1FZMA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
273
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of K(bm1) and K(bm8) reveal that subtle changes in the peptide environment impact thermostability and alloreactivity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 76
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fzmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1fzmA01
5HPMB 1VSCA 3OB0H 4U1IB 4OI9A 4NPYA 4XCFH 4MVBA 1L7IL 2H6PA 2X5PA 2XNAB 4HUUB 3CZFB 4Y4FA 1MVUB 1S7UB 3NPSB 5F6HI 5IMKA 1YMMA 1Y6KR 2MKLC 3OKLB 2CRIA 2F15A 4W70A 4MQXD 4JRYD 1YEIL 5CP3A 3DMMB 3NCJL 4NJAH 5EU5B 4Z5RB 4EVNB 1X5FA 5EOQL 4NQSA 5IVOA 1FG2B 4GBXA 4MMXC 5HBBA 1IGTB 4XNYH 5BVPL 3SQOL 5GRUL 3RWEB 4OLYH 1KEML 3QQ3B 2B4CC 3FQXB 1ZS8B 3SGKC 1L6ZA 5M94B 4M62L 2DD8H 1AI1H 3ZDZF 5F7KC 4GG6A 4GS7C 3SGJA 1BECA 5D6DC 2FEEL 4GKSB 3TNNB 2WY3A 2H41A 4IOSD 1LK2A 5ESQB 1EXUB 1KTRL 1TVBA 3B9KD 3H9HA 4P57A 3OX8A 5DMKA 1F3DH 4FP8L 1WLHA 2XA3A 1QQDB 4JKWA 3TGXA 3LD8C 3VFTA 4Q9RH 1A4JB 1IT9L 1TIUA 2A74B 1KCRL 2C3HA 5EFIA 4BQBA 3QIBB 4QXGL 4U33A 3ZDXF 3CCHA 2FX7H 4OZGA 3GKWH 2IQAA 4P2YA 3IS1X 4X5XA 2R69H 5GHWL 1JPSH 5E2UL 3WJJC 5C0EB 3BE1L 4XP5H 2H6PB 2FH8A 4QHLB 2VAAB 3VD5A 1UM4H 4OD1L 5KJRL 4HEME 1GH7A 1QG3A 3MLWL 1RZKC 1S7XB 3LB6D 4MVBD 3EFFA 4U3HA 5CJBA 4MDIA 3RGVD 5HD8C 4C56E 2BHYA 1ZT7A 4OAWB 4NQDA 4MSWA 4IJ3B 3QEUA 5KW9H 3OAUL 3SY0B 1MRDH 3O8XA 4L9LA 5GGTA 5GZNC 1WBZB 2RQ8A 3IAGC 3C60C 4DTGH 2FDBP 5FYKL 5B38B 1U8HA 3GSQB 2PTTA 1OP3K 5I9QC 5ESVA 4M8QA 2VO5A 2Z31C 4Q9QL 4N9OB 2C4FT 2R4SL 2X4OB 4HGWA 3OKLA 4QRSB 4NOBA 3PL6A 2W9LA 4PRPE 1LEKA 3UTZB 5E9DD 4MWFA 3VXRD 2ARJA 5GRYA 2HFTA 4LAQL 5EN2A 3CGTA 2RR3A 2FX7L 3QEQA 5ICXB 1UM5H 4JO1H 3ARDB 3ZT6A 1FG9C 2B1HL 4Z7UF 1ZT1B 2AGJL 1LP9F 2GTWA 5CKGA 2VITA 3B3IA 1BZ7B 4Y4HB 1G9NH 3BKMH 1DBKL 4AG4H 3QHFL 3GSRA 1NBYA 4KFZC 5ICZB 5FKAB 3S34H 4BZYA 1F11B 3MJ9L 1VCAA 5I1HH 4P2OA 3VXRE 3JUYA 3QUYD 1K3IA 1XGPB 2XQBL 2VZOA 3FO9B 1OP5K 5INDA 4IBLT 5CFHA 4FQHB 4DGIL 1J88A 4U1NA 4U1JB 4KJYA 3U7WH 2J8UE 4K7PL 2DMKA 5D7JD 2QQNH 3RPIA 4V2CB 5CGYC 2EC9U 1RMFH 2YPLA 3RVUC 1OSPL 3OTTA 4MXVF 3U9UB 4HS8H 4WU7B 1ZHBA 2VLJD 4NQCA 4JFDA 3Q6FA 2J88H 5J57B 3MCLL 3VXTB 4C56D 1G1CA 4M6AA 4KMQA 4TUOA 1U9KA 3G6DH 3X3GL 2X4OA 4HGWB 4DUWA 4Y88A 1S7QB 1R3HA 1RFDH 1J0IA 5F70A 4Z7QE 2BNRB 2J6EL 2V5YA 2HLFC 1I8LC 1BHGA 4KK8C 3SCMB 4HFWB 5LCVH 3LQZA 4QRQA 4U1NB 1MFCH 2X9WA 4HWBA 1OAXH 3L3HB 3MLYH 5HVHB 3O9WA 1P69B 4TOYL 3WUWG 1CFTB 5I73B 4LASL 3BDYL 5I8EA 1LVEA 2DTSA 35C8L 1KPUA 1AGBB 3GMNA 4R90H 1DQJA 4L4JA 1DLHA 5DJDB 1ACYH 4XNQB 2F58L 5KZCD 1S7XA 1GC1H 5D2LF 1NGZA 2DLFH 4K3JL 2GIYA 4XNZB 5HGDA 1G1YA 3WNPA 1S9WA 2CIIA 2NQCA 2GYSA 4X5LA 2BSSB 1D6EA 3MLZL 2GSIA 4YDIL 2PR4H 4QNPE 2LU7A 3WCYA 3UJJL 4Z95H 4EQ3A 5C6WH 5J13B 2EICA 3EBAA 4PJGA 1N6UA 5IWLC 2IMMA 1J05B 4H26B 3O9WB 2JELH 3L6FB 5HY9A 1T83C 4J4PC 5CILH 2P5WB 1T2XA 2AXHA 5BMFH 5F97E 1ND0B 4N1EA 2DF3A 2OTUA 4MD4A 3RUGB 4MJIA 3KHOA 1YEGL 3DX7A 4XP9L 3DHMA 1U6AH 3MV7E 3RWDB 1FAKT 3SDDC 3QDGD 4G8GB 1B2WL 4G9FA 4NQCB 2ZOLB 1LO3L 1T22B 4PP2A 1DBAL 1KJMA 4M43H 5I30H 2R0WH 4PJFF 1FO0H 1MFCL 1I4FA 4PRAB 3OV6A 3SDXF 4WU5A 3JWNC 2VIRA 5I1GL 5SWZB 4FZEH 1PQZB 4JM2D 1MWAL 4JANA 3UEZA 1CDYA 4PY8J 1CS6A 3O6KL 4DGIH 2G75A 5E9DA 3V6OE 3BKCL 3ZE2F 2DBLL 3O2DH 4P3DA 1PZUB 4RA0C 4Y0GA 3WKML 5FDYA 1RIVL 3VWKB 2YSSB 2GJ6A 3LEVL 1XCTA 3V5HB 1OAZH 1LE5B 3JZ7A 4N9GB 2VDRL 4H1LA 1L7IH 1KB5L 3L95A 3EJZC 3UP1A 3RHWF 2NY5C 4NCC2 3RKDD 3VI3E 3NACL 1SY6H 5I1DB 4PJFB 1A14H 4JFHE 1D6EB 4HCRL 1KIRB 4NHUB 4NQDD 3SDAC 4CDHA 4KAQH 4F33B 4JFEE 5EBWB 2YPVH 3KHQA 5DLML 2E6JA 2DQHL 3UTPE 3U4EA 1OAUH 4HIIA 2CDFA 1S5IL 4JEGB 2IMNA 4M48H 4P57B 5DRZB 3S5LA 5CGMA 2CRYA 3MJ9A 3H7BA 2YD7A 3P0VL 5IW6A 4O5LH 4M6OH 3ZTNH 5GZND 3ZL4H 1G6RH 