC 3LY6A 5JDSA 4WV1A 1JV5A 5F71A 3Q5OA 4QRRE 1RJYB 5DT1L 4EUPG 1CFNB 4L5FL 3GSXA 4PRDA 2NX5D 2P4AB 3VDCA 1J05B 4JFHD 4JQIL 2PN5A 2V5TA 4O2EB 1UYWL 4N9OB 4M1DL 5FM4A 3U4BH 2Y5TA 4FQ2H 3MRCA 1OCWH 3G5YA 1A7BA 1U8JB 5FEBA 3MRIB 4G6ML 4R2GC 1U3HA 4OLXH 1G9NC 1MQ8A 3VRLF 5C0BD 5IBUG 1V7NL 1RZJH 4QOKD 3MRQA 1X6LA 3I50L 4KXZH 2HJKA 3QJHA 5GS2D 2LAGB 1FRGL 2EXYD 3QIWC 2A6IA 4PRHD 4G6KL 1P7QD 3DOSA 1NMBL 3QHFH 1S9VB 4U2ZA 5DMIH 3S37L 3VFOA 1KTDA 3HTLX 2DQUH 3GSXB 2V6HA 4XRCB 1DQDH 1WZKA 4JY4B 3S36H 5FGCB 1YMMA 3VG0H 4EI5C 3QO1A 1URLA 3D39A 1ZGLP 2XTJD 4LLVA 1JNNL 1FFPA 2Q8BH 5TE4H 1DTUA 3I84A 1QRND 4KQ4L 3JWDH 3QCTH 1TJIH 3WS3B 5IB5B 1MCCA 1ZLVK 1X7QA 2DWEA 4KUZL 1YECL 1TETL 4G6MH 2CIKB 1NC4B 4W6YB 4PREA 4QT5A 5I1KL 2HJKB 3QJHB 4GAJL 4HXAH 3TCLA 4NO3B 3W5NA 1G7HB 3JTTB 1DQJA 2R2BA 2P24A 4N0UE 4K71B 4PJ7F 1TITA 2YN3A 5FECA 4DGVH 3C9NA 4YHLL 3QUXD 5FDYA 4D0BB 3FO2A 1T04B 3Q6GH 2UZIL 3MRPA 3ARXA 3UBXA 2BNUA 1NBYB 2DLEA 3LDBC 3RZCB 4WWID 3H9SE 2GQHA 5CLTA 2XZAL 2IJ0C 2X89D 5E99L 3RVUD 4LASL 1TDQA 3UPRA 4MJ6B 3IDUA 4P46D 1YMHB 1JZ2A 4G8FB 4KK9C 4Y16D 4HLJA 4YNYB 3HRZA 3SCMB 3HZYA 3MRFB 1KC5L 2RCSL 1KJ2A 5BVJA 1JZ8A 2HT3C 3EIFA 4YFDB 1V3MA 1K9TA 1R3IH 3WNOA 4OZ4B 4MXVF 4GXVH 4QCIA 4KVCL 5C9JA 5B21A 1D5XA 2OP4L 4J7RA 1N59A 5HVWA 3C8DA 1MJ8H 4F7MA 2ZOKB 5F70A 2K7QA 5F8QC 2VLKB 4KH2A 4YO0B 4GW4B 5EUKA 5K33A 4YHOH 2GTWA 4DN4H 4HLZG 3C09B 1VEMA 4KTEH 3KPRE 1J8HB 1GGUA 3FCTA 3QCUL 3N50A 1A6WH 1A7NL 4UMGA 5HYSB 4N8PA 4KUCF 5IBTH 2VDPL 3ZHDA 1EJ6A 2DLFL 3GI9H 4NCC2 2ZZUT 1RURL 1K4DB 1EHLL 5ALBH 4PS4H 1EDQA 3GGWB 3BZ4B 5FKAB 3EYVA 3DIFA 4GAJH 4PTUB 1CU4L 2IG2L 1T80A 4PJIB 4XWOD 3R0NA 4M1CC 5IFAH 4QRRA 1E6JL 2XQBH 4KUZH 2D7TH 3X11B 1JZ5A 1B4JH 2DBLL 4IMKC 1QBMH 2MCPH 4HUWB 4PP1D 1HK6A 1D6EB 3CC5B 4WUUB 2P1YA 