1FZJB

Mhc class i natural mutant h-2kbm1 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of K(bm1) and K(bm8) reveal that subtle changes in the peptide environment impact thermostability and alloreactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fzjB00
2FCBA 3OJ2C 2H6PB 2ZSVA 5CBEA 4XCNA 2E6JA 2MKLC 4LSRH 3PV7A 4X6DF 3T65A 1J0ZA 3RL1A 1A2YB 2GKIA 1CICC 2D31B 3ARGC 4Z5RA 3IDXH 3MRNB 3I3EA 1W2KT 1DVFC 3MRMB 3TIEA 2DAVA 5EBMA 2AXGA 1MY7A 2OJEB 5GZOC 1KC5L 4ZUWA 3NFPA 4XWOC 4QHLB 4OZGF 4ZUTA 3WXWH 5SX4H 1E4XH 5J3HD 3V7MA 5JPMB 3QIUA 4JO1H 3BPNC 1FYTA 1B3JA 1RULL 5JOPD 3SDYL 5CD3A 3SHSA 2YSSB 4PY8I 4QNPE 1HILB 1QRNA 2YD4A 4M7LL 4B53A 5FHAL 1I1FA 4NQDA 4NN7C 1IEAB 1FH5L 1NGYB 2Z91A 2HLFD 3QIBD 5MEPB 2R4SH 4M9OA 1X4XA 4L3EE 4JY6B 5SWZB 4JHAH 2FR4B 1BFOB 4NQDD 1IKNA 2XA8L 4H26B 3LKOA 5ECJE 3NIDE 2YA1A 4LHUA 1AP2B 4XGZA 4U33A 1VACA 3GMMA 4HULB 3O8XA 4L1HA 1MCBA 4K94H 3KPTA 3QIWB 4GW1B 2XZZA 3GDBA 3SE9L 4MVBC 1CWVA 1ZHBA 3KPPB 1HHJB 1YYLL 1KUMA 3TESA 1H5BA 3VXMA 4NQCE 2IAMD 3CLEL 3SBWA 3AS1A 2EO9A 3MV8A 4I8DA 3CX2A 1MLCB 4HS6A 4UQ3B 1RMFL 4CN1A 5ACZB 4W81A 3WO3B 3DV4B 3VFWA 5GHWL 1CTOA 2OTUA 3PL6B 4XPTH 3E2HC 4ORZC 3IU3B 5FYLE 4LCWB 3O3BB 4DN3L 5HVWA 4L9DA 5J9PB 5BRZA 5J4MA 4OLWH 3QDMA 2NMSA 4NZUL 1OSZB 1ACZA 2DQHL 4QHKJ 1T89C 2HG5B 4KGJA 3VWKA 4GKZA 3MRQA 5LGHH 1LEKA 4L3EB 2I5YL 4I48A 4OLZL 4JQIL 2X4TA 1OAYL 3L9RA 4GRLA 2Y7QB 1WWWX 3SGJC 5KOMC 1FZKA 5IW3A 2HT3D 3EO1A 2EE9A 4U1HB 1XF2A 3C9NB 2ENYA 1AXSA 4UIKH 3R4DA 1VADB 4P5MA 1GC1H 1KJ3H 3RWHA 3OKKA 2VKXA 1DUZA 4G6MH 2EDTA 1KPUB 3G6JE 5I66A 2AQ2A 4KWUA 5TPWL 3WCYA 2ADIB 4RMQA 1JV5A 1BVZA 5MHSE 4A6YL 3O4LA 4M6NH 1QQDB 2P45B 4L29A 5FCUL 2ICWB 4I0PA 3S4SA 4RISH 4YDKL 2YD9A 4WO4C 1T0MB 2B7DT 2VO5A 1AGCA 2GK0B 3JV5A 4KK5D 2FWOA 5GZNC 3FJTA 5F9JB 4G8EB 4QOKA 4PJCE 3TC9A 3TJEL 5K9QI 1RUKL 4JAMA 1UADC 4LU5H 1AI1H 1RK1B 5E2VH 1JF6A 5FGSA 2C7UA 1NAMA 4TOYL 4TVPE 1BZ7B 4ZFOB 5DJAA 5GGVY 1H3PL 1F8TH 2HVKA 3JWDL 3RX8A 1PZ5B 4HWBA 4TUKH 3QZWB 3EYSH 3HC3L 3V4PH 5I17A 3MRGA 3CCHA 5C09A 3S36X 2AQ1A 4IIQB 4X4YA 4WHTB 2X4UA 3QDGE 4FQLH 4FQPA 5BW7C 2BVOA 2WV3A 3DURB 4WJ5A 4E42A 1JPSL 2B39A 3AROA 4TPRL 3RKDD 5JOPE 2ZCLH 5IB3A 1A8JH 1EIBA 3RIAF 4OD2A 1RUKH 3HZMA 3RTQB 3QCTL 3FO1B 5GGVL 2QSVA 4PRHE 5L9DH 3NABL 2BNQB 4NHUB 4PJIF 1UZ8A 3H3BC 5JDJA 5EU6E 4Z8FL 4JZNB 1R5VA 4QTHA 3PGCB 3D85A 1QACA 5DQ9A 3HE6A 5KN5A 3WV0A 4UTAL 2OMNA 2BOBA 1T1XB 1MREH 4QHNB 1K9TA 2EH7H 2VN4A 4XB8A 3CLFL 1JMXA 3K46A 1FL3B 2R56L 2IGFH 5C92A 1MI5D 1P1ZA 4G6ML 4PIRF 4LVEA 5B3JE 1OM3H 1NKOA 1NMAL 3ARZA 3WFDH 2NTFB 1BBDL 1G9ML 3IT8D 2FEEL 5FK9B 4BM7A 4YJZL 2YWZA 5HVHB 4H1LG 5H2BB 5C7XH 1WBYB 3ABZA 3I9GH 4KVNL 4JFED 5FYKU 4KROC 3RWIA 4YDVA 4ZYKA 1MCWM 3WKNA 2EXWD 4C57C 1Z9SA 1MRDL 3WHE1 1AKJB 2VXQL 4ELMB 3H42L 2YPLD 4WI8A 4M4RA 4KMTH 4OQTH 5CP3H 5GS1B 4R26H 4XVJH 3RVUD 4QHUB 4O2FB 3TZVC 1INQA 5LAXB 3D39D 1XH3A 4R3SB 1YN7B 4Y5VA 4U1GB 5DR5L 1FFRA 4LSSL 5JHLH 1QSFD 1F97A 1HEZA 4FXGA 4EUPB 3TBSB 5E2UL 4OZGB 5DFTA 1K2DA 2ZUYA 4WFFD 4DAGH 4R9HA 2YZ8A 2WWMC 3VXQB 1S9KC 2NY5L 2ERJC 1MIEH 3G5ZA 4FQHA 1CL7I 4JZOB 2I5YH 1X4ZA 5DRZA 2OL3H 1ERNA 2V9QA 5KTEH 4YHPB 1ZHKA 3D87B 3ARFD 3GB7B 5DFVC 1JJUA 5ALCH 1A7NL 2H26B 1G7IA 2F8OA 3DYPA 3RVXC 2A1WL 1RZIA 1KCKA 5EUOE 2CR6A 3FONA 4IRZH 4OUUB 4D0DB 1RJZA 4OV6F 4NO2B 1C16B 3NVQA 4O9HL 1FH5H 1DL7H 5C0GA 5IESH 3EOBB 4NHCL 5F71A 1EX0A 1RUQH 1CDGA 5I71C 4TSAL 2EYTA 2HFTA 3GMQB 2FATH 3GSRB 4JO3L 3KPOA 1BHGA 2DS4A 5F7FA 4NM8L 5C0IA 5KAQF 2L7UA 4PG2A 2W0FA 1XGRA 2VZTA 3S34L 4FQ2H 4UDUB 3SKMB 4XWGL 2EXYC 5IMLB 4M5YL 5GRUL 3SCMD 1PQZA 1VFAB 4HUXB 3Q5TA 5DHVH 4YIQB 3LN5B 4LF3A 5ID1B 4ZOBA 4ZS7L 2B4CC 5C3TA 3BGFC 4YHLL 4ZUUB 5HGDB 4E41D 1AR1D 1MFCL 2WIIA 5SWSA 4N8VG 1QLFA 1KPRA 1RZ7H 1X5KA 2CD0A 4HPOH 3O6FA 1KGCD 1UA6L 1C5CL 2D9CA 2YKLL 2D3VA 1DBML 5HGDA 3GKZA 2YPLB 4GQ9L 4ZUUA 4HLZG 4HPYH 4G6JL 4G6AC 1C1EH 4P2QD 1OD9A 4PJDE 2YXFA 3P9MB 3RWFB 1PQZB 1VFAA 2C3HA 4HUXA 3OKDA 4WW1B 3V8CA 4UDTB 4AT6B 2FJFA 4RDQG 1UXWB 1TCRA 2J1KA 4C59B 5F7DB 4L5FH 4OZ4B 3NCFB 3SKMA 4DCQA 3LKNA 1XGRB 2XKSA 5EU5B 2BHUA 2PETA 1S8DA 3KPOB 4YZFE 3S3PA 1JFQH 1V3LA 1AGFA 4GRMB 1FSKB 3S35H 3IS0X 1I85A 1CFNA 4XPGH 3NTCH 3VMNA 5JHDA 1MLBA 3BZ4A 4P57B 4LSRL 4N0FB 1HH6A 4KKNA 1ZA3B 4PRHD 3IFLH 4NO2A 4RDQF 1U3JA 2YN3A 3U30B 1NBYA 3PIQA 4QT5B 1LO3L 3GMLB 1TJGH 3I6GA 4U3XA 5ICXA 4PJ5B 4P2OB 3MRPB 2X44D 5H35A 4AEFA 3LRSB 3LMJH 3OWEA 2QKIB 1ZHKB 4YHPA 3U4EB 5C6TL 3D39E 1I9RL 1B2WH 2Z9TA 1ZLVK 3GJFA 3KPRD 5I30H 4JZOA 3BPCA 4MAUH 5EOCH 3JWOL 3N1GC 4NQVA 5E8OA 4PLNC 3GSNL 3GRWA 2GFBB 3JUYA 43C9A 1T5WB 1GZQA 5DUBB 4PLKC 3MOBH 3QYCA 1PBYA 5C6TH 3DXAD 2EDEA 1MCPL 3QWQB 2YD2A 3UC0H 4PJ7B 3EO0B 1D5IL 2Y06H 4YHML 4J6RL 4NO5B 4OV5B 1AR2A 3N9GL 1ZAGA 1YN7A 2YZ1A 2YD5A 2X42A 4NN5B 5FFLA 4O2FA 2A74B 4XMPH 4R97B 4NFDA 5GS1A 3P30L 5CS7A 2L0DA 3E6HB 4N9GB 5FO9A 5DD0H 3EYOB 3DRTB 1HZHL 1R3LA 1KJMA 3OMZA 3S5LG 1LEIA 2OP4L 1XF5B 5DRNB 1JPST 4R7DA 1MEXH 4EOWL 1BD2D 5HDLA 3V52L 3VFMA 1NCTA 2AQ3A 2X4RB 1X5YA 2F8XC 1QR4A 5FK9A 