4YPGA 1BWMA 5TDNA 4UV7L 2HFFB 4HDIA 4DKEL 5I1IL 2VXUH 4H25A 2IC2A 3OGCB 1F6AB 5C07D 2IAMD 5J8OA 3HE6B 1FE8H 3MRNB 4QXUH 2ICES 4MCZA 4XC1L 2BVPB 5GGSY 2PKDA 5HDQH 3TYFB 2ATPB 3IU4L 5T3ZH 3SE8L 3MRCA 5ACMA 3PQYA 1TNMA 4OLWH 1U8IA 2XN9E 5DR5H 3VXPB 1XGTA 2WUBH 1Y18B 4UBDD 1KCRH 1WIOA 3LCYA 2X4RA 5H8DA 3O4LB 2KKQA 4ZAKB 2OR7A 2HT2C 3DIFB 4FQQB 4JN1H 4PJAA 3L7FA 1XFPA 3FRUB 4IHOB 5GRUH 1IKNC 4FFYH 1U58B 2BVQA 3HAEG 3MSPA 4PRHE 2F5BL 3M1BA 4HF5H 5HYJB 4M00A 4P2QB 1MIML 4G6KL 3C8DA 4TULH 1R0AL 2MQ0A 1RU9H 4KAQL 2ESVB 3P4OA 1C16A 4R7DA 4JFFE 4YIQB 2GUOA 2KPNA 2A0LC 4JHWL 5JHDD 5C6TH 4F37K 1B90A 5JO5B 5JW5A 4F7CB 1VEMA 5T3ZD 4PB0L 3HG1A 2XACC 3HZMA 5ALBH 4CNIB 5IB1A 5A2LH 4Z7VF 5IB5A 1WAAF 3RWHA 3TCXA 1IC4H 3NCMA 1FNSL 3DX9B 5JNYB 5I17A 3MGTA 4MGXA 3IFOB 4ELMB 4JFFD 4MD4B 1OAZL 1J1OH 5F9OL 3RUGA 3VXOA 3MRNA 5H35B 2AJYH 5LKNA 5I75B 2CLRB 4ZFZB 4G9FD 2Q7YB 4X6FA 3PDGA 1TJGL 1D5IL 1CD9B 2J4WL 2J8OA 4G80A 5FHBL 3VXSA 1JWSB 4MD5A 5BO1L 4K7FA 4JO4H 1XGUA 3JV5A 4AQ1B 1FL5A 1IFHL 5IV2B 4Q2ZB 2AKRB 3GO1H 2H3NA 1BMGA 3O3EB 2H26A 1UEMA 1YEJH 2HJLB 2DDQL 5JORA 4MJ6B 4O4YL 3SO3C 6FABH 1HHIA 4IOIB 4B0MM 5INCA 4FFYL 3K2UL 3PE9A 5DJCA 3RL2A 5B4MD 5C9JA 2BDNH 1CLCA 2P42B 5D1ZC 1OM3H 1J8KA 4W6XB 3VFMB 4Y4FC 1CT8A 3NOIA 3MOQA 5IP4A 4V3EB 4HC1L 1G7MA 1OW0C 1ITBB 1I1YA 4MAUH 1A9EB 3D9AL 1FCCA 4HGMA 1MQKH 1KXQE 5FYKH 1KCSL 3W39A 1MJUL 4JQIH 3FRPA 4D3CH 3BXNA 5C0FA 4YO0A 5DTFA 5FO9B 2VABB 1HHKB 4V1DE 5HHNA 5JR1H 1YEKL 4Z7WE 1OAQL 3P73B 1R3HB 2IGFL 3HE6A 2AXFB 3RWHB 1KLUB 3B6SB 2PO6B 4M7JH 1DQDL 1P53A 1HXMA 1MCSA 5I19L 1CFTA 3GI8H 5D8JH 5LXGL 5F6IC 5TPWH 2XIDA 1YA5A 3ECBB 1NCUA 3QQNA 1JWSA 4X99B 4ETQA 2X2YA 4NFDA 3AAZB 4LBEB 4NSKA 1NUFA 4XNUL 1KUMA 1INQA 4NYLB 1WZLA 2A9MH 3ZKMC 4YHLH 5DHVB 5C8JB 3D48R 1K2DA 3SGEH 2A83A 5K93A 2WBJB 4KK5D 4KKAC 2E8ZA 2IG2H 4YK4C 3H6JA 3NIFE 1XH3B 1UB5A 1U2CA 1RHHA 1UENA 2XN9B 2R0KL 3SBWA 2GSGA 2K7QA 4MB4A 4X6DF 1QSEA 4HCRA 3QUXA 3CLFH 1Z9LA 1T66C 2VB5A 3WD5L 1DL7H 4Q6YA 4XP6H 4X8JB 1HI6A 4OQTH 4WTZG 2MOVA 5JPNA 3UTTA 1OGAA 1IAKB 4C54A 4G7YL 4JO2L 5ADPL 2K9UA 4ELMA 4LHUD 1ZA3A 2J4WH 5IHZA 4JAMB 4DZBB 3AXLB 2HVKB 3FTGB 5DS8B 5DVNA 1I7UB 5FYJE 4WGWB 1B88A 3VXNB 3MYJA 3SDDD 3VW3H 3VWJA 1I8IB 1UVQB 5JDSA 1LO4L 1U8JA 2R29H 4JVPA 2Q8BH 3LZFL 4HXAH 1UQSA 4MDJA 1RK1B 1ZK9A 3O41B 3QP3A 3G04A 4UAOB 2ZUWA 4GW5A 2JF1A 4RAVB 3K46A 2EYSA 1DUYA 4MJ5B 4RFEA 1AO7D 1DEEB 4IMLA 3TJEH 5I66B 5DI8B 2N56A 2FRGP 3R0MA 3O6MH 3MCKB 1V3MA 1D5ZA 5IB3B 4P3CL 3PP4H 5D2NE 1J7VR 1LP9A 1OT1A 3VG9C 3X11B 3DV4A 1NFIA 3MLTB 4V2BA 1I8IA 2V2WA 1MFAH 3MRJA 3HUJA 2EECA 2C3WA 4R0LC 3RWCA 3PXHA 4Z7VA 3HNTH 4OLVH 2ADGB 1MCEA 4HIIB 4KQ4L 2BMKB 3D69B 5ELIA 4PB9L 2AJZB 4BH7A 3QUML 1WZ1L 2R1YA 2BHZA 5GRXG 1INEH 3T3PF 1I7ZA 4JGMA 3QFJD 4XC3H 4NCC1 4Q9CA 4X4YB 4X8JA 5KOMC 3MRFB 1UXSA 1CCZA 3O2VL 4H0HB 3MBEA 2CKNA 4D3CL 3RZCD 3UTQB 4XMKL 3KYOB 2BNRE 4XWOC 5DUML 4KGJA 1MWAA 4AEFA 3SGKA 5HHOE 1KN4H 3OKEA 2W92A 2FJGB 2Z8VC 2JCCB 3KPRA 4U0RC 1T0NA 3B8SA 3F7RA 2DKSA 4Z7WB 5FYJD 5HVHC 2FHCA 1FVCA 1FAIL 3N9GH 5IK3B 3QAZC 5D4QA 1FZJB 2ARJQ 2F19L 5E94B 4XBEH 1B0GA 3SQOH 4LQFH 1GZPB 4HIEA 1IJ9A 3IDXL 4UDTB 5E95B 3QI9B 4G8IB 2C1OB 3FB5B 4WENB 3EYUL 3G5ZA 3ZKXC 3BPOC 4WWKA 4R4FH 3U36A 1JZ3A 1JGDA 5J12B 2DI8A 4WV1B 4P2OB 5DRWB 5KSBA 4GG6E 4UAOC 3TO4B 4PJCA 4GFTB 2AEWA 2HKHH 1R3JB 3CIQA 4K71B 3TT3L 4BFIB 4WFFE 4PRBB 4Y4FD 4JM2C 3V9FA 3QG6A 4OD3L 3V8OA 4XWOD 4BK4A 2CRZA 2X4PA 5E4IA 2IFFL 1W72H 1CYGA 5HI4D 1D9KB 4QTIL 3MLPA 3ZDYE 4WO4D 1MRCH 3DMMA 3FQXA 3RWIB 3D0LB 1MCRA 2AEQH 2P48B 4KHTH 4WJ5B 1KJ3H 4JZNB 1KTDA 2R4SH 1NGQL 5HHQB 1W0WB 1DVFB 1MCHA 4LKCA 4P23C 4HEPG 3KJ4B 3HKFA 5DC0A 2BERA 3P0GB 4LLDA 1CGXA 1X3DA 2FJGA 4Z76A 3BGFC 2GTZB 4DW2L 1C1EH 3U0TB 1ZLUK 3QCVL 4NFBA 3SCMD 1OP3H 2F53B 4QOKB 2X4UB 2DM2A 