1X5YA 5DMGD 1ZKAA 3OGCA 2VOTA 5CZXC 1K3IA 1XGRA 4YHPA 4CU6A 2BMKB 4MA3A 5K93A 2BNRA 1ND0A 4OT1L 4X6FB 3KPLB 4PGJA 3GJFK 3HAEG 3LS4L 2VYRE 2V2XA 1B88A 3FB8B 5I2IA 1X5IA 1EO8H 1TTGA 4WFGD 4JM2B 4LAQH 2HVKB 1CF8L 1I8IA 2ZSWA 5I66B 4QEGA 3GNML 1SM3H 3WUWG 3ZDYE 3OX8B 1GC1H 4GOSA 1JGEB 1FVCA 2BSTA 4ALAL 3TBSB 1Q0XH 3TA3C 3DYMA 3M1BB 5E94B 4ZOBA 4P57A 4PV8B 1C5BL 2R1XA 4M7JL 4WI9A 1IEAB 1KIPB 3V4VL 4H8WL 4YHYC 5E1AB 4MNGB 4IRJB 4JKKA 4Q9QL 4W81A 5D7IF 3D39D 2HFFB 3CVHL 4APQD 4O02H 5JW3H 4JANA 4MQ7A 4K3DL 4OKDA 1XGPB 1OAXH 2WM0A 3BPLC 1SJXA 2XKNA 1X5GA 4XNQA 4ZUVA 1ROWA 4ODHH 4L4JA 3WN5B 2JTDA 3NPSB 1DLFH 1ZA3B 1EZVX 3MROA 4KZDH 4OCSH 2XPGB 4AH2B 4K3JH 3BN9C 2YS4A 5ESAB 4NO5A 2AVGA 4OF3A 1BZ9B 2Y9RT 3WFCL 2NX5E 5EB9A 2A77H 4AM0A 1A1OA 5C86A 3W39B 4QXUL 1EK3A 5HHQA 1AFVH 3KLAA 3DVFA 1LEKA 2BVTA 1UZ6E 3HUJB 3ARDA 4HZAA 4IRJA 5JHDA 3LZFH 4FQLH 2X2YA 2NZ9D 4U1NB 4HC1H 5HTSA 1CFTB 5C0BE 1LQSR 1PQZA 3GJEB 3WLBA 1ZA6B 3HNSH 1FZMA 2NQCA 1F11A 3BP4B 5GS2H 3D0VA 5LXGL 2DI9A 4WEBL 3D3VA 3OF6D 1BQUA 3T2NL 2Q1EA 3NA9L 3K4ZA 2ZG1A 4PRHE 3RZCD 5IQ7L 3SKOA 4K3EH 5CJOL 5GGRA 1S9KC 2CK0H 2VE6A 1CCZA 2VIRA 3FN0H 5DEFA 3KPMA 5E70A 2AK4A 3ULSA 1JHLH 1QFWI 3UJIL 1KJ2B 4XI5D 3DVGA 4DQOH 4U1HB 4P46C 3X14B 3WE6B 5JXED 1FZKB 3EJZC 3V4UH 1S7TA 5I8EA 3HE7B 2GTZA 5C08E 3VXSD 4XP9H 1CS6A 4KUCD 3FT3B 3ZE0E 3LQMA 1FYTE 4P99A 3MZTA 5D7LE 3T3ME 4TTDC 4HS8H 1FVCB 4HC1A 4F15B 1BJ1J 4LLUB 4YHZH 4K9EL 2A74A 2OL3B 4JDVA 2R1XB 1H3PL 1CFVL 1LP9A 5E5RB 4L4VE 2GT9A 2GFBA 4JDTH 1BX2A 4HXBL 3FOLB 2GJZB 3CLEH 4JANB 2OMNA 1UADC 5FGBC 3L3HA 4XHJC 5JUEH 1BZQK 1WIOA 4NDMA 5HD8D 5J3HC 4DVBA 1WV7T 3G5YB 4DKDC 1QBLL 1WWWX 3IDJA 5D71H 4NZTH 4ZUUA 1F3RB 3PQYD 5DUML 5CBEA 4G9FA 4CADA 3IJHA 3KXFA 4GAFB 2YMXH 4QHNB 4NFBA 4JVPA 2XXMB 2A74B 5F9AC 3VFRB 