2NTFA 5DHXB 5KVEL 2H1PH 3KXFB 1FSKC 4UQ2A 5E8PA 4JVPA 4MD4A 4NZRL 3AREB 3TNNB 2FX7L 4KJQD 4Z78A 1D9KB 3SDDA 2VZ3A 1HSAB 4EN3B 3NA9H 5A2JH 4DVBA 1F4AA 2HAZA 2XY1A 5EUOB 3EJZC 5CIPA 1O7VA 3BQUC 3PGCA 1DFBH 1PKQE 3N50A 5E8DL 4CMMA 5C0RH 4U1KA 4FA8A 3QUML 1CLOL 3MJ8B 3D9AH 3WXVH 3EHBC 1IEBA 5KVEH 4WFHE 4Y2DC 3OGCB 4XT1C 4KRPD 1GC1C 2VL5B 4Y4HD 5CEZE 5IB3B 3MLVH 4KKAC 1P4LB 2BVTA 3QPQC 5B3NA 3RNKB 3JWOH 2FO4A 5J7CC 4OB5H 2JCCE 4NM8H 5CWSA 2AABH 2BCKA 5I16A 1OD7A 4WHTA 4XHQA 4F9PC 3IB4A 3NA4A 5KVMC 1WFOA 3T3MF 2Z92B 1CR9L 1A0QH 4OAWA 2C3GA 4BSWB 4WW2A 4MJ4A 3LVEA 3P2TA 4HIXL 1RZ8B 4IHOA 2ESVD 2JE8A 1HXMA 1MRFL 4ISVB 4JANA 3MJGX 2ESVB 4G8EA 3D0VA 4XNMA 4XVTH 1I8KA 3DX9B 1PKOA 2PW2B 1N7ML 4HMCA 2E3VA 4I3GA 5MENA 5BV7C 3OKLB 1DUYA 4WU5B 5D2NB 3GJFK 3F7VB 2VN7A 1RUPH 4Q7DA 4XP6H 4MA7H 4GBXD 4LASH 2Z31B 3W11C 3QQ9D 5J8OA 5I66B 3QDAA 4XP4H 2B5IC 1FJ1A 4N8CL 4HPYL 3MV8D 1QLEH 2EDKA 4NQED 1ETZB 1WIUA 3ARTA 4PJEE 3RZWA 1DBMH 4HXAH 5HHPB 1DANU 4HWNA 4MCYB 1X5JA 2P1YA 1N64L 4Q6IA 5E5RB 1XF2B 4HPOL 5GRVL 5E4EB 3B9DA 3EO1B 4JO4L 5SX5K 3R8BB 1G1YA 3H9YA 3O6MH 1AQDA 1AO7B 4FQXD 1GGBH 4WWKD 5F1OB 1CDCA 2QHRH 3GEWB 2YOCA 4KUZL 1GIGH 4X8JA 3T09A 1QVOA 2HLAB 3N06B 3VWKB 5SWSE 1NEZB 1XF3B 1U3YA 3B6SB 1U8OB 4IEFB 3MRFA 1NFDF 2MMXA 3DX6B 1BFVL 1S7WB 4XTRC 1OSPH 1DQQB 1QBMH 4F7MB 4WCYL 1KCRH 2R15A 3ZYOA 1X6LA 2UYLA 4P4KA 1JZ4A 5GGRA 3VA6A 5HBBA 1N4XL 2CGRH 1GPOH 2PYEE 4YBQD 5T1MA 1R5WA 4EQ2A 4R4NC 3UEZA 1A4KA 1UXSB 2ZZUT 1V5JA 4ELKA 3ZE0E 5K9QG 2GSGB 3CFEA 5JA8B 1MAKA 3CFCL 5DMIL 2R1WB 2BNRB 4CVXB 2A83B 1T2QL 4PV8B 5DJ2B 4QRQA 5L9DL 3CFIC 3FT3A 5L7XH 3O41A 4ZFGH 3QCTH 4JCLA 3K4ZA 1TZIA 4EXKA 2R9HD 3MROA 2UZYB 1IGYB 1S9VA 4AMKH 5DURD 1BGXH 4BJLA 1UGNA 1OPGL 3FQUB 4RGNE 3HFMH 4JHWH 2BFVL 1L9MA 4UAOB 4CNIA 2FGWH 4F57H 3ETBF 4J3UA 5B22A 2Q76B 4I3RH 4MQXC 2P24A 3F6LA 4PP2B 2ZJSH 5E94B 3UBXG 3MGTA 1KTKE 2YSSA 3PQYA 4JRYA 3G04A 1LO2L 1T83C 1PG7W 2OXGA 2ZCHH 1WICA 3UCRA 4HGWB 3W82A 4ODXA 4F7PA 3MUJA 4QO1A 3R1GL 1DSFL 1QP1A 4MMXC 4S1QH 5DEFA 4WTZA 4Z7WB 4M5ZL 5FYKE 3W0WD 1AXIB 3TVMA 4RCAA 4Y1AB 1WK0A 1V3MA 4PBXA 1MFAL 1S7RB 2UZXB 3QCUH 1TTUA 4H88H 5IFHL 1F3JB 3KJ4B 1A9BB 4NCC1 1DQML 2D31A 1MWAB 4M6NL 3OJDB 3KPSE 5J11C 4AM0B 1KCSL 1Z3GL 4MJID 1NCWH 3BX7C 2H6PA 5HI4C 5HI3C 1SY6H 3KS0H 4WDIA 3M1BA 3WKML 5K9KB 3SDCA 3TA3D 4YXLL 4Q2ZA 2V2XB 4S1RH 2IPKA 4OCMC 5ERWA 3TEUA 5HYJE 5DJ8A 3B9KA 3U36B 3KLAB 5IROA 4F33B 5AWNL 2B4CH 3WNPA 3VJ6A 5GPRA 1G6RB 5IEKA 4X7TA 1SBSH 4E0RB 3VG9C 4I9WD 1ORSB 1TZGH 3OBAA 3U4BH 2XZAL 2MFNA 4LBEB 2ESVE 3B4NA 5LGHL 4ZFGL 3O11A 1IC5H 1MF2H 5CEZH 5DSCA 2FDBP 1YEGL 3B9KC 3L1OH 4MWFB 3BOVA 2CIIA 2H8PA 4M8VA 5LXGH 2CKBL 4KK5C 2NQCA 4OGXH 4IRSA 3PQYE 2M2DA 2XKNB 2BY2A 5EO9B 1HHGB 2EDRA 3PUCA 4OCXL 4BH7B 1BLNB 3TLRA 3BQUA 5AYQA 2ED7A 3QQ4A 1S3KL 4RA0C 2FL5B 3VXRD 4LRNH 4P46B 5JW3H 5L0QB 3VDAA 5DVNA 3EYVA 4J3SA 1MF2L 2OSLA 5F97E 1C5BL 5CEZL 1NCBL 1FG9C 4CUCA 1CE6B 1T2QH 4QRTB 5SX4I 4PBWD 3SDDD 1WCQA 5L7XL 15C8L 4HDIA 3I50H 1CGSL 4K3GA 3H9SE 2I07B 5D1XC 2YN5A 3GI9L 5J1AB 2QSTA 3PHOB 1WZ1L 5JDSA 1KIQA 3CFCH 4KRNA 3C60A 2HVJA 1JPSH 4HIHA 3FB5B 1TJIH 3L7EB 5D70L 5ICYB 3IFPB 2DM2A 2N1KA 2VLRE 4XPHH 5EA0L 4UU9A 1OGTB 3RKPA 1KCUL 4JZJB 1W72H 4YZFF 4OZHF 4Y5YB 3FO9A 1O5DT 1R24B 1P84K 1UB6B 2X4OB 3EJZD 4HD9A 1I7UB 4LFHD 1HHKB 4Z0BL 4ALAH 2X4SB 3TBWA 1Z9OA 4L4VA 5CZXD 4X6EB 2VDKH 2YC1B 3JV6B 1RSFA 4D9RD 1ZA6B 4XP4L 1QYGL 4QWWC 5E08L 1U8HA 4CJ1A 1A14L 3L3JA 1KCSH 1MQ8A 1Z3GH 3IU4H 4X5XA 1RVFL 5CEXB 3KDMB 3Q6FA 4JPWH 4P46D 2ID5A 1JYNA 1I7RB 1KTRL 1TTGA 4BSVA 2NY4C 1HCFX 2IBBA 2QHRL 3DMMC 4YBLC 1N7MH 2HTLC 2P42B 1P7KB 2H3NB 4UUJA 1OB1A 5CEXA 2BNUA 1I1AA 4JPIA 2CDGB 2XNAA 4YNYB 4IOIA 3BD3A 2O61B 3MZTA 4GG8A 4HXAL 2NCMA 3QXVA 2A6IA 4PJBA 4IS6B 1B4RA 1OAKH 5CJXA 1BP3B 3IDYB 3MLUH 1QR1B 1FN4A 1GHFL 2NY1D 4NO0B 2GHWB 4QRUA 1I7UA 4Q97A 2AV1A 2NY1B 3U0PB 2E9BA 3VXRE 3OJVC 2EZ0D 2OTPA 1DBKL 4W4NA 1YEDB 4UU9B 4MA7L 1EMTL 2W65A 1MSPA 4P23A 3D18A 4LASL 3MA9H 3C5JA 3HZKA 4Y4FA 1KIQB 3ARRA 1ZLUH 5HDBF 4XAWL 5BO1H 1YPZA 1IQDA 1GVIA 5KW9H 1YC8A 4AEHH 5MENE 3O9WD 3QISA 1VGKB 4ZSOB 3CDCA 1RZFH 1EO8H 3DIFB 4G8IA 2G2RB 4LCCB 4APQC 2A6KB 1F6LL 5IJKA 3ZKXC 4EVNA 1F2XK 2BOCA 2XTJE 4PY7A 4DN3H 4DQOH 4GG6B 3WLWD 2IPTL 2CGRL 2VE6B 1U58B 3EDFA 4LEXL 1DZBA 1A3LL 1HHGA 4JHBA 3IDJB 5EDXA 1EHNA 3EBAA 2Z4QB 5TE6H 5E9DD 3WNMA 3CFKA 5DC0A 3GSXB 1AD9B 4QRPB 3Q3GA 1CD8A 1T21A 1E4XL 1A6ZA 4XNZB 1EFQA 1SJEB 4Y7MA 4PJ8C 4RZCB 4H5SA 2Y5TB 4LVHB 2CRYA 5IV2B 3S96A 1C08A 3IDGB 1P9MC 2E8ZA 1BQHB 1M7DB 2WWKO 3RGVC 4E41A 3TH3T 1CZ8H 1GYAA 3QUMH 4W6YB 1KEML 3PE9A 5C0NC 3CC5A 3RUGF 5JUEH 3VFGH 3OJMB 3KLDA 2MCG1 3L5JA 1FAIH 4G8FB 3AY4A 3RQ3A 4NN5C 2DRUA 4XCYB 3KYNB 1UM5H 2OZ4A 3U36A 1KEMH 1QLEL 5GSRA 2FX7H 3VMPA 1LWRA 3KLHD 1UT9A 1CT8B 4J6RH 2AEWA 2H1PL 3IETA 4JB9L 3LOWA 5ACLA 2IPKB 1JYVA 1XZ0A 4Q2ZB 4XP1H 3B2VH 4U7SA 1YNKH 4WUUD 3I02A 1OAXL 4RGNC 4WGWB 4EEEA 1N3NB 2BY3A 3EYUH 4PUBH 2BX5A 5E00A 2QR0B 2WMPA 1A9BA 2GITB 3QIBB 3TVMD 3CDGA 4O2CB 1B2WL 1T1WB 2DF3A 4LFHG 1RJCA 3MC0A 