5CINL 3VA6A 1S3KH 3LPGA 3P0VH 4P46A 3X14B 2AK4A 1BQHA 4XPFH 3CFJA 4MNQE 4DOHB 2J3SA 5E6ID 3BZDA 4D0DA 2E9BA 2D03L 2B1AL 5GRWA 1T20A 4GQPH 5I9QB 4N8CL 3FN9A 2XI9A 4YDVA 1TJIL 5GJSH 2BSRA 5CSBA 5BOPA 4URTB 3A6BL 4ODHH 1R3JA 4NCDA 4I9WE 1CICA 2I27N 5C0AE 1U95B 5JLZA 3DSNA 5JW3H 4WV1A 5GGVY 5F72S 4EI5D 2NY1D 3HE7D 3OKEB 4OIIH 3WKNA 4BUHA 2AJSH 5EC1A 4MAUL 2WBJC 4S11A 3T4AA 3N1FC 1KJ2H 4KI1A 3FFCD 4OUUB 5J1SC 3QJFA 4P4RB 3VH8B 1BIIA 5BZDA 5DGQA 4X5WB 5ID1B 5IGXH 3L1OL 5EOCJ 3EHBD 2DWDA 4QEGA 2ZUYA 4FQIH 4L4TA 4X6EB 1F6LL 4G6ML 4NJ9L 3DX6B 1DLHB 4NRYA 4X6CE 4HZLB 2EDDA 4RDQF 5F7YC 1IFHH 4TOYH 3DETD 1I9JH 1ZLSL 1TTUA 1MQ8A 1XCQB 3MA7A 2VN7A 5D1ZB 4DN3L 3WHXB 4KKCC 1KF9B 3D1MC 1AR1C 1GC1C 4LQ1A 1GOHA 5IFHL 1OP5H 3VG0L 5CD5C 1QLFB 3ALXA 4XP1H 1KCLA 2V2TA 1RUAH 1PY4A 1I8LA 3CSBA 4UIKH 1FFRA 1BOGB 3I02B 4QTIH 3BDBA 4YQXL 1RZGB 4JFPA 3L7EA 2R15A 3ABZA 1U3JA 3HB3D 1FZKB 1T6WA 3L95B 4AL8L 3LN9A 4OV5B 4DWHA 1EHAA 5JW3L 3LQAH 1I3VA 1G6RB 3QIBA 1RFDL 4ZNCD 4PGEA 4KV5F 4N0CD 2RB8A 4LLQA 2C1PB 2Z4QB 5DVKA 3RVTD 4I18B 3BRFA 2DQGH 1U8QB 2Q86A 5FV2A 1YYML 3IU3B 1I7UA 2Q3ZA 5JIPA 3FO9A 4KUCD 2CUHA 2FX8L 3DMMC 4POUB 2E7MA 1H15B 3QCTL 5A2FA 2F58H 4LDEB 3PWVB 4L3ED 2AW2A 1JHLL 4GMTL 4JJ5A 4LFHG 3BVNA 3S96A 1QLEH 3I2CH 1AXIB 1MPAH 4ZUTA 2C1PA 1CFVL 4OZFB 4OZHF 2AQ3A 1XF4B 4PBWD 1ZANH 4F7TB 5DYOA 1YUHA 1AIFB 4JY6A 3VXPA 2H9GB 2P5WA 2CMRH 2AJSL 4G7VH 3T1FB 4PLOB 4F37F 1LNUB 1PSKL 1BGXH 1YMMB 4D9RD 4MZ2A 1HQ4A 1ZSDB 5D93B 2Y06L 1KACB 2ITDA 3ULSA 3RDTA 2Y7QA 3DJ9A 4MXQD 4JZJB 2XYCA 4AYFA 5DLMH 3D18A 3L3GA 5L2JB 4AQOA 3IGAB 3G5XB 4UOJA 4RAHA 3QHTC 1A7BA 2E7LC 1MWAH 1U8MB 3V5KA 1JMXA 2UZYB 4P2CG 4GKNB 2DQEH 4QRQB 5D6CA 4PRIE 3IKCB 4DK6A 5I1IH 4U6XA 1XGTB 3GJEA 3RVTC 4N0RA 5ILTH 1T4KB 3BZ4A 3OSKA 3V0WH 1CL7L 4JFXA 1N6VA 2BC4B 5T1DL 4MJID 5I1AB 1IM9A 3GMPA 1I1YB 3OG4B 1P84J 1XR9B 3O6FD 4TSBL 4OLWL 1YPZE 4I77H 4KKLD 1WIUA 1H5BC 5AWNL 1MHPL 5KTEH 4OLEA 4L3EA 4Z7OE 1A1OA 5DTFB 5K9KA 1KOAA 4IDJL 4W4NA 1U92B 2QADD 4P9MH 2ZSVB 1BGXL 4XPAH 4WCYH 1JPFA 3SKNA 5BS0B 4YDKL 5E8PA 5EU6B 1XIWD 5CJOH 3IDXH 4FNLH 4UT9L 4PB9H 1JUFA 4YJZL 4X9IA 3VXRB 4G8EB 3KPNA 3OB0K 5DJ2B 4ZO8A 1O7VA 3B2UD 4MS8A 4I3SH 4OZ4A 4XWGL 5E2VL 1NEZA 5I1DA 1IC1A 4OM0L 4UUJA 4ZUSA 1PG7H 4I4WA 5J3HD 5BZWA 3GRWH 1ACZA 2OSLA 4MNGB 5C0FB 4HLZG 3MRCB 4K3EL 5HGHB 1OVZA 1C5CL 1CGTA 1X5ZA 1D5BB 2NXZD 1A6VH 1YQVL 3V5KB 2DTML 4LVEA 2QLVB 3TIEB 5F9OH 5I1KL 3OKMB 2RCSL 4RX4D 1G7LB 1NAMB 4JFDD 3ULUF 5CZXD 1P7KA 4LMQI 3VU2A 3AVEA 4PJAE 2VDPH 3IFLH 1U8KB 3A67H 5IW6B 1J10A 2EIDA 4NZTL 5BVJB 1TCRA 5FIEA 2FJFA 4X4ZA 3P4LA 2VDNL 4JB9H 1NUDA 2C4FU 2VL5A 3MXWH 4ONOA 4YBLB 1TVDA 3KJ4C 1IM3A 3OR7B 3BP6A 1BJ1H 2HVKA 3SJVE 4HQQL 5CJOL 3CDGA 4XPBH 3TT1H 1UYWH 5IFJA 3CFEA 5EB9A 1LEIB 4TVPL 4TTGA 1G7LA 2B1AH 1JPFB 2A6IB 3LPWA 2R2HB 5LWYL 3TJHD 5T3XL 1F4WL 5EC1B 2I9TA 5F6HJ 3H9ZA 5LGJB 3T1WA 3CMGA 1J1OL 3GSUA 5HGAA 1NGPH 3KR3L 3DVFA 2EYTB 1LO0L 1BFVL 2MCPH 4PJEB 4Q6IA 3F7PC 4EN3D 2EXWD 5ICYA 3RUGE 1AC0A 3U0PB 3IJSA 4F7CA 2F8VA 3KWWA 3JV4B 1CF8L 1MI5D 3CFBA 3GSNA 5EUOE 4CU7A 5JOPE 3C5JA 1BBDH 4R7DB 4XP4L 1NUGA 4MCZB 5CJXA 5DHYB 3U7YH 5JMRA 3PGCB 4NHUA 1EAPB 2V9QA 4OCXH 3I6GA 3VE0B 1YNKH 5TE4H 4EOWH 1DBBL 3PWPE 3UTSD 4N1CA 3ZKMD 1LMKA 4QRUB 2FGWH 2NXYD 3SKUD 4UT7H 2GSGB 1CDGA 2NXZC 5L6YL 1U91A 4U0RB 3H7BB 4XI5D 4K94L 2BNQD 1TJIH 1OCWL 1PY9A 1NEZB 1SQ2N 4DN3H 1AGCB 4Y4KA 3MFFB 4J3VA 3ROOA 3FT4B 2VZTA 4JZOB 4DN4H 1MF2H 3KXFA 4N0YH 2OCFD 4N5ED 1CGVA 3RNKB 4M5ZL 1OTTC 1JZ6A 1DL7L 3SJVD 3I9GH 1IGIH 1I1AD 3WDJA 1T21A 4NZRL 1A6ZA 1TTGA 2YUWA 1MJ8H 3FOLA 1UWEL 3OWEA 4DGYL 5KSAB 4FQLL 3VFUB 3MRBB 3FFCA 1JHTA 2B5IB 2G9HB 3QQ3A 1C5DB 5DQDH 3HNVL 4OGYH 4IJ3C 2VDQH 2X89D 4U49A 3HS0A 1MEXL 1HE7A 3HR5A 4LSTL 2APWA 4AMKH 4MXWH 1N2RB 5T1KB 5FGSA 1L7TL 5L8JB 5I1EH 1IGFL 