1H3VA 4KRPB 1RZFL 2X4QA 4UDUA 4NRXB 7CGTA 3O4OC 5GGUA 3WS6C 3EFFB 3VFOB 3R8BB 3W11D 2YSSA 3C6LC 3PHOA 5T3XD 1L4IA 2C7UA 4C57C 5CSZA 2ENSA 2MPAH 4D2NA 1XCTB 3OBAA 1S5IH 1T5WA 3KPRD 5DJDA 5E2UH 1XF4B 1GH7A 1CT8A 5MENE 5IHUH 4MSWA 3VFSA 1U8JA 1VGEH 2BNQD 3SKOB 3KS0J 2DKMA 1U3HB 3U2SB 4G8GD 4WEMB 4G42A 3LH2H 3TVMC 1OAYH 1DBAH 4G8EA 4HIIB 4FZ8L 4UV7L 1IC1A 2AJZB 4NUJA 4JO4H 4YLQT 1D5MB 1PBYA 3GIVB 1GPOH 1MY7A 2PW2B 3LEXA 1DUYB 5IQ9B 4Z7VE 3C9NB 4N1CA 2YD2A 4UU9B 3FHQA 3MREA 2P42B 3BWAA 1JHTB 3NA4A 3CDCA 5T3XL 3OHXA 5KVDH 4PBWD 4MJ5B 4U1SA 1YN7B 2QTEA 4Z7NE 5L0QB 3V52H 3S35H 1W8OA 3MRJB 4Z8FL 2NLJB 4DCQB 2KH2B 4APQB 1BBDH 1WISA 4EOWH 4HZLB 3ZE2F 1X7QB 2DWEB 2VLRE 1BFSA 3FT2A 3CLFH 5EPMB 4NC2B 2ZJSH 5F8RC 1BP3B 5FB8B 3HZYB 1DQTA 1BLNA 2EDJA 4H88H 3C5ZC 3L3OB 5KS9F 1MSPA 4WFGE 1RZIA 3JTTA 1KJ3H 4TULL 3SGEH 3LEXB 5D7KE 5CSGA 2J6EL 1M1SA 5E6ID 5F9OL 4AIXA 1II4E 2XN9B 3IJHB 5MHSE 3M45A 1D7FA 4MQXC 1ETZB 5D2NB 4Y4KA 4KI5C 3TBTB 1OF2A 3CDFA 1GOHA 4IRSD 1LEGA 1OSZA 2ED8A 4HC1L 1Y18B 5DD0H 3NACH 3MCLL 5DD1L 4BH7A 3QNYA 4RGOH 5IHUL 2ZUTA 5EWIH 1AJ7H 5E2UL 4HFUL 5L2JB 1NAMB 5BZWB 5I8OH 4ORGA 5TE6L 4Y5VA 4F57H 4X5LA 1ZANH 1UWGH 4LKCB 3EO1A 1AE6L 5ESQB 1YY8A 2MWCA 3MRLB 2D9QB 3W0WE 4Z95H 1IKFH 5DTFB 5KSUA 4C56B 4NQCD 1K2DB 4P5TD 1IGIL 3GMNB 4PR5A 4X4XA 5DHVA 4NUGH 4BK4A 3U1SL 4LLMA 3ZZ1A 3OG4B 4Y88A 3TBVB 2R4RH 2JK5A 4JFYB 1CD0A 5FM5O 5FM8A 1S9XA 3BUYB 2ATKA 1WLHA 4JPKH 3EUUA 4QRPE 1OPGL 3BZ4A 5CEZL 4NIKB 2NCMA 4IS6A 3ARQA 3ZDYF 4ODUB 4WFEE 5CINL 3HAEH 5HI4C 3PDGA 1A7PH 4ZDHA 1BVKA 1FNGA 3FFCD 3TPUB 2FEEI 1CBVH 2VWEE 3HE6A 3KPOA 5J11C 4K2UL 3JVGA 3LSOA 4S1SH 2W0KA 2XIDA 4OCRL 3SDYL 1AXIB 4ZUTA 4NKOA 1U8HB 2Q8AL 3BJLA 5C08D 3IFOB 5LVEA 1RZKC 2COQA 2LVEA 1BOGB 1REIA 3BPCB 4ORZC 5DYOA 2I60H 2GSGA 4GKNB 1LE5B 