1FO0H 1PX4A 1NGXA 4QNPF 4Z7WA 2P5EA 3RVTC 1LDPH 2IQAA 1T03L 3OKYA 4HGWA 2X1WL 5EIQA 4HIEB 4F37K 5CBAA 1I3GH 1UWXK 2A77H 1BOYA 1JI1A 3BZFA 4BA8A 4MQSB 4H20H 3BUYB 1WEJH 3JV4A 3VD4A 2P24B 2DWEB 1G84A 2Q8AL 4R4ND 4PYHA 4H25A 5F9OH 4XPGL 3HRZA 3FQRA 1D6EA 4XP9L 3BP4B 3QDGD 1EFXA 4M6OH 5H94A 3QZWG 4Y4HB 3TP4A 5HYJB 3HKFA 3BRGC 4Q9RL 3C09C 4U1LB 4I5BB 3MLRL 3C5SB 3J8F7 5CKAA 2IJ0C 1ZLWH 3EYUL 5IOPA 5ADOL 3C5ZD 4LP5A 3D39A 2F8VA 4KI5F 1G7HA 3R0NA 4OT1L 3TM6A 3FT3B 4W4OA 2H2SD 1TLKA 4HIJA 3SO3C 1PDKA 3O6KH 1GGUA 3SQOH 3ZT6A 4LLMA 1I3GL 1OHQA 2XFXB 1FGVL 2AEPL 4ELKB 1PJ9A 1W0VA 3DO7B 2R8SL 1NH6A 2OTWA 4OFVA 4N8VB 4KAQL 1NAKH 3FQXB 4HK0A 4MA1B 4PGBB 4RAUB 1JFQL 4XVUD 2Q8BL 1KT2B 3C08L 5CCKL 1AHWA 4QRSA 4OCLC 1MI5A 2PYEB 4W4OC 1HNFA 4LLYA 1DQQA 3QDJB 1S7WA 4Q9QH 4HFWA 3K8LA 1OTUD 4J12A 4DKDC 2NY7L 1GGTA 3BUTA 3PP3K 4W70A 3NCCB 5IQ9A 1DDHB 1QVOB 4CW1A 5HSFA 3MBXL 2P8PB 4KZEL 2ZKHH 3ROOB 1FAIL 2YPLE 1A3RH 4GJTB 3VXOA 1J87A 1AHWC 1RZ7L 3ESUF 5JPNB 1AO7E 3IF1B 4WFED 2OXHA 3BKML 5C9KA 1S78D 2E7MA 1ZVYA 3FZUD 3V79C 2C3WA 3QUMB 1F5WA 4JM2C 4O00A 3FQWA 4YFEA 5F70A 4YFLI 1NCAL 3CFJB 4QXWA 1YEJH 5FYLD 3OG6B 1RZFL 1TXKA 3NCEB 3V6FA 3S3SA 5D9SB 4Z95H 5DO2C 4XBEH 5JW3L 3GSNH 1MJ7H 2PNDA 1UVQA 4M3JA 5MEND 3U7AA 2AK4A 5TH2B 5EO0B 1KB9J 3BO8A 5DD6A 5DK2B 5DF0A 2PYFB 3V5HB 3DARA 1IC4L 4OGYH 5K59F 5DJYB 1QEWA 2ESVA 1P4IL 2IBGA 3LN9A 4RA3A 5CZXC 1LO0L 3L3IB 1KTDB 2X05A 4CDHA 1HH9A 3HA0A 4DN4H 4HG4K 2CJUL 2VDNH 3PWPD 3WIHL 1V7MH 4P2RB 4IDLA 1DJSA 1OW0A 32C2A 4OD1L 3U0TA 4DZBA 2HFFB 1EGJA 1FZJA 4HC1H 4PJIE 3HAEB 4ZAKD 4WFGE 2XN9A 5AYUH 2DLFH 5CLTA 3SE8H 4LPWA 1B0RB 4KVNH 1P84J 2P5WD 3RNKA 3UTSB 3GJEA 1K8DB 5C70A 2B1AH 1INDL 1OQXA 1RIVH 3VXTB 4JFFE 3QPXL 4GXUN 3MACH 2BSTB 5C0BE 4PJHE 2VL5A 3FKUS 4JFFB 3PWNA 3GK8L 3B5HA 4GRLD 4LAQH 2XWJA 3IDIB 4Z7UB 1L7TL 4JJ5B 2W9LA 3GBLA 3TN0A 3QXAA 1UKSA 2VR9A 3PWPB 2JKXA 2H2PC 3M17A 2O5XL 1SY6L 4OGAD 5CIPB 1IARB 2WQ8A 1FHGA 4NT6B 4X5LA 4P5TD 4BFIA 4L3ED 1Q9WB 4ZAKB 5IFHH 3VFRB 4ZS7H 4IJ3C 4ONGH 4PRIA 3RUGA 4WEBH 1NGWB 3CUPA 1FLRH 2NX5D 4UQ2B 3KXFE 4WFFE 2QBWA 3QFJA 5IW6B 2BK8A 1FRGL 1EO5A 3TNMA 5DT1L 3TPKA 4J4PC 3GMPA 1IAKB 4V1DD 1S3KH 3C6LD 4LMQE 4Q9BA 3UYOD 2E7LC 5D7SL 1X3DA 3SKOB 1U3HC 3DRTA 3FFCD 1OCWL 1DVFA 3P0YH 5FUOH 4K8RD 5D5ME 4L8BA 4LHUD 4BELD 4N68A 2ZUXA 5C2BH 3W39B 4G9FA 4OZFB 4JGJA 5E9DA 3QUXB 3FFCE 4OV5A 2EZ0C 4ZPVA 4OZHE 1K4CB 2ZOLB 3CZJA 1FVDB 3LIZL 2Z8SA 2NY2C 2AI0H 3IRZA 4MAYB 7FABL 5DUBA 2BC4B 3ALXA 2VUOA 4PGZA 5LGJB 4CKVX 3PGFL 3DSFH 3UYRH 3T77B 3GIVB 2NY5H 3RJDA 3QIUD 5HVGB 4YDIL 1N5AA 4D0BA 3ULUF 2J8OA 2ZG1A 4NWTL 3VRIB 3KPQA 2GCYB 5I1AA 2QKIA 1NQBA 1CXHA 5JW4Q 1NCCH 4IOFC 3UYPA 2PXYC 4QXTA 5D7SH 1RUML 2HKFH 3GGWB 4P2OA 5DR5H 3V5DA 1NBVL 3I6GB 1FL6B 5ICXB 1YJDC 5E2VL 4YO0A 1EJOL 3L1OL 5TQ0H 1Z2KA 4BFEA 2MKWA 3BIAX 4JFEA 3H9SB 2GJ6E 4QEGA 4PRPD 4Y0GA 4QOKE 4KZDH 1CFNB 2FX9L 4I4WA 1DN0B 4MD5A 1MRDH 2AXJA 3WS6A 1PAMA 5GS0C 3FOMB 3QH3A 3MRBA 4HF5L 1N2RA 1KLGB 4NGHL 1S8DB 5FCUH 3O6ML 3VD5A 4JPKL 1ULVA 3HZYB 4OZ4A 2Y72A 4HKBB 4LCIH 3P4LA 3BP6B 2P8MB 2F53B 3NFNB 3VW3L 3P11H 4U6VH 4M6MH 3BP7B 3ZE0F 1H8SA 4LQFL 1F6FB 1EPFA 4BYHA 4NO0D 4NIKB 4TYUA 3QNXB 1YMHA 3DECA 1EEQA 3GFUA 1DQDH 5SWSB 2WIIB 2DBLH 5TE7H 4OLZH 1FZMB 4GRLC 4ETQB 1FL6A 2I9LB 3GGWA 2NY6B 4G43A 4IBLT 5BS0E 1YY8B 4RSVA 5BVJB 4K55A 4PR5A 2F53A 4TQEL 5I1AB 3ZYIA 3UJIL 2ZCLL 5C0CE 5C9JA 3X3FL 3HAEH 1J10A 4UDUA 3HZYA 1RJLA 3VFSA 3CMOH 3HLAB 4WW2F 1X6NA 3AREC 5EFIB 1N2RB 2X9WA 1KG0A 3MRBB 3QH3B 2BC4A 12E8H 4G9FE 5IM7A 4MAYA 4EIZC 4JG0L 3FB6A 4JZJC 1CFQB 4I4WB 4P46C 3WIIL 1MCEA 5E2WH 2ZOLA 3H9SA 5F7HA 4GAJL 3ZSTA 4YXKH 5CFHA 1AY1H 4N8PA 1OPGH 4U1JA 4TTDC 5SWZD 3E8UH 4OB5L 3V7AE 1E4KA 1IGCH 4Z18A 3V5DB 4XC1L 2R23B 4LQ1A 1G7IB 4DK6A 1U8JA 1TMCB 4AK1A 1BZ9A 4Q6YA 3SE4A 3MRHA 3QUXC 3KPQB 3VRIA 4NPYB 4AL8H 1CK0L 5A16B 3SKOA 4UT9L 4K7PX 3MV9E 5E56A 3GIVA 4FQHB 3TIDA 1IAKA 3D3VB 2NW3B 4FQQA 1FNEA 5IW6A 3VXQA 4GAJH 1A6VL 2L7JA 3WNNA 4MYWB 4PJHF 1GOHA 1X5FA 5F1IA 4EUPA 1T6WA 1S5IH 1QSEB 3QUXA 4FQCL 3OPZH 5IJVA 4XX1E 2D4DA 4JM4H 4R3SA 5ANME 3W39A 5J06A 2MHAB 1O0VA 4L8BB 4P9HC 4XVSH 4GBXB 2GT9B 4YE4L 1B9ZA 1BM3L 4PP1D 5BRZD 4GAGH 3SDCD 4LLVB 5C1MB 3PABB 2YD6A 4LSUL 4MNQA 2HH0L 1A1OB 1JF5A 4OIIL 4U1SB 5H2BA 3SKNA 2VZOA 5A3IC 4MNHA 1WBZA 2XTLA 4X4XB 1K8DA 4ZS6C 5JO5B 1DCLA 4OQTA 3I6KA 1B0RA 4GFTB 2V7NA 1QRKA 1BJ8A 3BESR 2VR5A 3RPIB 3SDXA 3P4MA 3HAEA 4M6ML 4DZBB 5CP7A 5FDWA 4EI6A 5E03A 4MSWB 2F5BH 2XQYG 3NFSL 1Q9WA 4NT6A 4BFIB 4MNQE 4G9DB 4QHNA 4P2RA 3CMGA 4G6FB 1JTPA 4U1MB 3LPWA 5GS2H 2H2SC 4JY5H 4QTHB 3ZSSA 4PBVC 2A73B 5HHOE 4BZYA 5IVZB 3MLVL 2ATKA 1JMZA 2VAJA 4YHNA 5L88L 3QQ3A 4J3VA 4LEOB 1S7TA 2VLMD 5DK2A 3EDJA 3QUZC 3BO8B 5HXMA 3PDOB 5EO0A 1YMME 4TVSa 1E6JH 4NOFA 1L0XA 3C87A 4LPUA 3QEHA 3OQ3B 4R2GC 3DURA 4ZUSB 3N85L 4L1DA 4XNZC 3HG1D 2FECI 2ZG3A 1QTYT 3V6FB 32C2B 2BDNH 4BH8A 3BIBX 4FQXC 3WIFA 4LIQE 4JRYE 1MOEA 1YA5A 3FQWB 1D9KD 5E6YA 2WW8A 4JLRA 1Z9LA 4JN1H 4G8GD 3PWJA 1A6UL 5KVFL 2XN9E 3FTGB 1EHAA 1HE7A 1HH9B 2UZIH 4PJIA 