2QTEA 3IAPA 2NY0C 3HNSH 3SDCA 4MNGE 1RZ8A 4UV7H 2ADIA 1J1PL 4X7TB 4P2RE 1FVCB 1UH2A 3QDMA 1NGYA 4G42A 4NPYB 2AJXH 2FJHB 1P4LB 2E3VA 3ZKND 4R4NC 1OGTB 3CVHA 5FB8A 4X9BA 3T4YA 1FGNL 2NX5E 4M62H 2DL2A 1ORQA 1R3LB 4P5TD 5F9WC 1V3KA 3PWPD 4XP5L 5INCB 5IVXA 1OHQA 1G7IB 1CK0L 3G6JE 2CIKA 5D6DA 5ESAA 2MCPL 3O8XD 3EUUA 4TTDD 2M1KA 3TZVC 4HQQH 1D5XA 1ZVHA 1QBLH 2IBGA 2VZVA 4HF5L 4ZD3L 4XB7A 2JJSC 1QLRA 3CDGB 1EGJA 2JCCF 2Z31A 5JXED 5HHNB 1YEEH 1AY1H 2Z8RA 4NQDE 4D9LH 4JFED 3W9DA 5J6HA 1WBXB 4YUEL 4KTDH 1KYOK 4Z7NE 3UTPD 5TH2A 3QUMB 1WC7B 1X44A 1BPVA 3MOBH 5HHMA 1I8MB 4B7IA 5LGJA 4HLJA 1YY9D 1QA9A 3VJ6A 4MNHA 1LP9B 1Z6JT 3FMGL 2ENYA 2W07A 1WEJH 4Y19B 1CE6A 4K23L 1ZANL 3CCHB 1FO0B 4U6YB 4TSAH 2B7DT 5D2NA 3GIZL 1XGPA 3L3OA 1A0QL 5FO8A 2OP4L 4BQ6A 3FO0H 2LAGB 2XKNA 1RJZB 2EZ0C 1QPXA 2JJUA 2VISA 4L3CA 4AH2A 4DAGL 4RMRA 4NBXB 4WDIB 3VWJD 4BH7B 3QPQD 3QIUD 1A6PA 3V4VL 1KLGB 4P2RD 5GS1C 4R4FL 1VKXB 1WTLA 3MJ7B 4YHIA 3KDMA 3D2UB 3ARDA 2WIIA 2E7HA 4DUVA 4UT6H 5AZ2L 2W0FA 3FQNA 1RJLB 2IH3B 2OQJB 4HC1A 4NRZB 5C6TL 5HI5C 5KS9E 4GMSH 1NSNL 1NFIB 3QUYC 1N5YH 5TQ0H 5C0RH 3KLHD 2QQNL 3DRQB 2R1XB 4BK5A 5JPNB 1GXEA 4YHZL 2JCCA 3KPRB 4ZOEA 5C6PB 1DEDA 1IGIL 2A73B 4K07A 3RVUD 3QUZD 4KHTL 4WI4A 3BWUC 5ESVB 2YPLE 1NMBL 5B39G 2EC9T 3SEPA 4Q97A 1MCIA 4YFDB 3UMTA 4JO1L 1R6VA 12E8L 2WLYA 1HHGA 1F90H 4XXCC 4M1GL 2PO6C 1UM6L 2MQ3A 1Q9KA 3KG5A 1DR9A 4X4YA 2R4RL 4AG4L 2X9XA 1TQBC 5F3HA 2HT3C 1K4DA 4U7MA 2LQRA 1GHFH 1U8KA 2APBA 4XGZB 4HULB 3OAYK 5KTEL 1L7TH 3FQUB 1ZAGA 4PJ8D 5D7JA 5DI8A 1I8KA 2NYYD 3PWUB 4K3GA 3AS0A 1UEYA 4OZHB 4LL9A 3GUTB 1HIMH 3RGHA 1K5NA 2YD6A 1NBYB 4YX2H 1IC7H 4GKSA 2D03H 5KSBE 2BY1A 1MI5A 3ARPA 4BSVB 1IEBB 4HG4K 5CGTA 3DO7A 5I2IA 3O3AB 2BOBB 4O9HL 4WHDA 3DSFH 2I9TB 1MQKL 1XF2B 3H3KA 1KBGL 4YGVB 4X6BA 4MJ5A 4RFEB 1JF6A 1S7RB 1T1YB 4TNWK 4L3AA 4P4KD 4IDJH 2P46B 5B3NA 1SM3H 1NGXB 2EKSB 4KKLC 3N1QC 5I75C 4JFQA 5JQHC 4PG2A 3DX8A 4ELKA 4LRIC 12E8H 4MNQB 5EZOL 1B2WH 5DVOA 2Z35A 3DYPA 4PJIF 1N3NB 4PLJC 3G08B 5KN5A 1FH5H 3QG6B 1UGNA 3JTSA 1MY7A 3UPCA 1CICD 5BRZD 5FV1L 4EUPA 5LAXA 3WE6A 2OR9L 2PTVA 1QEWA 4PTUB 1JWMA 3BVNB 4OF8A 3RWGA 4PJIB 1ZOXA 2WBKA 3JSSA 1KTDB 2EYRB 2QEJA 2EKSA 4KVNL 1MFEH 3TN0B 1BLNA 1IC5H 1BFSA 5J1AA 5EZJA 3RGVA 2B8OT 3FAWA 4PJDF 1YNKL 4JPIA 5ACZB 3F7YB 2CQVA 1RZJL 4S1DD 3UZQA 4JY6B 3P4NA 1S7TB 3GHBH 3QWQB 3WNLA 4PD4J 3VRIA 1KB5H 2D0GA 3ZE0F 5CWSB 2A83B 1BX2B 3MUY1 1X7QB 4M7LH 2NYYC 3IFLL 1B4JL 3AFLA 3MRIB 1S9VB 1AKJB 3ZE1F 5L9DL 5IVZA 1BQHB 4JY5H 5IFAH 1U8NA 3T0ED 5HJ3A 5DJ8A 3IETB 3JTCA 4HWEL 3HLAA 1RULL 4JG0H 4PTTA 3A6CL 2AJVL 2D9CA 3LN4B 5EO0B 3V79C 1OSZB 3LHPH 1X5AA 5DQ9A 3U36B 5I15L 2GJJA 3VG0H 1NMBH 2IJ0C 5F89A 5F3BB 4E5XA 3O0RL 3GJEB 2YPLB 2MMXA 4GAGH 5DVMA 4OT1H 1NDGB 1HCVA 3UPAA 1R5VB 4U1JA 2YXFA 4OGXL 5EN2B 4AL8H 3D85B 5DJ6B 3PP4L 5ID1A 2VLLA 1NGZB 2JE8A 3QZWG 4APQB 1WSST 5BZDB 1BJMA 4OFIA 1RK0A 4J1UA 1FJ1B 4QRRD 1J1PH 4E42A 3PQYE 5TDPA 3VGFA 1EFXA 3AB0C 4GXUN 3D3VE 4RNRA 2UZXB 1JK8A 4DK3A 3VXUB 1NEZG 1CXLA 3MA7B 1JTTA 1QVOA 1BZ7A 4Y4HA 4YDLB 3BKML 4A6YL 1BD2D 2ZSWB 5EOTA 3HG1D 4J3WA 4ZOAA 4HFWA 3LY6A 3KS0H 4HPOL 4PRHA 5FO7A 1SVCP 5ITFA 3KPNB 5DJ2A 2MPAH 2BP3A 3BH9B 4OLZH 4PRPB 4HKXA 2UZIH 3M17A 4L8CB 3MNZA 4PGBA 4G59A 4GLRH 4J3SA 4P4RA 3VH8A 5KBNC 4AK1A 5I17B 1TZGL 3A0OA 1KPRB 2WMPA 1RIUL 3GZKA 2ICWJ 1ZLVK 4K7PH 4X6BB 2ORBH 4EXPX 1NCAL 3HG1E 3B9DA 2B0SH 1BBJA 4S2SA 3TV3L 5GGTL 4U1GB 5EZOH 3GKZA 2P8PA 1PX3A 2Z92B 2P5EA 1XCQA 5D1XC 3VRIB 3D85A 1G9NL 2I07B 4PGZA 4ZFFA 4KJWD 2FATH 3VXSE 3S36X 1ED3A 4MA7H 4YHIB 3TH2T 2EH8L 4RRPA 5E8NB 4IRJC 1A9EA 1NC2A 1AQKL 4Q6IB 4LSUH 2AXGB 3VMPA 4OCYL 1JIBA 2UUDK 1Q38A 2ZSWA 5EOTB 3L3IA 3OKDB 1Z3GL 2BVOA 1YECL 3BKYL 4UNUA 2O61B 4MJ6A 5JXAH 2HT4C 2PO6A 2BY0A 3OJDB 1NL0H 4XTRC 5E9DB 2I25N 4H26A 3BH8A 4HWBH 