3AFLA 5DA0B 5BS0E 1I7RA 4I48B 3VD9A 1WFTA 4JJHA 1IBGL 3RP1A 3FOMB 4U31A 1MCRA 1IM9A 2L7UA 2YC1A 4Z7UA 4ACPA 1O0VA 2VXTL 1FAKT 2QQLH 1RIUL 3MRBB 2FX7L 3PNWB 1K8DB 1FNGB 1WEJL 4OLYH 1JPTL 5J1AA 4N5ED 3QQ9D 5IB4A 4S1DD 4ORGB 4PJCA 4YDVB 3B6SB 2XRAH 4HWBL 4LPVA 1B0RA 3U0WH 3GIVA 1T5XB 1UVQA 1YNTA 1FO0L 1NGYA 1SMAA 1XF1A 1CGWA 4TSAL 3MODL 3PQYE 5SX4I 1NAMH 3QDMB 2LTQB 5DHXB 1QSFA 2PXYA 2ED7A 3LDBB 4LSDA 3EJJX 1MAMH 1KXVC 3RGHA 2AXGA 4YHOL 4JM2F 1DUZA 2X4UB 3DRTB 1J11A 1T3FA 5TQ2H 3O8XA 1FDLH 3W9EA 3RUGA 1OAUH 4XZUA 1KFAL 2B5IC 3KDMA 4UDTB 5FUZL 5DQJB 3IJSA 6FABH 3DUSA 3MJ8B 4YXHL 4HD9A 5LWYL 3BVNA 2JB5H 4X4YB 2Z9TA 1FGNH 2BHUA 2CDFA 2VE6B 1UACL 1YUHB 1I1YA 1O7VA 1KG0A 4W6XB 1P2CB 4XWGH 2Z31C 3L3OA 4PJXF 4B7LA 2Y6SD 1J1OH 2DIBA 2JKXA 1EAPB 5FF6B 4F33A 3HE7A 4NQXB 2WWMC 4ZPTA 3EYOA 1U41A 3V4VH 1I7ZA 1A3QA 4C83A 1LO5A 4Q9CA 1DBJL 4OGZA 4WHTA 5GJTH 4Z0XB 5DD5L 5E2VL 3GSVA 5KSVB 1NGZA 2PETA 3TJEH 4NPYA 2WUCL 5CMAA 2EDQA 1CLYL 4UT6H 3UXFA 1H0DA 5E2WL 1Y18A 3UBXG 3NFNA 3KPPB 4U1JB 3KVQA 1DN0A 4BH7B 5LJYH 3ES6A 5D8JH 1QOKA 3ARGA 3STLB 2YR3A 3TO2A 1CGYA 1N4XH 1RJLA 2RHEA 1C12B 5J9PB 5EU4A 1IQWL 3VXQA 5A40E 5CJXA 2OZ4A 1N7MH 4YBQC 2R0WL 4Y4FA 3S3JA 3ULVC 4HXBH 5DMJB 5FF6A 2H9GB 2XTJC 2W91A 3DV6B 2ZPKH 1Q9LB 3HG1D 1FNSH 4DJMA 4GAGH 4Y16B 4IDLA 1HEZA 5I16B 2R69L 4HF5L 1P7HL 3CZFA 3A67L 4GG6E 3SQBA 3VXOB 2M1KA 4XNMB 1A3LH 2AXHA 3QNXA 4BA8A 1W0WA 3EO9L 5FYJH 1J1XL 5J89A 1U3YA 4CN4A 4BSVB 4FQXC 2RFXB 1DBMH 2DQUL 3UPCA 5HGAB 4P2QA 2DQJH 4M00A 5DFWH 5CGYD 4KY1H 1HYSC 4KJPD 5CP3A 1ORSA 2H32H 3HCVA 5MHSD 4P59H 4BFGA 3IDYC 3X3FL 4J3TA 3BKJL 4M5ZL 5IGXH 5J6HB 4ZFOB 3QWRA 3VXTB 2PYED 3KJ6L 3QI9D 3BPOB 2NXYD 2ATPA 4U1IB 4BZ1L 3C5ZA 1BD2A 5E5MA 3NFSH 1YJDC 2DD8L 2EDNA 3QG6B 2XNAA 3RIFF 4PG9A 4XPTH 5DC4B 2R4SL 1LGVA 