3IF1A 2F5AH 4L8CA 2AJZA 4KJPC 2OM5A 2X1OA 2ICES 1S7SB 3NCJH 1VKXA 3WE6B 1YNKL 2FWOB 3ROOA 1QSED 2DTSA 1M7XA 1HKLL 2IBZX 3KR3H 3MRCA 1FNAA 1HKFA 3LPFA 2ICWA 4I0PB 5TH2A 4L29B 5T3ZL 1FGNL 1QQDA 2WBWB 2VLJD 2VDRL 1H5BC 3THMH 1UJ3A 3G6JA 4X4ME 4PG9A 1A47A 1GGYA 3PDGA 3QDJA 4LLYB 1CGWA 4X98B 3HG1B 2EEAA 3LB6C 5A43C 2OR9L 4P5MB 3QO0A 1VADA 4X6CE 3UMTA 4AQ1B 2GTWA 1K4DB 4XNYL 4ODTL 3K81A 3SDAD 3EO9H 1OOAA 1MEXL 4EOWH 5IBUB 1ADQL 2XFXA 4I48B 1S9XA 2AXHA 2R1YB 5KS9F 3F7YA 4XTRD 1NFIA 1DDHA 1UYWH 3BN9D 1W0WA 3BEVA 3QDMD 4KVCH 1EA9C 1U92A 1NGQL 4I5BA 1XGTB 4LDEB 4GXVL 5TDOA 4NSKA 5C0FA 1K6QH 3PL6A 1KXQE 3S98A 3BKYH 5ALCL 3LH2H 2FHCA 1FORH 1T04B 2J88H 3RAJL 4H25B 3SQBA 3MV8B 4GQPH 5F7LB 3MUGB 2VUYA 1NUGA 3LSOA 1Z5LA 3L3OB 5ISZB 4JN2A 1JGDA 3NH7L 2P46B 3ARBB 3GKWL 5EC2A 2A6DB 3HNSH 1BF8A 1UM4L 3HAEG 1VEMA 3GMMB 4L5FL 3L5XH 1BQUA 3F62A 1LHZA 3RBGA 4NUJA 3LMJL 4DAGL 4JFDD 4LCUB 2UY6A 1NGXB 2DICA 3MRJA 4N0UA 4ZPTB 4G7VL 3KWWB 1F4WL 4U6HA 3QIBA 3VRLE 3WUWG 4KK6C 1BFOA 4XCFH 3T0XA 5I15L 2FR4A 5I1CH 4X6DA 4R8WH 1FIGH 5BVPH 1DEEA 1YNLL 5HYJA 3I75B 4NC1C 3T2NL 4Y4HA 1QRND 3FN0L 3MV01 1BF2A 2A0LD 2HFGH 1G6VK 2HJKA 4LLWA 4KKCD 4DGYL 3ROLB 2ZUQC 4KY1H 4C56B 4HUUB 5MHSD 5BW7A 5T3XE 1X5ZA 3GSNB 3QHFH 2VLJB 4JKKA 2DQDH 4NJ9L 2EO1A 3D1MC 3BPNB 1XAUA 3QXWA 1FFOB 5CEZD 4PJXF 2Y36L 1BREA 2DQEH 4HH9B 3LEXB 4NKMB 4PJXB 4R4FL 3MXVH 3SGKC 2B1HL 2KZWA 4OJFH 5MI0C 3O45B 5F89A 1XGUA 3GNMH 2FEDC 5I1GH 2DQIL 5EBMB 2WZPD 5C0CD 5D93C 4PJ9D 2JK5A 4XAKE 2RR3A 2QR0A 3MRNA 4EDWL 3CU1A 5MEOB 1C08B 4KTDL 3T65B 1DL7L 4NOBA 1G7PA 3T0BA 1AGEB 4DVRH 4KTDH 5JXAH 5HPMA 3WSQL 3RIAK 1JYXA 1XZ0B 1ITBB 3BGMA 3CFKB 3DJ9A 4FQ1H 5AD0A 1TVHA 2DQCH 3BH8A 4CADA 4CVZA 4P2YA 3KYNA 3IDJA 1DBBL 4HX1B 4PB0H 1X5AA 1OGAA 2WM0A 2HJFA 4ODWA 5CINL 3VI4F 3SDDC 2YK1H 1Q0XL 1FVEB 3DGGA 4PY7B 1NAMH 3UDWA 1T2JA 4HBCH 4RIRB 4PTTA 1ZWIB 1TJHL 4LKXB 4U7MA 3MMEB 5D72H 3PWLB 1BQHA 2NZ9C 3SGDH 2J8UA 2AKRA 5IESL 5FGRA 1T0PB 1EXUB 4CBPA 3K2MC 5CEYA 5LWYH 1R3HB 3C6LB 3NIDF 1BJ1J 4S1SL 1SJEA 2YA2A 3HZKB 4Y4FB 3VU2A 2PN5A 4D94A 2VLKB 4MDIB 2R0LL 1LK3H 2R2HA 4R7NA 4AG4L 1RZJL 3UDWC 1G7JA 6FABH 1TZHB 1YJDL 2AXFA 2X70B 2Q7NA 3KVQA 5HHNA 1A7QH 3V0WH 1QNZH 3FFDB 1KENH 2VE6A 2ZOKB 1J88A 1S7VB 1YZZA 2UVEA 4JKPL 1A6UH 4PJBB 5KVFH 2BOCB 4EVNB 1V3JA 5B8CC 4C56D 1I3RA 3RVTD 1CIDA 2FX8H 2BNUB 3BE1H 4G8IB 2H3NA 4MB4A 1P7KA 3QUZA 5JXED 1M05B 2F5BL 3V2AR 3N85H 2P7TA 5IEHB 2F53D 4KQ4L 3TJHD 4YHIA 4JY4A 4KDTC 3ARXA 3B43A 4PJ5D 1E6JL 2XQYK 4JFDB 3QNYB 2IPUK 4JDTL 5KSVB 1Q9KA 3MQIA 5HHMB 1HSBB 4JDVA 1GGCH 4C54A 3HNVL 1XGPA 4TRPL 2HTKC 1NC4A 4JCMA 4PGJA 2HT4D 2A9NH 3DTXB 3DTXA 2X4SA 4NO0A 2IFFL 5JW4N 2X4OA 1CVRA 3IVKB 4JDVB 1J5OL 1I1YB 4S1QL 3D6GA 2JJTA 3ZT7A 4PUBL 1K5NA 1LGVA 5KG9A 4XVSL 4I13B 1WAAF 4PV9A 4UUJB 4FRWA 3RWCB 5JDSB 4ODSL 5HYIA 2F74B 5DUPH 4NDMB 5GHWH 4F7CA 5I0ZA 4H8WC 2DKUA 4O51B 3JWOC 2OSLB 1G0XA 4X5XB 1U3ZA 3UAJD 3HZVA 2VSCA 3TV3L 5I1EL 2R0WH 1H3PH 4KFZC 1DBAH 1ZT7A 2Y5EA 1ZA6A 1X44A 5F8QC 5HDBE 4K3EL 4HUKB 4YXHL 3S7GA 5T1KD 1HYRC 4NKIL 3FFDA 4WUUE 4O2EA 1QFHA 3KR3L 4U1IB 5EO9A 1R24A 1UB6A 2XKNA 5C8JB 2ED9A 1T20A 3P77A 1OP3H 4N90D 5GJTH 1N8ZA 43CAB 3MCKA 5GXBB 4FQCH 3PHOA 4RX4D 4G6KL 3ARFA 3BDYL 2PW1B 3HN3A 4KKLC 5C07E 1EXUA 5I74B 4CU6A 4YXKL 2X9YA 4G7YL 5KANG 1CFTA 4JFHE 2XG4A 2MNUA 5F93C 3MMEA 5D8JH 5DUML 4ZFFB 1ORSA 3FQNB 2EDFA 1QZ1A 3CVHA 1FNSL 3DROA 3REWA 1FVEA 3DGGB 4CRPA 1ZS8B 3MV7D 3VJ6B 5KSBE 1U2HA 4MVBD 4AL8L 4S2SA 3KPSA 5DJ0A 2GAZA 3X3GH 4IOFD 3TZVB 5J6GA 2XRAL 5CJ5A 3BGMB 1YUHB 2V2XA 1AGDB 3R06B 5ETUB 3MBEB 5AUMA 4MWFA 4KKBC 4MNGE 3WIIH 5MEOA 3O11B 5HHOB 4ERSH 1U8QA 1F3JA 1K3ZA 1G7MB 3RL2A 3MCLH 4HH8A 2RBLA 4XPTL 1J05A 4K2UH 5HVHC 1JGLH 4Y1AA 1RMFH 2R2BA 1XGUB 4NN7B 1NLDH 1UB5B 3P9LB 1LO5B 1MJ8H 4ODXB 4PJXA 1AFVH 4KKLD 1SEQH 1F90H 2W0KA 4GH7B 3RVWC 2APBA 4DW2H 4QGTA 3B9KB 1KXVC 3S36H 4JPKH 3TBTB 5E24E 8FABB 3LQZB 4XXDB 1ROWA 4GBXC 5T3ZE 2YMXL 3SDCB 1EVTC 3M1BB 4N5ED 1T6VN 4X0KA 5DVMA 4YBHA 3MNVB 2CRIA 4AM0A 1MVUA 3TH2T 4L8SA 3OJDA 1EJ6A 5D5MB 2VNCA 1IGYA 4U6HB 3KWWA 1FBIH 5HHOD 1XGYL 1T0NA 5DEGB 5FHAH 5LQBH 5E95B 3CX5J 5F7KC 2DD8H 2XN9D 3K74B 4FFWD 5D1XA 5F8RC 3LHPL 4LCUA 3H7LA 4P49A 3DVNA 4QRQB 3M45A 3ULSA 4PV8A 2BY0A 4HCRH 5SWQA 1T4KB 2E7CA 3OXSA 4G42B 5JHDE 4ZNEE 1KIPA 5EC2B 3QFDA 3HPJA 1T5XA 5DRWB 3ZE1F 1IL1A 5JXEA 5CILL 1JGDB 3CVHL 3HG1E 3ZHLA 3PQYB 5DK3A 2FX9H 4PTUA 3S88L 5IG7A 2VSDA 2Q76A 1WWAX 1EEUA 1T04A 5L2KD 2OX5A 3QI9C 1BPVA 4X6CF 1RZGA 4IRJA 4XNXH 2YUZA 3V6ZB 1NUNB 3IAGC 5EZIL 1OTSC 4IRJD 3MCG1 4LP4A 3LQAC 1ZVSA 2X6MA 1TZIB 5JIKA 5D2LA 2EDQA 2DB8A 1W0WB 5FGCB 1DQLL 1EEZB 4X8JB 3LD8C 4OM0H 1OT1A 4WENB 1I1AC 4XI5C 2GSGA 3CFEB 3DSFL 1YEKH 1A4KB 4S1DD 2V2WA 4O5LL 5I1DB 3CSPA 4X7SL 1TCMA 3G5YB 4I2XA 4WO4B 2BVEA 2EYSB 4P4KB 2UYLB 4P2CG 1CIUA 5J6HB 2EYRA 5F6IC 5D1QC 1GXEA 4K3EH 5B8CA 2I27N 3GSOB 3IKCA 3SY0A 3UP1A 3MRLA 1C8PA 3CJJA 5IUSA 1T7WA 4KKBD 2KUTA 4ZOAA 3OGOE 3MOAH 5GZND 1XF3A 5CIPH 4PJFE 5M95B 4JDTH 2DMKA 1VESA 4Z6AT 2BSED 4M7KL 1RY7B 1JGUL 2NR6C 3RWDA 4CN6A 