1YPZB 5MEQA 2X40A 4PRIA 5IB2A 1ZVYA 1NGQH 4UU9A 5I76B 3T0EA 2X4TA 2QQLL 2X10A 3VD7A 3MNVB 1IGMH 2DQJL 5B21A 1A7QH 1A6VL 1A9BB 3SOBH 1NCCH 5IMOB 2YMXL 5IBUB 5DK2B 3VRLE 1QR1B 3BIAX 4WRLA 1AO7E 3E8UL 1RY7B 3OAZH 5IQ9A 2YEZA 2NY6B 2MNUA 4ZUTB 2DJUA 3EDDA 2VL4A 3KPSA 1RIHH 4A6YH 4NT6B 4A6YB 4ODXB 4F33A 3B6SA 4I0PD 1A3LL 1RZFH 4FXKB 1OLLA 2A6DB 3GMRB 1JYXA 2RBLA 3S97C 3MOBL 5BV7B 3WS3B 3LV3A 3SO3B 4N0UE 1VERA 5HYEA 5ENWB 1U2HA 5FA4B 5CP3H 3DETC 5DZOA 4K2UH 1FV1B 5SX4H 2NMSA 2P24A 4MX7B 4HBCH 1RUQH 3ROOB 1MREH 2YUVA 3MV7B 1X5IA 4GW1A 2AI0H 2R23B 5AAMA 5ICYB 1NGXA 1PZ5B 1DQDH 1X6NA 3T0XA 1HH6B 4PGJA 3CJJA 5D1XA 1U8IB 1RJYB 4ALAH 5LVEA 2D7OA 4K71C 1KC5H 3NFSH 5C0AD 3QPQC 2QQLH 5DMGC 3RVVC 3UTTE 1H9VA 4L4VA 4ONFH 1I1FA 5I30L 2PNDA 3FT2B 4UTBH 3T2PA 1FGVL 3BN9C 3PABA 3AY4A 2GHWB 2DM3A 3KPTA 2CLRA 4ZFZA 2ENSA 2YBRB 4QNPF 4PGBB 5FYLH 2GTWB 3CVIL 1PZ5A 3NCJH 4LSPH 4NJAL 3PHQA 4NGHL 3HMWL 5FCSH 4Y2DD 1S78D 3IDNB 1F4AA 3KPOA 4JJHA 3BHBA 4G5ZL 4JQXC 4PJXA 5DURD 5E2WH 5DUBA 4X9GA 4LIQL 3AMKA 3HAEA 2VXUL 3MRJB 4JZOA 3QUKA 3QT2A 1MVUA 1S7UA 4KI5F 4K94H 4PJEF 4KRNA 5A16B 5EBWA 2HMID 3C8KB 1QSFB 4HKJB 3IU4H 1A1MA 3MRKB 2G60L 2E7BA 3LKPB 3MXVH 2O5ZL 4R26L 5DGRA 2X09A 3H9SE 4GRWE 3CFDB 4XMLL 2WUBL 1YMHB 2YKLH 4CW1A 5MP6L 1EEZA 3QO1B 3GMMB 1JGEA 2VLRE 4N0FB 3QUXB 3VFUA 3NA9H 3HUJE 4PG2C 1U58A 4HIJB 1TCRB 2AXGA 4KMTH 3HZYB 4NKMA 4MD5B 2D31B 4XT1C 1F3JB 2R0LH 1XGYH 3R06B 5CD3A 1EBPA 5EUOA 2N4IA 1YEHL 4XNMB 2FIKB 3MUGA 2XQYK 2FHBA 3EYOA 1B0RA 2YN5A 3ZZ1A 3QJHB 1UXWB 5D7IB 1G9MC 5EULV 4F2MB 4NHUE 2BRRL 5IW1A 3BUYA 4AMKL 3MODL 4ONGH 1N8ZA 2J7LA 4Y1AA 4EUPH 3MGOB 3PWPA 5EBLB 3VFRA 4JDVB 4K3HA 1CR9H 3FL7A 1JRHH 4KVCH 4MJ2A 4FQQA 3DNKA 4KY1L 2XFXA 3KNBB 1NCBH 3IDNA 3KPOB 4LOUC 3CMOL 1CFSA 3LKSB 4ODBD 2X6MA 3ROLB 1WWBX 4DKFH 5CEZE 3H42L 3ZTJG 2K3TA 4JN1L 4FN0A 5C09E 3FQTA 3IXAA 4PJ5D 2ESVA 3P4OB 5FGCB 5GSRA 2RIKA 2VABA 1QSED 3CXHJ 1NCTA 3BUYB 4ELMF 1A21A 3ULVD 5LQBL 3TF7A 4NQXB 3IB4A 3VI4E 3I3BA 2HFGL 4UTBL 2L0DA 3QH3A 4Y2OA 5D1ZD 3WS3A 4HHAA 4OFPA 4IS6B 2IBBA 3HS0B 5MI0C 5FUOH 4PB0H 3FFCE 1A2YB 5LGHH 5D96C 1PEWA 4LCIL 1TJHL 2VLRD 1K9TA 4NGHH 3FHAA 3PXJA 4QTHB 5B3JE 4U3CA 2A77L 4OLXH 4PJFA 4YO0B 5FO9A 2XV6B 2VDOH 2QHRL 4WFGE 5BS0D 4J3XA 4MQXC 5DD1H 5F7UA 1ES0A 4X7CC 1U3HD 3I75B 4PBXA 2LAAA 3C8KA 4ZUWA 4QO1A 2G5BB 2OL3H 2H2SD 5D6CB 5C0NC 4I0CC 1UJ3C 1FIGL 3Q48A 3QULB 1NCAH 1S7RA 1T1YA 5DJZA 4M7JL 1KLGA 5FCUL 2WK2A 1DQLL 2FEEI 3MMEA 3FO0L 3RTQB 3QDJD 4NBZB 4P9ML 2HKHL 3AXLA 1C08A 4HUXB 3FO2B 4KU1A 4QWWC 4ZTPH 5K9OA 4HUVA 3MRDA 1NANH 4WNQB 2H32A 3Q3GB 2DLFL 5IM7B 4TNWF 25C8L 3EYVB 4YEFA 1WFTA 4MNQA 2B5IC 4EQ2A 2MSPA 1HHKA 1AHWB 2NY2C 4LLYB 2VDLH 5DHYA 4NO2B 3TM6A 5C7XL 1CD8A 5IVXB 2ZUUA 1YEFL 5IR1B 1G7IA 5I74C 1ORQB 5A3IC 3BJLA 3T4YB 2QKIA 1WT5A 1BD2B 3MO1B 3H0TB 4GW4A 5C0IA 5DD6B 3D6GA 1C7TA 4U4BA 4JPIB 5IMMA 4UBDC 3VXMA 5HGBA 4OFYD 1YEGH 3B9KB 3NCBB 5DFVD 1M71A 2R56L 3CD4A 3M45A 2QBWA 3PGDB 4UINH 4HWBL 3SDCB 4EI5B 4N5EA 4S1SH 3AM8A 1BWWA 1M4KA 1JN6B 4JRYE 5EU5A 3BN9D 3N50A 3MOAL 5EUOB 3IDMB 4KHXL 2F53A 2PYFA 4FXKA 2XWTA 5EWIL 5E8DL 2NY3D 2PR4L 3QNXA 5GIRB 1Y0LA 4JB9L 1U8JB 4ZXBC 4EDWH 4R4BA 1J9CT 4JLRA 1EERB 4S1RL 1WWWX 1U93B 3Q6FB 5F93C 2NY4B 3OPZL 1WAAA 1T2QL 3QH3B 2W1NA 3DUHA 5H94A 1VGKB 5KS9A 4YQXH 1A64A 5LGKA 1S9KC 2GAZA 2HFEA 2FIRT 3UX9B 3NABH 3V7MA 4P3CH 1A6WH 3S5LG 5E8OB 4H0GA 4P9HL 2LTQB 2XKNB 3SBWC 2VXSL 3SDYL 2ADJB 1A6UH 4M7KL 1NMCB 2J12B 2V2TB 4UOW0 4U1MA 5FYJU 1CFBA 4M43L 2HWZH 5EA0H 1FFOA 2EDKA 1WZKA 3UJIH 5J11C 4WWID 3MREA 3MLWH 2DYPB 4LSUL 4KPHL 4YHMH 3GNMH 4PRID 2XKUA 5I1JL 3G04B 2EXWC 3KDMB 1I8MA 4AJ0A 4DZ8B 1DBJH 4CMHC 2CKBB 4H1LG 1A1NB 1EEYA 4WO4C 1S8DA 3ARGA 5AYQA 3NZ8B 2RFXA 2HLFD 1FCGA 4XAWH 4O2CA 4I13B 4JKKA 2X44D 4JN2A 4Y1AD 1TETL 4L1HA 1NKRA 3REWA 4DVRH 