4O2CA 1CQYA 4NQDA 2Y23A 3WUZA 5J56B 3SDXE 1XIWA 2WNGA 2XWTA 3CMGA 1U8QA 5EU6D 5K9OA 4LKXB 2WBKA 4CVZB 5ICYB 1BQHA 1JJUA 15C8L 1SYVA 4V2CB 5SX5K 3L9RB 2B1HH 4NJAH 4EI6A 4ZNCD 4TSCH 3M07A 5I76B 1U8OB 5E8DH 5IW1B 1YNKL 4GT7A 5IMKA 5FUZH 4W4NA 1NJ9A 4Y19A 4XCCL 4Y2OA 3TBYA 4KVCH 1YEDB 2C3WA 1P7QB 2WK2A 3QEQD 5ADOL 2BVQB 2PO6C 3O6LH 4I3RH 2VC2L 4PJFE 2AERT 3QQ4A 3BD3A 4P9HL 4JQVC 2XN9D 3KPPA 4IDJL 4MB4A 3O3DA 4P4KC 3DX9B 5EBMB 1U58A 1F2XK 1T1ZB 1X3DA 4E41A 4NQDB 5E99H 2HLAA 1TFHA 3CFKA 5MP6H 3VFTA 2YD3A 3I9GL 3O9WB 1KLFA 2WV3A 3VGGA 4CMHC 4GBXA 2Y07H 1IGCH 1T1YB 4LK4A 3QXDB 4AEIL 1QSEB 2F58L 2V9TA 2VXTH 3SQOH 4WFED 1U8NB 2ADIA 5I75C 3KPRA 5C0BA 1U8MA 2CO7B 3HZKA 1JGDB 5GS1B 3ZE2E 4Z7QE 3G5XB 1FC2D 1EVTC 3WIHA 3S9DB 2OTPA 5MEQB 5JO5B 1QO3B 4OKVA 2ADFH 1RIHH 2NR6C 1MVUA 1T1ZA 3VGHA 2J2ZA 4IHOB 5GGVY 2OK0L 2EE6A 2DQHH 2M8XA 1XMWA 4NQDE 5DVMA 1SHMA 2D7OA 3LKOB 3SBWC 5I1DB 2F53D 3MLWL 4Q9BA 2UUDK 5BS0D 1KEGH 4XVJL 2CKBB 1A6PA 4IMLB 1TNNA 2A1WH 2EIEA 1YMME 32C2A 3BJ91 4OD1H 4IRSA 4P23C 2GTZB 4CJ1A 3EO1B 4Y4KD 1FGVH 1I7TB 3EJYD 3ORJA 4G6KH 1D5ZB 5EZOL 4ELKB 1Q9KA 3RUGF 1AD0B 1U3ZA 2XXCB 1QPPA 5MI0C 2CPCA 1U8MB 3X3GL 3T0EE 3OAZH 4HFWB 4OUUA 4UT9H 3SJVD 3T3MF 3F62A 3PE9A 1TVBB 3NFPA 4HQQH 2FZ3B 3OAYK 4R7NB 4JKPL 2A6JA 1C8PA 4DEPC 3L1OH 4RMQA 2B39A 3SDXB 4U3XA 3T1FB 5AAWA 2AEQH 4P23A 5DJYA 2WQRA 2BDNL 5HYQA 4ZPVA 5D1XA 2NXZD 1V5JA 4PRBB 4JFXA 2Y07L 3QPQC 2VKXA 2VDLH 3FN3A 2VDQL 3FQNB 1G84A 4JJ5B 2AI0H 5I16A 2ZOKA 1V05A 1VERA 2OTUB 3RPIB 3C5ZD 3TPUA 3REWA 4ENED 5IHLB 1NFKA 1WICA 4O4YH 4BZ2L 2MHAB 1UQSA 3VXNA 1CE1L 5IFJA 1KJVA 2E9WA 3WXVL 5HDQL 3LS5L 5ESVA 5IIEA 1ITBB 1EEYB 3ETBF 5I74B 3IFOA 1UXWA 4Z5RA 3T0DA 3RIFK 3AM8A 2A6DA 3MCLH 5DD1H 3KHOA 3MLSL 5ILTL 5HPOA 3OF6A 1YEGH 4WNQA 4GG6B 5FYKE 2F53A 1P7KB 