3I6LE 3TYFA 3WE6A 3ZTJG 1S7SA 1OAUH 1VKXB 5DT1H 3ULVF 3LV3B 1JNHB 3RA7L 4OIAA 4M1DH 5IWLA 3T0EA 4M1GH 4GMTL 3RGHA 5DA0B 3NPZB 5F9DC 2JB5H 2MWCA 2BRQA 3QO1A 2QSCL 2JF1A 1J86A 4HG4J 1LK3L 2BCKB 2VR4A 2Z31A 4GO6B 3MV8E 1RD6A 5EU4B 1MFBL 5CJ8A 4YHYB 5CZVH 5T33H 3NMEA 4RGMB 4ZO6A 3QRGH 2PXYB 1MHEB 4JFFD 5B3JF 4Y2OA 3KPSD 2PW2A 4Y4FC 4Q58C 1S7TB 3DX9A 3VH8G 3OKMB 4I3RL 3QPXH 5IF0B 3DI2B 3UJJH 5C6WH 2FX8L 2A73A 4JANB 2K1MA 3ULVD 1NAML 3T4YA 4FZ8L 4BZ2H 1E28A 1QD0A 4OAWB 4BSWA 3PHSA 4HS8H 2RQ8A 5DLMH 2FNBA 1HSAA 3SDDB 2J8UF 4P2RD 4KRMB 4E9LA 3X11A 1UWGH 2J88L 5EU7C 2QHLA 5GJSL 2OR8A 3UTPE 4BFBD 5D2LE 4K3HA 4PB9L 4ZUVA 4K3JH 4G8GB 1OF2A 1A1MA 1QG3A 4X4XA 5JO5A 5JXAL 3STZA 3QAZC 1P4IH 4LLUA 4EI5A 5CSZA 3CDYA 4UINH 1CXFA 3VFMB 2BHYA 3GO1L 1CGTA 3ALWA 1IEBB 3QJFB 1A3RL 3PXJA 4QKXB 4YH6A 3PV6B 3CZFA 3FFCB 4DGIL 5DZLA 1QRNE 4KZEH 4MNQD 2GT9A 4ZXBD 1H3VA 4NZDA 4U1KB 4BQ9A 1R3LB 5FHBH 4UMGA 3MJ9A 1H3WM 4YX2H 3RGVA 2ARJA 3G6DL 2E6PA 4LRIC 4NNXB 5IVXA 1I8LC 3QG7H 5IJVB 2WLZA 4Z78B 4PGDB 2W07A 2DQGH 5GS2D 2VXUL 1HXYB 5F1IB 2XXCB 1TVBA 2BHZA 1RUQL 4J4PD 2QADB 3FN0H 1FNEB 4KAQH 2X4RA 3JXAA 4FQQB 43C9B 1YEFH 5L2KE 2NW3A 5CHNA 1Q1JH 3B9EA 4HK3J 3OAZK 5C08E 2VDRH 2C1OA 5F6HI 3VDCA 3WFEL 5KVDH 3GJFB 3QDJD 1P69B 2Z93B 2M8XA 1ZLVH 3KPNA 1I8LA 3GMNB 3QUKB 2DL2A 1LEIB 4NPYA 3EYOA 5IROC 3MRHB 1V05A 4UT6L 3P73B 2EE2A 2VLME 2APTA 4LSTH 4JM2F 4PJ5A 5IGXL 3TT1H 5EH1A 3GMLA 4FTVA 3KS0J 5GS3A 1MFNA 5K9OB 4M1GL 4LSTL 5IBUG 3GKWH 3AUVA 4P5TB 4U1JB 1MJUL 4HC1L 1YQ2A 1OAUL 5DQDH 1JNNH 5F9OL 4ZG1A 5E2UH 1MCIA 4PJHA 3H9SD 2PF6A 2X4QA 3RY6A 4NUGL 1KG0B 1XR9B 5EUOF 1FGVH 2AEPH 3MV7B 4R4BA 4ZAKC 2YD3A 2DLGA 1OWWA 5F7DA 4Y4FD 5C9JB 2P5WE 4R26L 5KVGL 4JQXA 3NZHH 4FNLH 3ZYJA 3STLA 5SWZE 1YY8A 4P5KB 1MCWW 5ELIA 5T1DL 1YC7A 2I9LA 4PJAE 4YWGL 2VIRB 4ETQA 1WLHA 4M7JL 1F13A 3VGAB 5JOEA 3VFUA 4CAGA 1ZA3A 5ITFA 2IPUG 1QLFB 5BZWB 4JREB 2SEBA 1QHOA 4S0SD 1OTTD 5EORH 1CL7L 2CRZA 3AB0C 3MPCA 3C60C 2VLRA 5E7BA 1IGTA 5DMGC 3AVEA 4HMDA 2NYYD 4HKBA 4PYGA 1TCRB 5D7KD 5A40E 2NY1C 4XHJD 3VFGL 5GRYA 2VLRB 2LABA 5FM4A 4MS8D 3FOMA 5DK0A 3GSQA 4P3DB 3GMQA 5T3ZH 2DLEA 4OF6A 3FL7A 4HS8L 5C0GB 2O93L 3MNWB 4B0MM 5ITFB 1JRHH 3CX5K 1IT9L 1KPRB 3VXUD 3HMWH 4O5LH 1RJZB 4LDLB 4ZXBB 5KSBF 1IBGH 3PHQB 5CGMA 5IR1B 4D0DA 4PJ9A 3FOLB 2QQLL 4JB9H 1JZ2A 3OSKA 4F80A 3KXFD 3F58H 5IBTH 2GCYA 3EYSL 3HC3H 1MVFA 1NCDH 2ZPKH 1A6TB 1N6QL 4XI5D 1FG2A 2FD6H 5EZOH 3ULUL 2DN7A 2W0FB 3G5ZB 5C0IB 1FGNH 1AI1L 5JZ7C 3GBNL 4XVUC 4PRBA 1D5IH 2ICEB 4LPTA 4QRRA 2O5YH 4MA3B 5D1QB 4TNWK 3EOBA 4NM4L 4KU1A 5IWLC 4OZHA 4XC1H 5K9OA 4DKFL 4U7KA 4R96B 3QI9D 5C0EB 5E9DB 4OUUA 4OZFA 3W9DA 4HS3B 1EGJH 5I30L 5MEQB 1E6OH 4GRWB 3WNKA 3P73A 2H26A 5I76A 3AU1B 1OTSD 4TNWF 4APQA 1ZT4B 1JGLL 5DHVB 1II4E 3GMNA 3GM8A 4M3KB 4KHTL 2ZUTA 2EDXA 2C1OB 1UKQA 3X12A 2WK2A 3VRJA 5DA4A 4GSDH 4PJGE 4Y16C 3W5NA 1TVBB 2DYPD 1H15A 3CUPB 1NGWA 3PL6D 1HEZB 1HXYA 3QFJD 4PRIB 3RUGB 1D6VH 3IKKA 3X3GL 3ULVH 5IT2L 4PGDA 4YE4H 4QYOB 4XAKD 3ZKND 3FCTB 3UZVB 4WFGD 1DQDL 2ARJB 2I60H 5DWUL 4YGVB 2DQFB 1Z0NA 4PRPE 3RGVB 5FCSH 3D85B 4JZNA 1N0LA 3V4VH 3OR6A 5DUMH 4JJ5A 3EW3B 5FYKL 1GHFH 3PV6A 5MI0B 5I1HH 2P44B 3RTQA 2ITCA 3J7HA 3VDBA 4KPHL 2BSTA 4OFDA 1WBYA 5CSZB 4LLUB 1GAFL 1S9WA 2F19H 1I1CA 3IAQA 4X6FA 2E7HA 1A1MB 1OF2B 4UAOC 1M71B 4K3DL 3T04D 2Q3ZA 4XNQA 4E42B 4PRNA 5ILTL 5TF1H 1ND0A 1FZJB 4OKVA 2X4UB 4IIQA 3OXRB 2A6JA 5HGBA 1HOCA 1LEGA 1CK0H 3IAPA 2E7LA 1XCQA 2UY7A 4M5YH 1PZ5A 1T1XA 3D69A 1QYGH 4LPXA 3QEGH 3M8OH 2VDKL 1JRHI 1DBAL 1R5VB 2V5YA 4OLYL 3CIQA 1AIFB 1A64A 1QEWB 5DJYA 3FO1A 4OCXH 5E2JA 1AGCB 1AD0B 2GK0A 5E2WL 1BJMA 4ONHA 1J0KA 5DD6B 3LB6D 3WD5L 2AK4B 4XXCC 3PNWB 4I1NB 4LDOB 3QNZA 3MLZH 2X4NB 1KIRA 1ORQB 3O2VH 1JV5B 4G6AD 2ADIA 2BVOB 4WJ5B 4ZO8A 3GSUA 4TQEH 3G5XB 5FYLH 3V6BR 1KPUA 5C09B 3V9FA 3MRGB 2K7QA 5I17B 5I6XC 4YUEH 4RRPA 4YPGA 3QO1B 2AS5M 3QUMA 3QDHA 25C8H 4ZFOA 1MUJB 1A5FH 4CMHB 4R90H 3T0EB 5A1AA 5A3ID 1GJIA 5TQ2L 4XZUB 5I1EH 3GHEL 1FZKB 4L4TB 4HV8B 4ODUA 2PCPB 2Y6SC 3ECBA 4YHYC 1U2CA 1CICA 1MIMH 3ARGA 1PVHA 2EXWC 4Q0XL 1FVCA 3E3QC 4LQFH 1KPVA 3FRUB 1DVFD 4K71C 4MQTB 5GGTH 3CSGA 4JEGB 3UJIH 4G5ZH 4NGHH 1IAIL 1RFDH 2FRGP 3MFGB 3QUYD 4UOJA 5F96L 3H3PL 1EUUA 3H42H 3VG0H 4JKPH 1S78C 2OTUB 4H0IA 5FKAA 3CFDA 2C3XA 1HIMH 1ZGLA 1F3RB 2NNAA 1CDUA 1WCBA 4Z7VF 4LARH 1W8OA 4I2XB 4HK0B 3UZQA 4HIIA 3GMOA 1SJVA 3IDYC 3MV9D 3IU4L 1DQJA 4KJYB 5I1DA 1Q72L 4PRID 4BUGA 3WFDL 4ZD3L 3F7QA 3DX8A 3BP5A 1MAMH 3O8XB 2FD6L 4L3EA 1JZ7A 4ZODA 4LLMB 4NZJA 4YXLH 1A6PA 1HQ4B 3PGDB 3ARPA 4LHUB 2JJUA 4HZLA 2EH7L 5D2LF 3C5SA 4M1CD 1G9NH 5BRZB 2NXYB 2PTVA 1A4JB 3OHXB 4XNUL 5CMAA 4UILH 2R29L 4IRJB 5GRWA 1I1FB 4X80L 5H94B 1JRHL 3VFWB 4JRXA 1QSVA 4AH2A 1WC7A 4M48L 1RQ5A 1F4YH 4CGTA 5FF6A 2ZNWA 3GMRB 1F2QA 5IG7B 2DWEA 3JV4B 3BUYA 3VXMB 1H5BB 3NACH 3ARBD 3DI3B 3ZLQC 4F8TA 1KB5L 5HHQB 4F8QA 3BN3B 1ZV5A 3WIHH 3QIUB 3QCVL 2H45A 2HKFL 4EN3D 4HUNB 1T4KA 3NFPB 2F15A 4I2XE 3LRHA 4ZUWB 1GPOL 4F7TA 3MXWL 5EOQL 3P0YL 3KPRE 4EDWH 2UWEA 5DXWA 1B88A 3TIEB 2H2PD 1MPAH 4BZ1L 