2V5MA 1JWUB 1HN1A 3EFDL 4P23D 4QRSA 5MI0B 4EI5A 4X6DE 4UT7L 32C2B 3QIBD 1MI5E 2E9WA 3VXQA 5JOPD 2VDML 3DTXA 3O81A 1V05A 3WIFA 2V7NB 3MJGX 1HXMB 1MY5A 1T2QH 4O58L 1BQLH 2V6HA 3N9GL 5C0CA 2XRAH 3SY0A 3QZWA 3T0BA 1F00I 4J1UB 4X80L 2DQHH 2CDGB 4E41A 1IC4L 2WWMC 3ARBA 4MA1C 4O2EA 4RGMC 3KAAA 4XHJC 1ZGLP 5GISH 4E0RB 1NANI 1NDMA 1HHJB 4NRZA 1U8HB 3GSQA 4H8WH 1RZFL 2DIJA 5SWZA 3RGVC 1XT5A 2EDEA 3D0VA 1NFDA 4OCLC 2HJFB 1BVKA 4GKNA 4WW1A 2Z91B 5E1AB 3CFJB 1T1ZA 2EDLA 1OW0A 3PDDA 1YEFH 1HSBA 3TBTA 4PV9A 1JWMB 3S4SG 5EO1A 3VFPA 2IANA 3EGSB 3MLVH 3LS5L 1I7RB 4LVOC 2EH7H 4NC0B 2YR3A 4HLZH 1VPOH 4Y5XA 5D1QA 5EORH 2OMNA 1A4JA 2F74A 2ZPKL 3ARRA 4CJ0A 1IILE 1FAIH 1FHGA 1RK0B 4LIQH 4UINL 1QRNE 2AJYL 1KCVL 4LVNB 2AJXL 1GGYA 1A3QA 4EN3C 1G7HB 2GK0A 3S37H 4P5KB 4M7LL 1MVFA 3DTXB 4EUPB 2X1XR 2OI9A 5DZLA 1MIMH 1JL8A 3GB7B 1N4XH 1FVEA 2F8OA 3ES6A 3EYQC 3G08A 1VACB 5B8CB 1MIEL 2FEDC 3V7AE 1YPZA 1P4LA 2HWZL 5EA0L 3NPSC 4GRWH 1WF5A 2L7JA 5FYLL 2VLJE 3O3AA 3RGVB 1II4E 5FM4A 3EOTL 4HV8A 3D25B 2CR3A 1QFWL 3IJHA 4PGCB 3VGAB 4LVHB 3D39D 3VFSA 3VH8G 5JW4R 4S1DC 1T5XB 2ZSVA 2QADB 4XNXL 1UACH 5D7JB 5HY9B 1A6UL 4M7KH 5HI3C 4A6YA 3FFDA 2CXGA 1EMTH 2FBJH 2Z35B 1RZKH 1NKOA 1VFUA 2CGRL 2ADJA 2IBZX 3UJTL 1QQDA 2Y5TA 3L7FB 4HUMB 1CR9L 5DMIL 1DQML 2DWEA 1ZLVH 5IMLB 4L29B 1Q9WA 3AB0B 4KROC 4GQ9H 2HRLA 1MRFL 3RY6A 2Z9TA 2XRAL 4KK8D 1T03L 3BGFB 3PV7A 4UILH 3EYSL 4M1GH 2OLDA 3MRFA 5IIEA 1NBZB 5D7LE 5F88B 4FNLL 5JHLH 1WFNA 1U3HA 3D3VA 2R2HA 4MA8H 4NT6A 5FAAA 1IVLA 3BW9A 3BD3A 1LEIA 3NIDE 4MA7L 1RSFA 5GJTL 2GI7A 2FX9H 5SWSD 2EDYA 1Q1JL 2UVFA 1MJUH 1P4BH 4Y8DC 5ALCL 3BZFA 5HTSA 3QUYA 5C0CD 2JLLA 1N5YL 2DBLH 3WFDH 1HK6A 1HZHH 4E42B 2C3GA 3U4BH 1Q8MA 1YJDH 5C0JB 1F8TH 2E7LA 4PUBL 4DKAA 2GSIB 4JRXD 1WIPA 3VDCA 1U8MA 5E1HB 5E5RB 3V8CA 1KJ2L 3IT8D 1EFXB 5EG6C 5CJ5A 3DO3A 1YUHB 4KGLA 3CFEB 4QHKJ 4LSDA 3FB8B 4LHJB 1FFNA 2VMFA 4E9LA 5C0AB 3V5DB 4QRTA 2FECL 3HPJB 2Y7QB 3O6FA 2HKFL 3GSVB 3MA9L 3U1SL 1UZ8B 4JHAH 2JB6A 1NC2B 3BJ91 4FZ8H 1ZSDA 4MLIA 3HNTL 3MJ8A 3MGAA 4LKXB 1KNOA 2O5YL 4KKNA 1ZLWH 5D9SA 4Z9KB 3UC0H 3VA2C 1U3HB 1I3GL 4S0TD 3ZT7A 4TVPH 2PW2A 1EK3A 2J8HA 4AEEA 2KQMA 5DD1L 2VLKB 3RTQC 5E8PB 4XZUA 2YWZA 1JGUL 3QDGE 5GHWH 5FK9B 3ARED 1KT2B 4ZAKA 3X12A 2NCMA 3BZFB 4S1RH 4QOKA 1UWXH 4ISVB 4LRNL 5FKPA 4MS8D 3LSOA 5FCUH 4RGNE 1ZHKA 2EDRA 2GJ6D 1SYVA 3LEXA 3NIGF 2VE6B 2RJMA 4HH8A 2A6KB 1J8HB 4J4PA 1DANU 1NCCL 1T0MB 4P49A 5I1AA 2NNAB 4PRPA 5DJ6A 5TF1H 2UUDH 5D2NC 5IT2H 4IM8A 5HVGB 1QRKA 4IOFD 1MCQA 5KVEL 1XGQB 1S8DB 1ITCA 3ARGB 3B3IB 1QOKA 3SKOA 4MZ3A 3CFKA 1VFAB 5C0BE 3LVEA 3MOAH 5IHUH 3O6FB 2JK5B 3O6ML 4KMLB 5I1JH 5D70H 4FXGB 4O2FB 1N7ML 3H7LA 3T09A 3WYRA 4EBQL 4NFCA 4Y7MA 1EDQA 2D7TL 3I50H 2O5XL 2YC1A 2QSCL 3ZHKA 4FG6C 4I3RH 4PLKD 3KPPB 1FV1A 3MRLB 1J5OH 5J7CC 4HBCL 1FYHB 2EEAA 2VKWA 2BC4A 1UM5L 3QUYB 3PWJB 5KANG 4KZEL 3S88L 1EIBA 3J7HA 4MNGA 5EBMA 5BZWB 1LQVA 2J8UA 4XVJL 3NGBC 4ZUSB 4GXVH 5D1QC 5D96B 5FK9A 3MCLH 1TQCB 3ARUA 3GMOA 3S34L 3LN5B 2Y6SD 1J0KA 1SJEA 2NX5A 1INDL 3TWCH 3QDMB 5CS7A 3B9AA 3LDBC 3MBED 5IVXE 4JCMA 4HS3B 5IB5B 1FPTH 2H2PC 1QKZH 2NY2D 4MQTB 4OUUA 4L4VE 5FA3B 3RPKA 1RAMA 2JB6B 5KVEH 1TITA 2X42A 1OSPH 4WEUD 1TZHA 3ZKSD 1P4IL 3VXSB 1HSAB 4WV1C 1HILA 5EC2B 1ERNA 2G9HA 1VGEH 5IHBA 2Q7YA 4LHQB 1A6WL 2XOTA 1JZ7A 3L9RB 2L7UA 5IQ9B 3MODH 1NMAH 4ONGL 4OBSA 1YEDB 4LSQH 3TC9A 4S0SD 4I48B 4X6CB 1HH9B 4P5TA 2AABH 3RWCB 1O0VA 1U8QA 4I0KA 4Y5YC 2Q86B 3X12B 2I5YH 1JNJA 4WWKD 4Z7OF 2R1WA 4U1HA 43C9B 2H2SC 2FZ3A 3WFEH 3ERYA 3TV3H 1FZJA 2KUTA 4YHKL 1GL4B 2R0ZH 1PX4A 4TPRH 4JG1H 1SMOA 1IGYB 4OSUL 2VQTA 4X4XA 4F15C 3PHQB 2OQJA 2WIMA 4KC3B 3JV4A 4QRPA 1JMZA 1GOFA 2CK0L 4KTEL 5D7IF 3STLA 3X13A 4N5UA 3U0PA 3IDUA 2A6JA 1CD1B 1OD9A 2GFBA 4P2QA 3PGFH 1AR1D 4V1DD 4UNVA 3K0WA 5I0ZA 1L0QA 3A6BH 3WIHA 5D93C 