2VITA 2BSRB 4ODXB 3CUPB 5JR1L 1SMOA 5HHXL 15C8H 1PX3A 1RFDH 3OXSB 3FQNA 2O5YH 5IWLC 2VDRL 1R24A 1G9MH 9CGTA 3U2SA 3QR2A 3P73A 1I9IH 4QWWD 1J5OH 2NY7L 1FZOB 4ZXBA 4HPYH 4GRWH 1VSCA 2J1KA 2PF6A 4XHJD 5D93B 1CDIA 1OGAB 4F80A 1PY4A 4ONFH 4JAMB 3VJ6A 1M7IA 1RIVL 1ZHBB 4K94H 3OJ2C 3HG1E 5C6WH 3CSGA 3BDYL 2EO9A 4ETQA 1N5AB 2LABA 1K6QH 3T3PF 1FGVL 2E9BA 1AP2B 1UWXK 3UYRH 1KB5H 3O3EA 4ZOCA 5JIKA 5KJRH 5I1KH 1NSNH 4JPVH 4CVXB 3D39B 5F88B 2Y4SA 3HC3L 5GRJL 2FB4L 3ZO0A 1M71A 1HOCB 1DBKH 1CL7L 5DJXB 2P5WD 1LO0H 3U9PL 4EN3C 3WL9A 3PP4L 3HLAB 1NC2D 1GHFL 5F89A 5JTWA 1FQ9C 4M43L 1MEXL 3VRJA 4N0YL 5DRZA 2ZUXA 3VW3L 1PKQA 2G9HA 3SGDH 3U83A 4CMMA 1S9WA 4MNHA 4RQQB 1ES0B 2VUYA 4DAGL 3DVGB 1QACA 3RL2A 2AGJL 4PGEA 1IE5A 4MZ2A 4MMZC 3VJ6B 3ZT5A 1UJ3A 2PYEE 2V7HA 1WBZB 3RFZC 4MNQA 3KYMB 4I9WE 4NQSB 3NAAH 3QDMA 4JLRA 5KS9E 1P5VA 4PJ8A 2ARWA 4YX2H 5BW7A 4I0KA 1INQA 4PJEB 2AJUL 4WI7A 3ULUC 4WVRA 5CWSB 5DHYB 4P3CH 5HGDB 1PLGH 5F88A 5AG9A 3OJDB 4LNRB 2NY0B 1XGYH 5GGSY 5B8CC 4XMPL 3F7QA 1YN6A 3PP3K 4LFHD 1NCDL 3GSRB 1A5FL 3HZMB 3BE1H 4OIIL 4CNIA 5SV3A 4G7YH 1F97A 43CAB 4F7PB 1Y6NR 1TJGH 2CLVA 2FX8L 3P77B 3SDAA 1JUFB 3QEQE 1S7UB 1RSFA 5BJTA 1MCOH 2DN7A 4UTBL 2AJXH 4PV9A 4X9FA 4ZS7L 2AK1H 2V2WB 1XH3A 4YHML 5GSVB 5JOFB 4L9DA 1UXSB 2WIIA 5H35A 1FLRH 3S4SG 6FABL 1MF2L 3NZ8A 1OTTD 1WIPA 4UZGA 3MBEC 3H7BA 2YUXA 1D5BA 3FHAA 3VWKC 2F54D 1L6XA 4I3GA 4LVHB 1VPOL 1JZ6A 3NIDE 1R3KB 3VH8B 3MUHL 3O6FA 1NH6A 1I85C 2W1NA 5E4IA 4ONGH 2BNQB 1UEYA 3A6BL 3BRDA 5D72H 2XRAL 2C3HA 2XG5A 3G6AB 3O6MH 4GS7C 1R3JA 1F5WA 3MRIA 1LMKA 5I1AB 5JMOC 2ZCKL 4N9GA 1B90A 3L1OL 4LCIL 4NO5B 3OTTA 3RWHB 2F53E 2Y6SC 3RWGA 1AY1L 4EUPB 2R8SL 5EO0A 1ZLWK 3BSZH 2JJWA 1YMMD 5JDJA 2X4TB 4U05A 2R2HA 2D7PA 3RTQD 1AGEB 1U9KA 3MACL 1A6VL 3BWAB 2BERA 3V6FA 2GJZA 