4ODSH 3LDBC 4U1NA 5ALBL 1PYWB 3WUZA 2GITA 2MQ3A 5LCVH 4HWEH 1IT9H 4JY6A 3Q48A 5E00B 5SWZA 4AMKL 3MNVA 3T8XA 2HP4A 7FABH 2DQEL 4CJ0A 4Z7NF 4H0HB 3D2UA 2V2TB 1N6UA 1U41A 4PRIE 3BJ91 3IETB 4XXDA 3RUGE 3AFLA 2G9HA 1ES0A 2AJXH 1KJVA 4UBDD 5F44A 5HYSG 1BECA 5DJ6B 2RFXA 5FIEA 1SBSL 2APVA 2BRRH 5DD5L 3SDXF 5JW5B 5JOFA 1MHCA 1LE9A 2EKSB 3DV6B 4XRCA 2OJEA 4R8WL 4RFOH 4YDJA 2A9ML 1GC1L 4KI5C 3MJ7B 4OD3H 5HHOA 3VFVB 3IDGA 1JNNL 4NWUL 5KZCB 1A2YA 3INUL 4LLAA 1LK2B 4KH2A 4KUCD 1BBJA 1ONQA 3P0VH 5AUMB 1WBXB 3EDDA 1RIVL 1A6ZB 5HY9A 3D25A 5D7JC 4FG6C 4ZQKB 4F7EB 4FQJH 3LKSA 5E6IA 2Z4QA 4UT6H 2FH8A 2KL6A 2ARWA 1X5GA 5HI3D 3L3GA 4S2SB 1DSFH 4YBQC 1HHIA 1N64H 2QV2A 1HWHB 4XCCL 4ZO7A 1YNLH 2C4XA 3KG5A 2UUDK 1Q1JL 3B2UC 3DVIA 5TGBA 3UTZA 4KKCC 2A6KA 1CS6A 4Y1AD 5F7YC 4ODVL 3CH1A 2G5BB 5D7JA 5J13B 1GL4B 4X4ZA 3S37L 3ZHDA 4NKQB 4OGYL 2PW1A 1YPZB 3MLRH 1YPZE 3C5JB 3D18B 1SYSA 2YRZA 3SJVE 1SMAA 4P23D 4YX2L 3FQTA 4Z0XB 4JHZA 4IMKA 4FQ1L 4O2EB 4QRUB 1NCNA 1CF8H 1NCAH 3ARDB 1V7ML 3BPOB 2FECL 3HRPA 1U8LB 4Z7QF 1FN4B 4PJBF 4P9HH 1QA9B 3LPGA 4HIXH 4JHAL 5FB8B 3EJYC 1ZT7B 4KTYA 4GG8B 1B4JL 2O61A 3SCMC 1X5HA 3O4OB 5MP6H 5GS0L 1OB1B 4KRLB 2KQNA 4PJAF 4O51A 2WBKA 5J3HC 1IGJB 4NKOB 3F5WB 2AABL 1KTLB 2XY2A 5KSAD 4NDMA 5D6DC 2E9IA 2WP3T 5ACMA 3RWCA 3X14B 1BVKA 2X1QA 1UZ6E 3PL6C 3QDJE 1U6AH 1NKRA 3O6FD 3LKQB 2Y4SA 1ZMYA 3B2UD 3D9AL 4X4MA 3WXVL 4BZ2L 4X6EA 2VISA 1UJ3C 4PGCB 5JQ6H 3BSZH 3TWCL 1NC4B 1HHKA 5E2TH 1GGBL 1NAKL 5HGAA 3WN5C 5T1KA 1Q9KB 5KSVA 1OGTA 2B0SH 3SN6N 3ULVC 3P30H 1BJ1H 5BXFB 4K3JL 3IFPA 4CMHC 1DANT 2XQBH 3CXHK 5JUEL 3LQMA 2NX5A 1F4WH 3T0EE 5IVOA 2W92A 2FIKB 3F5WA 4LSVH 1RHFA 4BKLB 4N0CD 3HPLB 1JK8A 3L5XL 3QB7C 1F6AA 4OIBA 3KJ6L 3WN5A 1RUPL 4XP6L 2H32A 2NTSP 1S7VA 3KHOA 3QP3A 2ZOKA 4RMWA 4HUVB 2C3VB 1J7VR 4NQCD 4ZFZA 1A6WH 1J11A 1H8NA 4NN6B 4HSQA 3BAEL 3BWAB 3OAUL 5HHNB 2X70A 3RAJH 3TZVD 4DJMA 2D03L 4XP9H 3RWEB 4HFUH 2Q8AH 4DK3A 1NLBL 1QPXA 2E5EA 2V5MA 4NRXB 4NQXB 4UOW1 5T33L 2VC2H 1XIWD 2DLHA 3O4OC 4RFNC 1U8NA 1CR9H 3ZE2E 1EHLL 2ZUWA 2NY3D 3CFBB 3TT3L 1SVZA 4UTBL 1DE4A 1QBLL 3WYRA 2HRLA 4QRRD 4RWHA 4YAQA 2DIBA 1A6WL 4RFEB 1FO0L 1BM3H 2NZIA 1ZWIA 1CLYH 2GJ6A 5I2IB 3L3HA 3REVA 4X7TB 4CDGC 1FC1A 4FP8H 3U9PH 4ODWB 4X7SH 4NQEE 4YC2B 4Z7WF 3RVVC 2CSPA 4M6AA 4OCNC 1S5IL 1OWRM 4RGNB 4PJDB 4MJIE 2RAMA 3MBED 4LOUD 1A22B 1EEYB 5HPMB 5K9KA 3DUUA 4XPFL 1UM5L 1ONQB 1A6VH 4JFQB 4F37F 1AGEA 2AV7B 2A38A 3LKPA 4L3AA 3NTCL 1U95A 3EOTH 1S7RA 4ZTPL 3SGKA 4NP4L 5ANMA 3I84A 4WHYH 1PLGH 2VABA 1TIUA 2J3SA 1P53A 3NCJL 1TNNA 1I85C 3I6LD 3O45A 5FYLL 1U6AL 2BNQE 3H9HB 5IMKA 1SVCP 5JOFB 1MFEL 1ZTXH 3RI5K 5TFSH 3CVHH 4B50A 1YEKL 4HH9A 4JE4B 5IHZA 1FPTL 1NUFA 4UB0H 1ES0B 4K7PY 4JRYB 2LU3A 4PGEB 4QXUL 3RIFK 4M61B 4HLJA 5FO7B 5DVLA 1KCUH 1JGEA 1WFUA 4L4VD 3S5LA 3FQUA 4JFOA 3F7PC 1JN6B 3ZE1E 4FFVD 4DQOL 1G1CA 3VWJB 5CUSH 1JNLH 4JRWA 3MRJB 3MROB 4N0UB 3S8WA 3VGFA 3P4NB 4YBLB 4GW4B 1A7NH 5D96B 3BW9B 4NUJB 5DJ2A 3O0RL 4CVXA 2PYED 1CDIA 3KPMB 5D1ZA 3V6OA 3OB0H 1EERB 2OBGA 1UXSA 2CLZB 5EOCL 1GZPA 1J18A 3MYJB 4KQ3H 5HHQA 3G5VA 1AFVL 4JN2B 1AY1L 4KI5E 2ORBH 5EULV 1EMTH 2QJDA 1N5YH 3QXTA 5EU3B 4OM1H 1NGZA 5FF6B 4QOKD 4AH2B 1V3KA 4P0DA 4PRDB 3Q6GH 1SEBB 4RGMC 2DWDB 2JJTC 3IDNA 5DJCA 2DJSA 4PJBE 1LD9B 1NCUA 5C0FB 1EHXA 1YN6B 4LK4A 1XGTA 3TPUA 5BS0A 5HGHB 1B0GB 1OAKL 3DX6A 3AMLA 3N1MC 5HYJD 5JQHC 5E1AA 3V6OC 3D5OF 2RIKA 4HMEA 4C58B 1KN2H 4ESKA 3QWRD 3F12A 3QR2A 4XC3H 3HTLX 2BP3A 1S9YB 1NFIB 4HF5H 1QLRB 2YPKB 3CXDL 1BIIA 1KB5B 3H7BB 5DTFA 4Z7OF 1FZOB 1OAQH 1WQVT 4YGAB 5HD8D 4HJGB 4U3HA 3GMOB 1K4DA 4NWUH 3VXPB 1A14H 4P3CH 5T3XH 5FKAB 3WJJC 4LSSH 3MLUL 4HC1A 4OBRA 3U9UA 5C86A 2DI7A 3WS3B 5EBLB 2IMNA 1DQTA 1FNHA 4U2ZA 5GRZA 3HB3C 1IM9D 5D2NE 3BVNB 4NQSA 4WUUA 4AEIH 3FRUA 3EYQC 3F7VA 5C71A 4PJFB 1TJIL 2EECA 4AIZA 3TO4C 4S11A 1CLZL 1FVCB 4OF5A 2Z35A 5GGUB 3NCMA 3PJSB 1CGSH 1D5XB 3FHAA 4LNRB 1OAZL 3ECBB 3ARBC 5J0BA 4HV8A 4ODUB 4RNRB 1XF1A 2KZ1B 4MXVE 4FXKB 1HXMB 3O6LH 3L5HA 1IFHH 1IGCL 4XZUA 2EIZA 3NIGE 4MDJB 3FTGA 3GSVB 3GSVA 1W8NA 4HWEL 5LCVL 4MDJA 1TTFA 4D0CB 4HXBH 3PP4H 4Z7VA 2N4IA 3RVWD 3I85A 3BDXA 4JO3H 1TPXB 5L2JB 4Z0BH 4FQXB 4RNRA 1GGIH 5IBTL 1RAMA 1XGQB 2WBJB 3G5XA 3Q2CA 2Z35B 4KJPD 4NHCH 5GGUA 3VFTA 1GGIL 3GSUB 3LCYA 3KLHC 5CWSB 1FL5A 1U8KB 4UB0L 3L5WA 3CMOL 1KIRB 1ORQA 3QNZB 2BNRD 1G7LA 1A7RH 3MLXH 3QEHB 3SKJL 4GG6F 1A7BA 3PGFH 3UYRL 3VH8A 4Y8DC 3NABH 3QWRA 4ONHB 1P7HL 1AD0A 4LEOA 4YFLF 5HTSA 5EBLA 4YHNB 5AAWA 1G6RH 1F4YL 3JUZA 3WFCL 3AS3A 4LRNL 2EIEA 4OCYH 2XWTB 1FYTD 4ONFH 1J0IA 3JBG7 5EUOA 4FQLL 1B0WA 4V1DB 1XCQB 2ZUUA 1FZOA 4DZ8A 5J89A 2A6JB 1D9KA 5B39A 1KB5A 5FYKH 3DMMD 4OKVB 5IFAH 1NJ9A 4S1RL 4YHZL 1ND0B 3VW3H 4PRNB 3SDXB 3RPIA 3ZO0A 4PLJD 5LXGL 4RRPG 3KXFA 4FABH 5EBWA 4LCIL 4P3CL 5T3XL 5D2NC 1K3IA 2ICWJ 1FNFA 4MNHB 3OAYK 5EOCJ 5HHMD 2B20A 2LVEA 4I0KA 3ULVL 1A1OA 1WWBX 3QCUL 3QXUA 1CCZA 4LLVA 4PREA 3OR6B 2CO7B 4KZDL 4XWOD 1PEZA 4NC0B 1DEDA 1FE8L 1ZHNB 1FDLH 4N9GA 6FABL 3ILPB 2J8UE 1ACYL 2DQJH 5JXEC 1H8OA 1KN2L 3FRPG 2CKNA 3G5VB 4QYOA 1TITA 3A0OA 4NO5A 