3T77B 3IKKA 4PJ9A 1BZQK 2P7TB 3MRPB 4EDXA 1QVOB 4G9FE 1EAPA 5I18H 2C4XA 3FOLB 3P9MA 2JTDA 2GT9B 3EOTH 1MUJB 1P7QA 5T1LA 2NTSP 3DXAD 4NKIL 5J0BA 2XT1B 3O6KH 3W0WA 4K55A 2X7LA 3C60B 5IMLA 1YN7B 3OHXA 3C9NB 3M17B 1ZA6A 4WFED 2QHRH 1UT9A 3FB6A 5IG7A 5GS0L 3MFFA 3OGCA 5CEZH 2HFEB 3C08L 4OD2A 4HKBA 15C8H 3JWDL 1AGCA 3DI2B 1DBAH 3PP3H 3C5SA 1R24B 3THML 5EDXA 3BHBB 4HXBL 3P0YL 2UYLB 3NACH 1BBJB 3LIZL 3RNQA 1HYRC 2ZWLT 3P9MB 3IYLW 2P44B 2DIBA 5C09A 1AO7B 3SOBL 3TBVA 2ESVE 3UBXI 1D7FA 4WUUD 1YQ2A 2HT3D 2Z8SA 2Q76B 2R2BB 1NC4D 3QNXB 3BP7A 5TJWK 1CGYA 4WFEE 4PBVC 2GKIA 5IW1B 1NLBL 4MJ4A 4JANB 2ZOKA 4YXLH 5L2KA 4K8RD 3B5HA 3E1F1 3LKOA 1RUAL 2D4DA 3AREA 3BMWA 4OFYA 3FT3B 3MRQA 1P5UA 3SJVB 5D5ME 5T5NG 2X4NB 1OWWA 2YD2A 1FZMB 2AERT 5I1CL 3ROLA 3AREC 5HSFA 1KB5A 1R5WA 2ESVD 3Q5OA 4NQEA 1LE5A 2V2WB 2NZ9D 3LQAL 1DSFH 4KQ3H 3S4SA 1MPAL 4HX1A 2X4UA 3TBYB 4LDOB 4Z6AT 4X7TA 4HJJH 4ZPVA 5GS1A 1X5KA 2ICWA 1YEDA 1M05B 3IAQA 5BV7C 3D39B 2KBGA 4OZIE 2AI0L 3BPLC 1EFQA 3T4AB 3ZHLA 2NTFB 3BIBX 2ZCHH 1BQSA 2NLJA 1OPGL 3ARVA 4HKJA 4LVNC 2EYRA 3VFWA 4PIRF 2XN9A 3DXAE 4MHHG 2VH5H 4G43A 3H8NA 2VNCA 2OZ4L 3NZ8A 4JREB 2H32B 4C4KO 2EDWA 4KXZH 4BQ9A 1W72B 4IIQA 3BP4A 1OTUD 4RMUA 1LK2B 4KRLB 5ESQA 3RQ3A 1I9IH 4JR9L 3MA9H 3U1SH 3X3FL 3T3MF 1YY9C 1BFOB 3MPCA 3QDHA 1CDCA 3U2SA 1Y6MR 5BS0A 3FO1B 1FZOB 4HJGB 5HHPA 1CLZL 1YY8A 3K4ZA 3WFCH 1XF1A 4PJHA 2R2EB 2R1WB 5DUPL 4J23A 5DRNB 5SWSA 4OI8A 1OY3B 1PSKH 5DT1H 4NQSB 4MXQA 3QFDB 2DAVA 3P30H 2F74B 1UQSB 3GBLA 2CO7B 5TE7L 2IQAB 3O11B 4HZAA 1R3LA 7FABH 2EIZA 3GSWA 4TUOB 4UTAH 5DK0B 4OKDA 3STLB 5IEKA 5D72H 3THMH 5JPMB 5JTWA 4IRJB 5TQ2H 4QGYA 2HRPH 4FQ1H 1PLGH 2Y36H 4HK0B 4LLVA 3NA9L 3G6AA 2FSEB 3SGEI 1LO2L 4Q9QH 3SDAA 5JW5B 1NMCC 1IKFL 4X8XA 1A5FL 1V7ML 2VJXA 2CUIA 5DD6A 1UKSA 3K2UH 1E4XL 3RL2B 2MHAA 4BSJA 3BRGC 3I6LD 3SKMB 3UC0L 1JZ5A 5GS0H 1NCWL 2J5LC 1G7PA 4G7VL 3BO8A 5ILTL 1FJ1A 4LCCC 3CSYB 4FMFA 5HGBB 3VXMB 3TF7C 1T83A 5JIKA 5HHPB 5ACZA 3QCVH 3CMOH 3H9HB 1D9KA 1T66D 5TF0A 5DT1L 1A0QH 4PV8A 1TLKA 4JM2B 4KZEH 2ARJB 5CP7A 3MNZB 4K7PX 3CLFL 4NKOB 1J0YA 5L2KD 5IJVB 4JLRB 2B2XL 2PYEB 3RAJL 4NN5C 4Z7WA 2AJ3B 3U46B 3G5VA 3WHE0 4GLRI 2WIIB 5I8KL 5DK0A 3F6LA 2VSDA 5C9JB 3MJ7A 3GSRB 1FG2A 4GBXB 3G5ZB 1UG9A 3BT2H 2XPGA 3EDJA 3VXUA 3UJJH 4AIZB 5MENB 4G8IA 1DFBL 1P6AB 3QI9A 2EKJA 4MQ7A 3I3DA 1NSNH 3PWLA 1PVHA 5DO2C 4PD4K 4WW2A 4C57C 5I1GH 4M4RA 4DZBA 1YEKH 1JGVL 5EU3A 3IRPX 3SE9L 2R1XA 4MA3A 5IJVA 1C5CH 3OXSA 5EPMB 3PL6B 3W9EB 3TBSB 4O58H 2YPKA 3TT1L 3ARBD 3QJHA 5D7IA 3QNZB 3TPKA 1BIIB 1X4YA 3QWRA 2EEDA 2VAAA 1XF2A 5I66A 4CU8A 1N0LA 4YNYA 4LASH 3F7VB 4KDWA 1GPOL 1ZGLB 5BQ7A 3RRQA 1DN0A 4F7MA 3O8XB 4L9LB 1XF3B 5IQ7H 4R4BB 4YE4L 2X41A 2P5EE 1I9IL 4JN2B 4MD0A 3B2VL 4DUXA 4OD1H 3N1PC 3BEVA 5KS9F 5GGQH 4XRCB 1EO7A 4HUNB 1TCMA 3FTGA 4HT1L 1P9MA 2LABA 3NCFB 1QUNA 4OSUH 1Z5LA 4ZDHA 5C8JA 1PG7W 3TA3D 1IRAY 1Z3GH 4YXKL 4C58B 4FQPA 5C0CB 2FSEA 5I6XC 1FFOB 4XVTL 3IDIA 5IW3A 3BGMA 4GKOA 5BQ7B 3ARBC 2CSPA 4OLUL 3ULVE 3OR6A 3VI3F 3Q5YA 3W81A 4GG6B 1PFCA 2PW2B 4P5MA 1MWAB 1P1ZB 1QO3B 1IQWH 4G6AC 4NM8L 1A3RL 1AP2A 5FF6B 1IAKA 4WI6A 3ZHDA 1T7WA 5KS9B 4FQIL 4XBGB 1HDMA 1N64H 1G0XA 5FECA 5CCKH 4HAGA 3DVGB 5GS0C 3O4LD 5A40E 1R5VA 5JDSB 4O5LL 15C8L 1UWXK 3JWDH 4G8GE 3WE6B 5E6IB 2GITB 5MHSE 5IFHH 1R5IA 5EIIA 1T1XA 1G9EA 3OAYH 4RZCA 3KPSE 5GJTH 4X6EA 2PW1B 5DQ9B 1AE6L 3B8YA 3DX6A 3QWOA 4PRAA 1ZS8A 1OSZA 5KSBB 1KJ2B 4LF3A 3CDCA 3QG7L 4M6MH 1DFBH 1CZ8L 5EO0A 1HDMB 1NC4A 1U8PB 4DVBA 1CQYA 5D2NB 4RRPG 4FFZH 4N0UA 1DJSA 4GUPA 3MRGB 3E2HC 1KB9K 4LNRA 4M5ZH 2BNRA 1T6VN 3VFGH 3MV11 3RZCB 1MRFH 5HDBF 3NABL 2YSSA 3QQ4A 4TRPH 3E8UH 4F57H 3O6FC 4NQDB 1NAKH 2W0PA 4G6KH 4TULL 4NQCE 5CEZL 4IRSC 3TA3A 4KUCF 3RWFB 4G6FD 3BPCA 5DEGA 3Q5TA 4FQLH 3H0TA 4OB5H 1KPVA 2MQCA 2QL1A 1I7RA 3BZEB 2EZ0D 3V6FB 