2CSPA 2QSVA 1FL5A 5I6XB 4JY4A 3RWIA 3S3SA 1H15A 2VDMH 5DJ8A 3F7PC 3G6AA 4X6EB 3SKMA 3SBWA 4H0HB 4J8RA 3MRGB 1E6OH 3HMXL 4KDTA 3BMWA 4WDIA 12E8H 2O26U 4XBEH 3Q5YA 1F90L 4J3VA 5SX4H 4UT7H 5FA3A 1QFUL 3FFDB 3OKNB 4OZGB 2FO4B 1KIQB 1Q38A 1G9MC 2XTJB 3HPLA 5C0EA 5FDWA 3BP6B 1CLYH 4UT6L 1TZIA 1RUAH 4PJXB 2NZIA 4OCWL 2IPUK 2EC8A 3IFNH 4OCSL 4NQVA 4R9HA 2OM5A 3GSUA 3GHBH 3B8YA 4HUXA 2WUBL 1EFQA 1JWMB 2E27L 4XCNA 3TYGL 3TVMA 2R56H 1RV6X 1NCBL 4CU7A 1R5WA 1D5BB 3KR3L 4Z9KB 1MH5B 4TVPD 3Q3GB 1KBGH 3C5SA 5DQJA 3TYGH 5JOPD 1TZHB 3RTQB 2QLVB 4H8WH 5CZVH 5I1GH 5TF1H 3EYQC 1WF5A 1DE4A 1XF2A 3KG5A 2WINB 4GBXB 1YPZE 4POUB 1D5MA 3LMJL 4GRWB 4JGUA 4LCCA 1HXYB 4F8TA 5H94B 2E6PA 2DB8A 2HRPH 1QTYT 5GRXG 4M5YH 1MREL 5CILL 1CR9L 4TUKL 4PJ8B 3VGAC 5E8DL 3TO4C 2OTWB 5CJ8A 3LPWA 1PG7W 1ZWIB 3VG9C 1NFDA 1G7IA 4PTTB 4HK0A 3LS4H 4GRLB 3HC0B 5CZKA 3VRLE 3EOYG 1QSVA 4LRNL 1OTTC 1A6ZB 3SJVA 4OQTA 3UC0H 3P9WB 3R4DA 4PRNB 3QXAA 1T89C 5FUOL 5HYSA 2YUVA 4I0PB 1G9EA 3MPCA 2HFEA 2GK2A 5HYJA 4AL8L 4XPTL 1ED3A 3QDJB 4FXKB 1LEIA 4WCYL 4PIRF 5ISZD 4YHNA 1OAQL 1IBGH 1OARL 1RULH 2W0FA 1FVDB 4E41E 5ENWB 4EDWL 1CG9B 4UI2A 1CIDA 5I8EB 3V6ZB 1CTOA 1JYVA 1KCSL 2P5WE 4WWKA 5JIHA 2J3SA 1EH9A 4KY1L 4J2XA 2NNAB 2VXQH 3WV0A 5AWNH 4P4RB 1ZWIA 4L3EB 3BKYH 3HE6B 3HR5A 4M93C 5EC1A 4WY7H 4FA8A 4HIHB 3MRKB 4X98B 2WWMD 4X80H 1JL8A 4R4BA 4RFOH 5C07E 1DVFD 4PGZA 3A67H 2BSED 2APWA 2YPKA 4QXGL 3G9VA 1XFPA 3AS0A 1K5NA 1OARH 2OJEB 2Z92B 2FJHA 2AEQL 2HVKA 2X4NA 4GXUM 4RZCB 3QH3A 4CW1B 4NZUH 2OP4H 1JMXA 3TN0D 4HQQL 5IHZA 2VRAA 1QEWA 1DE4B 4PGCA 4XAKD 2AK1L 2AABL 1ZVHA 1Z9LA 4P0DA 3B6SA 5F6HI 1GVIA 1ZVYA 1IGIH 4M6OL 2VERN 2QSCL 3K80A 4NRXA 4RA0C 4XNUL 4HKJA 3X13A 1A14H 2B4CC 4F7EA 4OJFL 3V6FB 1A5FH 5MERA 5KS9A 3IXTB 1KN4H 1HCVA 1YMMB 3C6SB 4PJIE 4LSTL 4JQVA 