3HC4H 3EO0A 2MPAH 2F54A 3BW9A 4LAQL 1IGIH 2BVQB 1KN4H 3HUJA 4K8RL 4XCEB 5EIIB 4MXQC 3MNZA 5EZLB 1BX2B 1F11A 2E27L 5FAAA 1TJHH 5FUCC 5BCAA 1RZKH 1G7QB 4GKNB 5I74C 3B8YA 3S4SG 1RJYB 3W5MA 3S5LB 3TT1L 3K0WA 2AI0L 1AJ7L 3B8SA 3KPRA 1ZT4A 3MJ6A 3ZMRA 2YR3A 4OD1H 4GAFB 1YEJL 1T7ZA 5I73C 4JFXB 5I76B 2FHBA 3HR6A 3PF2A 5GGRY 4TPRH 2RJMA 1SBBA 3NN8B 2HFEB 4X9IA 4Y2DD 2DYPA 3MYZA 3OKOB 4IMLA 3WD5H 2B0SL 4PJ7E 1HH6B 3EUUA 1BWMA 2NY4D 3QPQD 5AG9A 3EZJB 5D1QA 3VI3F 3FN9A 1IC4H 3FB6B 1YYLH 2XZCL 5IIEA 3BSZL 2CK0L 5FDYA 4BQCA 3RHWK 2LU7A 1DBJL 4HLZH 1Q0XH 3HLAA 3GNML 1U95B 4X9BA 5EU5A 1J0HA 1FG2B 1SMOA 3RX7A 3U46B 3G6DH 2AV7A 1UXWA 3TJEH 4R4FH 1YYML 2FJFB 5EO1A 4PR5B 1GIGL 5TDNA 5D1XD 2H32H 4LPVA 5CCKH 5LGKA 4HUWA 3FOLA 3BEWA 4PJ9B 3EOTL 5B4MC 2Y25A 4A6YH 3NAAL 4JO4H 5DJDA 2JIXD 1KV3A 1S7UA 5C6PB 2FIRT 3MNWA 3LDBB 4WNQA 3C5ZC 2Y1VA 4B7LA 3IJYA 1Q9LA 3NCBB 1D5BB 5I15H 3K80A 3BP7A 3MO1B 4YIQA 4PD4K 3DXAB 4D9RE 3NZ8B 2IWGA 3BP6A 5IMLA 4OZGE 3GSWB 4H1LH 4NNYB 1IGTB 3HNSL 4HUMB 4PJ8B 2P4AB 4FFWC 4NZTL 1SM3L 4G6FD 5D71L 1OQOA 2D0GA 2EYTB 5DGRA 5H37H 2BMKA 4M7LT 2NY0D 4IRSC 5E5MB 1FNGB 5BZWA 3BWAA 4JFEB 1JUFB 5CJOL 3L6FB 2NW2A 4J3XA 3W9EA 3UX9B 4HUVA 1K6QL 2YUXA 5FYKD 3VMOA 1IJ9A 3FONB 1ZT1A 1CYGA 5M7QA 1LO0H 5FGBA 3QI9B 2Q86A 5DZNA 2CO6B 4P5KA 2Y06L 4YHMH 1DR9A 3GB7A 3O6KL 2F54D 4UV7H 4RGOH 4BKLA 3JTTB 4MHHG 3FN3A 1T1ZA 3T0VA 1VDGA 2GSIA 7CGTA 1KFAL 3L3KA 2G60H 3VFPA 5EOTA 3MV7A 4WY7L 1TETL 3BPOC 3MTRA 1EBAA 3MRKB 4WHDA 1ED3A 2KBGA 3MRIB 3CNKA 4Z95L 1PFCA 4QY8A 4NQCB 1J9CT 4PRHB 4RMTA 3KYOB 4EBQH 5BJTB 1K4CA 2YEZA 4FXGB 4X7CC 4GOSA 4H20L 3WFEH 4LRIA 4RX4A 1NFDE 2CRMA 3K8MA 5FA3B 2ZSWB 4UNUA 4PJEB 1DVFB 4P2OD 4M7LH 5BV7L 4JFEE 4IJ3B 3SE3C 2ERJB 2AJXL 3SO3B 1CZ8L 3OL2A 4AZ8A 4JFPB 5EPMB 1T1YA 2CMRL 3HNTL 4NRZB 3EJYD 3I2CL 3GMPB 4FXLA 3T2PA 5GGTA 3DSNA 3PG2A 4XNYH 3RNQB 3C09B 3T0ED 3MLYH 3LZFH 2AEQL 1PLGL 2VQ1B 2EXYD 5DD0L 4FTVD 1FL3A 1J0JA 2CLVA 3RVUC 3IJHA 3FT2A 4RGND 1YEIH 5IVXB 4P99A 1AE6L 1UA6H 2EDLA 5DD1L 5DI8B 3BZEB 3O2WL 3SDCC 3E0GA 3KJ4C 4P23C 1CGUA 4GS7C 1OT2A 2CXKA 3N9GH 5CD5D 1EZVX 3FFCA 1JNJA 4K71B 4WWKA 5SV4A 5EORL 4M9PA 3QJFA 3IDIA 1G9MC 3PWNB 3S88H 4XBGA 1SQ2N 1I4FA 4PJGF 3VXTA 2UZIL 3ESVF 4OGAC 2C1PA 2OCFD 3GBML 4XWGH 3ZDZE 2PO6A 1MY5A 4MX7B 2IADA 2CMRH 3MLTB 4RAVA 4TUJB 3SDXE 5IJKC 3JVGA 1D5ZA 3MA9L 2VXVH 2WUCL 5T1DH 5FGCE 2HKHL 4GRWH 3RZCA 3O2DA 3U0TB 3DRQA 5BOPA 3L3GB 3X11B 3ZL4H 1JPGB 2J4WH 3CCHB 4UZGA 3H3KA 1YECL 2DD8L 2LE9A 1TPXC 1A3LH 4L8SC 4LEXH 2HTLD 5E7FA 2HVKB 4LSPL 1HQRA 1N6VA 2Z8RA 1BVLB 3WIHA 4WI7A 1TJGL 3NGBB 1IMHC 1N26A 4WRLA 1RK1A 2IALB 1BBJB 3UTTB 4BK5A 4EI5D 5IF0A 1IAOB 1MCPH 1P5UA 3QT2A 4WI4A 3VFVA 2PYFA 5IKCA 4S1DC 4WFEE 2GI7A 1MHEA 1T7VA 4GMTH 4YDJB 1KCVL 3KYKH 3U1SL 4DW2L 1SM3H 5F96H 3W11D 5FO8A 4M4PA 3MGAA 3DV6A 2EKSA 2LTQB 3O2DL 4XRCB 3EFFB 1WISA 1RPQA 3JWDC 1B90A 3INUH 1W72A 1NLDL 4JGUA 3CFJA 2RFXB 3UPRA 1F00I 4ZTOH 3SKUD 4M62L 3MJ9L 4PJAB 2V2TA 1J1XH 3AM8C 1UH2A 3LV3A 3T8XB 5JPNA 4WO4D 2WIMA 2NX5E 4CU7A 2Y7QA 1CDYA 1U91A 1X9QA 3NAAH 1WAAA 1PYWA 25C8L 2VAAB 4NCC2 5HYQA 3MX0A 2VDML 2XPGB 1EAPA 1U0QA 4YHLH 1VENA 5IQ9B 4HHAA 2UWEB 2JTDA 1ZHLA 3O3AA 2AK4D 1KLUA 5E0QA 2RCSH 1L6ZA 4FQ2L 4JPWL 2QQNL 2R0KH 4BK4A 1ZEAL 3K7UA 3MLZL 3O2VL 5J9PA 5C0JB 3IKCB 3SY0B 3S34H 2PYEA 4OM0L 1OM3L 3E8UL 3VRLF 4QRSB 5D7JD 3D3VD 3ULUD 2AK1L 3H6JA 5D7LD 4GW5B 4FZEH 3U4AA 4BZ1H 4QHMB 5C0CA 2CIKA 3RKDC 3WO4B 5JMRA 2Q6WB 5CMAB 4J8RA 1JGVH 2YWYA 5CJXC 4LHQB 3IDMA 4UTAH 3ILQD 1U8IA 4P9HL 3CSYB 4P59H 1WZ1H 4Z8FH 2GQHA 3GI9H 4H0GA 1E0OB 4OCSL 3ZT5A 5INDB 4M1CC 1HQ4A 5D2LB 1G0DA 4MLSA 1WTLA 5TF1L 3U0PA 5ILTH 1ZVSB 2QQKL 1MNUH 3BP5B 3DX8B 1I9EA 4KTEH 1FC2D 2PXYD 4U1LA 4D8PB 4XMKL 4NQUA 4EQ3A 3GUTA 3MGOB 5CJQL 4J8RB 2Z91B 5HI5D 3V6ZA 2CK0H 5DRXB 1RZGB 1DQJB 4KJYA 1EFXB 4K23H 3FQRB 1QRNB 1RV6X 3FB8B 4OZFH 3VXRB 2F9BT 1WCBB 5I1HL 2NNAB 4OLVH 2APXA 35C8L 2K7PA 5CD3B 3BD4A 4N9OB 3UTSE 4OI9A 3ZDYF 4X99A 1OW0C 1WGOA 5JPMA 4TOYH 4GRWE 2D7TH 5CBAB 3PWVA 4FQIH 4G42A 5DD3H 2IQAB 2VB5A 3QUYC 3UTSD 4OF7A 3LQAH 2CH8A 3TBVA 1ZHLB 1DQMH 4EN3C 4HHAB 5I75B 4CVWA 1UCBH 3BD5A 5K59E 3MRMA 4ENED 1CDJA 2HWZH 1UG9A 2IMMA 1U91B 2XT1B 3SGEH 4L8SB 3RL1B 3U6RA 4XBPB 4XCNB 5DYOA 4GUPB 3HMXA 3EAKA 1EVUA 4OFPA 2GJ6D 5ENWB 2EH8H 5C3LD 4YHOH 2MPAL 2XA3A 4EUPG 4PJAA 4IOSD 4K9EH 2R56H 2VDQL 4OCRL 4TNVF 4YPGB 4ALAL 2YD1A 4LVHC 4QRPE 3HS0A 3VE0B 1SHMA 4D3CH 4K7PH 4I18C 4G8FA 3CLFH 1NMBH 4GAYB 4XVJL 3SDAA 3T4AA 1FNLA 1QUNA 1EGJL 3Q5YA 3CC5B 1A6AB 1KBGH 1ZLWK 2X4NA 3IFOA 4P2QA 2J6EL 3C8DA 2DMCA 2R2EB 3DNKA 4JR9H 4E41B 1G7MA 4Y89A 1IKFL 3SJVB 1R3JB 4XXCA 3NCYS 4PLJC 2UVFA 5C7XL 4Z7NE 3S96B 1AIFA 4LVOC 2WAHA 2IALA 5FUCE 1DLHB 5GGSB 1I7ZB 1TDQA 1NBVH 4EZMA 2EEDA 5ETUA 3VWKD 3MLXL 1KULA 1KIUA 4YHZH 1CN4A 1DQLH 1XIWC 4OZIE 4JM2B 2ITDB 4QGYA 3L95A 5SX5H 3N1FC 4Y19D 2ZCKL 1I8IB 4LCYB 1F3DJ 2DMBA 3DRQB 3BMVA 2FHFA 1ZSDB 3V4PL 1S7XB 3MV9A 4PRAA 3EOAB 4LMQI 5ICZA 3DROB 3REWB 1D5ZB 1I9JL 4XNQB 5GJTL 4RAVB 1LVEA 3FQNA 1OP5H 4UIMB 2B2XH 1MAJA 2CDEA 5FA4B 