2OSLB 4KHXL 3PGDA 5GISH 2VDKL 3EOTH 3RL1A 4LGRB 3BZEA 3HE6C 1A6ZA 4NHCL 2F54E 5GRVL 2F8OA 4YE4H 4A6YH 4KGLA 5CP3H 4DFHA 3MJ8A 4RGND 5LGHL 4MX7B 3DI3B 4JN1L 4AJ0A 1HQRB 1PD6A 3OPZH 4YXHH 3C09C 3UROR 3OKNA 3F7VA 5DD0L 2EH7L 3LIZH 1DR9A 4QT5B 1SJHA 1R0AH 3K8LA 3C8HA 5DJ6A 1OQOA 5C9KA 1RJZA 2W0FB 5HHOE 4FQIL 2QKIA 2RB8A 3B2UC 3MV7D 3FO0L 5E00B 2XZCH 5B38G 1JRHI 3GDBA 1FIGH 5B4MC 1Q9WA 4MAYD 5E03A 1IAII 4ZPTB 1NAML 2LTQC 4NOBA 3KPNA 3RZCA 2V2TB 3IAPA 4EBQL 1UKTA 3TO4D 5EC1B 3MRDB 4JPVL 1MH5A 4XPGL 5C09E 1SEQH 4U1JA 3O4LB 3NABL 4FNLH 3BQUC 1JI2A 4CNIB 2OQJA 1AGCA 2HTLD 1K4CA 2BVPB 5HHMD 3V5HA 2BRRL 4YWGL 3SKNB 3S4SB 5EBWA 4LPTA 2P5WB 4CMMB 4PPTA 2X05A 5BJTB 1DDHA 4DQOL 1J1PL 1TZGL 3ARYA 1CGXA 3QUKB 3V52L 4E42B 5JXAH 4K9EC 3MACH 3O2DA 5FHBL 3O4OB 4K23H 2X4NB 4RZCA 4U1MA 4NFCA 5T1LD 3VCLB 1OCWL 4UAOC 1QFPA 2GITB 1GGCH 2VLKA 3THML 1AKJD 1BVKB 4R4FL 2M26A 4MXWH 4PJEE 3W2DH 1GPOL 4HBCL 4HS6A 1A6AA 1KCUH 2E8ZA 5IMOB 3BIKB 3QIUB 2QHRL 4N0UB 3HNSL 3QBTB 3MRHA 5D96B 4F3FA 1UCTA 3PGFL 3C2SA 4I8DA 1GZQB 2C1PB 2BMKA 3ZKXB 1OY3B 4XX1E 3UTTE 1WIUA 5HI3C 1NGXA 2DTSA 2NY4C 3BI9X 3ZSSA 4QXWA 3QDGE 5D7SH 2J8UB 1GIGL 3BW9B 3QIUC 1M6OA 4NKMB 1CD1A 4E42A 5DMKA 1BREA 4D0CA 3ELAT 3S3PA 2XZZA 1DCLA 4WWKB 5JOPE 2QL1A 5KBNC 3H42L 2CK2A 4XP4H 2DMBA 1QLRB 5J1AB 1YEHL 2VDLL 1XZ0B 1LILA 4HUWA 3TYFB 5HVHC 2A38A 3OAZK 4M93B 1BF2A 4KKBC 1S9VA 1H3XA 4LRIA 3V6OA 4YHMH 4YPGB 5EU4B 4N8VG 5F72S 4N1HB 1ZANL 1F8TH 2HKFL 2B4CH 3R1GL 3WYRA 4PJXE 2CJUL 4XMKH 4K3HA 3LN4B 1EPFA 5ISZA 3VFWB 1QLFA 3TP4A 1QYGL 2PTTB 3QFDA 3T4YB 4QGTA 4TTGA 3FZUD 5CUSH 3MNZB 3MNWB 5I1AA 8FABA 2D9CA 5JXAL 3FAWA 5ACZB 1IT9L 4X6DB 1CF8H 5ISZE 1MFBL 1X5KA 1LO4L 3R06A 4P3CL 4U1LB 1C5DA 5E2VH 4G5ZL 5E1HB 1KEGL 1I1AB 3S34L 2OLDA 2YPVH 4K7PH 4DGIH 3AROA 5C0IB 2L0DA