3D3VE 1F4XL 3WFCH 3CSBA 3QHZL 2IAMA 1CBVH 2F58L 1CFTB 4LCCA 2G2RA 1I4FB 1MCHA 1AR1C 2ITCB 4H1LA 2HRPH 3OX8B 4JPVL 1PKQB 3RDTD 2ZUVA 2PO6C 1AO7D 4WWKB 3ARFB 1IQDB 2LFGA 2J2ZA 2R29H 5EUKB 1CLZH 1N59B 4P59L 2XWBB 2EKJA 3ZKNC 5KSAB 3MCKB 6CGTA 2DQFA 4JRXE 2NXZB 4E41E 3MUY1 4NJAL 5ESQB 3FCTA 2O5XH 4BQBA 3DHMA 2AV1B 2BVPA 3L3DA 1I3UA 2VDQH 3F8UB 4OCRH 2VQ1A 3PP4L 4HXBL 3UAJC 4WCYH 5DDHB 1UFUA 3C2SA 1IFHL 2F53E 3HZVB 4JPIB 1JF1A 4NRZA 5E99H 2VOTA 4N5UA 4XHJC 3HE7A 1GGCL 2VDMH 2COQA 1FCCA 2F74A 2HA1A 1HNGA 5E4EC 3UTTE 2DQHH 1U3HA 4LLDA 1YNTA 1KBGL 3UZEA 2OZ4H 4NZUH 5DD3L 4PJEA 3UROR 3AU1A 4PV9B 5KG9B 5MEQA 1QBBA 2NLJA 4MB5A 2CJUH 2VDNL 4FG6D 3WEXA 3U7WH 5FKPA 4R96A 5C0EA 2XZQH 5HDQL 2YRLA 4K2UL 5IFJB 3T3PE 1M1SA 4U6XA 2HLFC 2YEZB 2E9WA 4Y5YA 5BJTA 3MACL 4HK3N 4MA3A 4J3OC 4FFYH 1J1PH 4QY8B 3C6SA 4PRBB 2NY5C 3HFML 4HWBH 3MRIA 3SE8L 4YLQT 3FB5A 3L7EA 4HIHB 2G75B 1TFHA 3B83A 5EOTB 4JY4B 3VFPB 1J1OL 2I07A 1A6TA 1MCKA 2XRAH 4HDIB 1M05A 3JTTA 3DVFA 1MCCA 4QRTA 1CE6A 2NY0C 2AJUH 4Z9KB 3SCMB 2GTZA 4LVNB 4ONOA 4P46A 1MRFH 4PJ9C 1TVDA 4OLUH 2DOCA 5BQ7B 3QDGB 5C0AE 2JIXA 3HI1A 4XP5H 1SJHA 2W38A 1BLNA 4BH7A 4NYLA 3AS2A 5C08D 1E4KC 1NDMA 1FNGA 4FZEL 5K93A 3MV11 3H0TB 3G9AB 1KYOK 2PUQT 3VG9B 3V0VA 2LQRA 4HBCL 3SE4C 5CINH 5I1IL 2H8PB 5L8LB 2QQLH 1AQKL 4JM2D 4NNYA 1P5VA 1U36A 4HJ0D 3C60D 5CEYB 1DLFH 5BZDB 2X4PB 5DSCB 1IM3B 4FOMA 1U9KA 1IGMH 4R6UA 2VITA 3AC0A 2NYYC 4CU8A 3K1DA 3PWLA 2NPLX 4TSBL 4E5XA 2K3TA 4L9LC 4MAYD 4PTTB 1D5BA 5C0RL 3IFNL 2SEBB 5IEKB 4E0RA 1JGVL 1E27B 1RK0A 4I3SH 5LBSH 2Y9RT 1MELA 5CGTA 5T3XD 5DD1H 2W9DL 3KLAA 4TUOB 1FFNA 2J6EA 3GI8H 1L4IA 1M6OB 2FSEA 3O81A 1CE1H 5DJZB 5FECA 2VH5L 2GW5A 3VGHA 3BEWB 3BH8B 4HUWB 1I9IL 5T5NG 2JJSC 4A2LA 5CLWA 1JI2A 2X10A 2OL3A 3V5KB 2XTJD 4MMZC 5DWUH 1I7TA 3TO4B 4Y88A 5B38A 4Q9QL 1UJTA 5F21B 5IHBA 2NXZC 3Q0HA 3QEUB 4RMRA 4YR6B 4WV1B 2JK5B 1D6VL 1I9RH 2X4QB 2W91A 3AXLA 1JWMB 1YY9D 5C0AD 4KY1L 5F89B 5B38G 5L6YL 5DEFB 1VGEH 1Y18B 3VGBA 5I1KL 4J4PA 3LEXA 4NKMA 3BGAA 3OKOA 3WMSA 1WFNA 1R3IH 2DYPB 3MSPA 2BJML 3QQNA 4HJ0C 5IHUL 5IW1A 3FZUC 3FB7A 3G6AA 3LS4L 4ZNEA 3IFLL 2VLJA 1JZ8A 1T03H 1YECH 3GSNA 1QSFE 5I1KH 4PP2A 3BXNA 5ITBH 4OF3A 4YK4B 4ODHL 3RRQA 1BFTA 4WI5A 4CNIB 2NXYD 3VXUA 3I75A 1DEEB 4X6DB 4UV4L 3U1SH 4WI2A 1BOGA 4DKFH 1VEPA 4MJIA 5CHNB 5FUZL 4X6DE 2FYYA 3RA7H 4XPAL 3T3ME 4IIQC 4F9LC 1UWEH 5TDPB 5C07A 3H8NA 5F3HA 4M7ZB 4UV7L 2A83A 2A77L 3A6CL 3ARSA 2R1WA 3GBNH 3VFOB 2CUIA 4R97C 2PKDA 4DFIA 3NBNA 4PLKD 1LO3H 2HJLA 4I0CC 5GSVB 2YKLH 5JIIA 3WO4C 2D2OA 3L3OA 3LSOB 1PX3A 2IANA 4Y4KD 2IG2L 1INEH 4MGXA 1L7IH 1A21A 5D72L 4PLOB 5DURB 3CZFB 3QHTC 4H8WL 4KK8D 1VEOA 3MLYL 3RBSA 3ZKQD 2CKBA 3F65A 4Y5XB 5D5MF 4NSKB 5DVOA 2DM4A 4L4TD 4EI5B 4G9FD 2FJGB 3MR9B 1U8OA 4LCCC 2NR6D 5D7LE 4KRPB 3LKRA 5EBWB 1BEYH 1A7PL 5FV2A 3VWKC 1KB9K 1NEZA 2JB6A 3W81A 3F7YB 4KUCF 1AO7A 3KNBB 5B39B 1CFSA 5I8OH 3IGAA 5T3ZD 4DZ8B 4V1DA 3UPCA 4L9LB 1T80A 5ID0B 4DGVL 5EZIH 1E28B 5HHPA 3TCXA 3FO2A 4XPBH 2EIDA 5F1NB 5JQ6L 4JFYA 4CVUA 2VRAA 1LO4L 4EBQL 5GJSH 1J12A 4X98A 1CF8L 3QWOB 2KKQA 3MOBL 4K9EC 2I9TB 5KTEL 3G6JB 1UJ3B 4AEHL 1EUTA 4WY7H 1IQWL 4UV4H 1G7LB 1IM9A 4WU5A 5EU4A 1DUYB 5INCB 5D6CA 4QXGL 4HWBL 1KCLA 3MRCB 4GKSB 4HCRL 1Y6KR 4MA8L 4XNMB 3D0VB 4G3YH 1BD2B 5D7LB 2IH1B 2DQTL 1KXTB 5D7IB 5DS8B 4FQXA 5L2JA 2AJZB 4ISVA 5I0DA 1T66D 4ODVH 4O9HH 1B4JH 3EDEA 3UBXA 4JVUA 2P5WB 3QEQA 5C0AA 1R3IL 5C0AB 2ADGA 3SBWC 4XCFL 2P5WA 5C0BD 4IRZL 2AJUL 4JLRB 1BQLH 4O4YL 4LCWD 3K2UL 1JP5A 1MWAH 2VXTL 3RWGA 3BRFA 2A2QT 2P8LB 4M8QB 4POZD 5D7IA 4BH8B 5ISZD 3RWDB 1J1OH 2NXYC 2R69L 4YHKH 4BSJA 1JTTA 1F58H 2VLKD 1DN2A 1IM9B 1U93B 3RGVD 1T89A 2K9UA 5BRZE 4NQSB 1WIOA 5ADPH 3UBXI 3K1KC 4RGOL 2BSSA 3OGCA 2ATKB 3GSOA 5IVZA 3MJ8A 5HYSA 4JFYB 4N1CA 5F1NA 3RY4A 4GQ9H 3WDIA 5GGSY 3FO2B 5B4MD 3P11L 2VH5H 2UUDH 4TN9A 3EIFA 3WDJA 2EYSA 2OLDA 1FFPA 3G5YA 3U7WL 4HJGA 1VFMA 3S6CA 4I3SL 5LBSL 1D7FA 4DVBB 4Y4KC 1TNMA 5D1ZD 1WVZA 3H7BA 5DTFB 1FCGA 4KK9C 1BIIB 4GAGL 4YDLB 4TULL 1VA9A 4MD4B 5F88A 1QO3A 2JB6B 1S9YA 4OSUL 2XIDA 2V7NB 1ADQH 4NBZB 4Y8AA 3QG7L 5JW4M 4J23A 3DX7B 2IBZY 3JV0A 3LKRB 1C5BH 3HR5B 3PXHA 1JHTB 5C08A 1EZVY 1NDGA 1I9JH 2CKBB 1LD9A 3V95A 1NMAH 5JA9A 2YHGA 5IB1A 2IAND 4Y4KA 4M03A 3IXTB 5DRNA 1IEHA 4C56E 1EDQA 4PRPB 1NCCL 1NGZB 4ENEC 1NSNH 5CGYC 3VXSE 5EU3A 3E6HA 4PTUB 4XPHL 3V0AC 1NC2A 3C8KB 1P2CA 5JLZA 5E8NA 4X6BA 3MYJA 1IL1B 1PGRB 3BIKB 4Y5VC 4ONFL 3VXSD 3I50L 2JJSA 1XFPA 4YDLC 3PWPE 3OXSB 4PJ7A 3NPSB 1KB5H 3V4UH 5SWQB 5F3HB 4PS4H 3VA2C 5D1XB 4GW4A 1AJ7H 2HRPL 3K3QA 3KGRA 1GZQB 1MJJA 1HWGB 1LP9E 4Z76B 3VWJA 4YXHH 3DUSA 5D93B 5D5MA 3D3VA 4AIXA 2GFBA 2BNQD 5E8OB 4NQVB 4WIQA 3VD3A 1KYOJ 2VERN 3GRWL 1G9NC 5JMOC 5CP3A 1YEHH 4ACPA 5JZ7D 5FOJA 2Y6SD 5TPWH 3ISWA 5AWNH 4MCZB 4OGXL 3NIFE 3MRRA 4K7PL 5GS1C 3VI3E 5FV1L 3BXNB 2Y23A 4YQXH 4ZOCA 5EZJB 4PGEA 2Y07L 2L4OA 3HE6C 3LRSA 3HC4L 4HWZA 5JHLL 3LQZA 1KEGL 3FB7B 2FLBT 3G6AB 5IW1B 4JKMA 2R4RH 3U30C 4QT5A 2OQJA 4FHBD 4EKXA 1K8IA 4N0FA 4HEME 4X7DC 5IMKB 1IKFH 3BZ4B 1MLBB 4P57A 3P9LA 4N0YH 4WTXA