5DYOB 2VTFA 5EZLB 3LQMA 5SX5H 1Q94A 1L9NA 3HR6A 4Z77A 5KSBF 3MZGB 3FN0L 2HKFH 4WFGD 5CINH 5L8KB 3PHOA 4ZPTA 5LBSL 3MBEC 3WFZA 5IKCA 3D85D 1CD0A 1NUNB 1CG9A 3RWJA 4P0DA 5I8CA 3IU3A 5J1TC 4JKLA 5KG9B 5E7FA 4WI3A 3PHSA 3S9DB 4DQOL 1A7PL 2A9NL 1T3FB 4F7PB 2XZQL 3GMMA 1X7QA 1UFUA 5IOPA 2CMRL 1U91B 1ZHKB 2EYTA 5GJSL 3NMEA 3CVHH 4M1DL 4D9QE 5F71A 4ODTL 1WT5C 5K59F 3G6DL 1JPGB 1H5BB 4JFEB 4UZGA 3WL9B 1DSFL 3D25A 4PJIE 1SBSL 3DRQA 3V0VB 2XTJB 4BH8A 2DQIL 1MJJA 3UYRH 3NVQA 5FGBC 3BWAB 3O45B 3CZJA 6FABL 2IF7A 2BFVH 4Z0XA 2P8LA 1MAJA 4HMDA 2X4QA 3C6SB 2ZZUT 1DVFD 3GK8H 1NAML 1H3WM 1KLFA 2VLRA 3G5YA 1DQQB 3AM8C 4D9QD 3JV6B 4XVUD 5EU4A 5HYJE 4R8WL 4BFIA 1RV6X 3RX7A 5I2IB 4MJIE 3L5HA 1CFQA 3MNVA 4YGAB 2BJML 3D9AH 3QQ4B 3ZKNC 5MEPA 4RMTA 2NY5H 4YPGB 3AS1A 2BCKB 4GH7B 3MC0A 1XAUA 3GSOA 4QRRB 4YIQA 2A6JB 2NY7H 4NQCD 2DI7A 4MDIB 4Z7QF 2F5AL 2FD6L 3PWJA 4Y4HC 3CK0H 4R9HA 1A7OH 1P1ZA 2P1YA 3WNOA 2HH0H 2MCG1 4UDUA 4GAYB 4ORGA 4KZDL 3BH8B 3T65A 1WTGT 1NGYB 4G42B 3QIUA 3QXVA 3QIWB 4JCLA 1J86A 3W0WB 5EBLA 2IH1A 1KEMH 5D2LE 3WJLA 4KJYB 4PJ8C 4M9OA 1KIQB 4LCYB 2XA8L 5D9SB 4RMWA 3FONA 1KNOB 3SE4A 3FOMB 1XGUB 1A02N 2VR9A 3QG7H 5CLWA 5DMGD 2XZAH 1VHPA 3FAXA 4CDGC 2F9BT 3GMQA 3VGAC 2BSRB 4DGVH 3SKNB 2YEZB 3IF1B 2GJZB 4FQCH 4S1QH 1KIRA 4RBPK 3ME0A 3IXTA 5KVMC 1QFPA 2X4RB 4EI5C 2AV7B 3MACL 4X4ME 4DEPB 4S0UC 4F57L 4J6RL 4BFEA 3QNZA 4Y5YA 3KYAA 3BPOB 2NR6D 2NY7L 4JPWL 5GZOD 4OCRL 3ULVH 3PG2A 3U30B 4YC2C 4PJFE 5HHVH 4LP5A 3QJFB 2AS5M 3O6LH 2P43B 1T7YA 3EAKA 4ZSOA 4R2GC 3LN4A 2XY1A 5IFJB 5HGHA 1G84A 2QQKL 3HE6D 4QHUB 4QXWA 4YHKH 2IPUK 3L5XL 1PQZA 5ACLA 1G6VK 3OKDA 5D1ZA 2DQTL 5D71L 2IH1B 1DBKH 3W9DB 5B8CC 1GGIH 2ZG1A 1TFHA 3VFMA 3O4LA 3QRFM 4WI7A 1N6QL 1VGEL 3SO5A 2YBRA 4QKXB 1LO5A 4D0CB 1M7IA 5SWQB 2NR6C 4ZFOA 3ESUF 1JPSL 5E2UH 1P4BL 2FBOJ 5KSVB 1QR4A 1FE8L 1AD0B 2NNAA 3JBG7 3KVQA 2OBGA 4YXKH 4Q0XH 1AD9A 3BYTA 5EIQA 1QYGL 2HP4A 4PJXB 1SMAA 4X6FB 1T0NB 1YYMH 1AIFA 1WGOA 5D1XB 1XR8B 4GQ9L 4ENED 4TUKH 4E5XB 3NFNA 5IR1A 3QUMH 1LK3L 3QISA 4TUJB 4JFXB 3L3JB 2YC1B 3L3KA 2PCPB 1C12A 1UWEH 3QCTH 2FECI 3U82B 3WBDA 2ZUTA 1KFAL 4NSKB 5SV3A 1QRND 1R3IL 1K6QL 5FOBA 1M71B 3AAZA 3ZSTA 4HD9A 2N1KA 2CD0A 2Y1VA 4JRYA 4G9FB 3O3BB 1K8DA 1S7SA 3GSNB 5L88H 1VFBA 5JMOC 3QFJA 4ZQKA 4NRXA 5CD3B 1MCCA 1HH9A 4P5TB 5GRJL 4YHPB 4X0KB 3NFNB 1H3XA 3LN5A 2FB4L 4P9HC 5FB8B 1IKNA 3BI9X 3DO7B 5DF0A 5J11B 3P73A 5T5FH 2AXFA 2QJDA 3TVMB 2UWEE 5BXFB 5CZXC 3W0WE 2J2ZA 1YMHA 4PYHA 3MCKA 3QQ9D 5HYFA 1OAYL 2VDKL 1E27B 1I85A 3RDTD 4ACPA 2J8UF 3HC0A 4KI5D 4KROD 1VGKA 1OAQH 1LO5B 5DJXB 4CRPA 4ETYA 3DV4B 5FHBH 5FOJA 4JFZL 4GG6F 4XCYB 3KYMA 5EZLA 3NZHH 4PRDB 4V1DA 2O93L 4TUKL 1L0YA 4CMHB 3T77A 1W72A 1UVQA 1KIPA 5GSRB 5DUBB 1AC6A 3L3JA 2XICA 4JRXE 2O61A 4PV8B 1H8SA 2EYSB 1NLBH 2LE9A 1IGFH 1K8IA 2M2DA 1RK1A 5E56A 4Z7WF 4RGNC 1GGIL 4G5ZH 4KI5E 4PJEE 4K8RL 4PRIB 1FC2D 5IB2B 1F42A 5ANMB 3TZVA 4ZUUB 1P84K 2CDGA 4CW1B 1PYWB 3K2MC 3WLWD 1UA6H 1QRNB 3KLAA 4U6YA 4Z7UB 2GEEA 4CVUA 2E5EA 5EZIH 1J0JA 2PXYA 2F54E 1G0YR 3LKSA 3FQRA 1S7TA 3GHEL 1BM3H 1BREA 2BNUB 4QHNB 1D6VL 2CLVB 1JGLH 4OLYL 1OF2A 4M7ZC 4F9PA 5C0CE 5AYUL 4R90L 3TBSA 5L2KB 3OMZA 1YNLL 3MLSL 3EYFA 3LB6C 1WWAX 3S35L 1XIWC 1RHHB 5JHDB 1FBIL 3CX2A 4FRWA 3PDOB 3BMVA 4RFOH 1I7ZB 2VQUA 2JKXA 2FL5B 4I3SL 3LOWA 5CSZA 3BUTA 2YN3A 1DEEA 3JWOH 3VD9A 2F54D 4PG9A 1MCBA 1FO0A 4O2EB 3MRRB 1DUYB 3DARA 1O5DT 3FN0H 3ULVF 4JR9H 4JRYB 1CFSB 3BD4A 3T04D 5C3TA 2JIXB 1HOCB 1S7WB 1FNEA 1TJHH 5CEXA 2DTMH 3X11A 5GGVH 4ORGB 3OF6D 3IDIB 4G8FA 3WFBL 1EEUA 1ORSA 3T65B 4BYHA 3H3PH 3F5WB 4N8VG 5C0BD 1JRHI 5IWLA 2ZCKH 2Z31B 1RJLA 2L4OA 4YR6B 1F3RB 2NW2B 5H37G 4OB5L 4NWTL 2ZOKB 1FIEA 3D2UA 1MHHA 3KLAB 1QRNA 5SWSE 3IFPA 1IGTA 1R3IH 4RFNC 5A43C 3W11C 3GMLA 1JCKA 4X6CF 2BY2A 5J89A 4WHCA 1GHFL 1MFDL 4HCRH 1NBVH 2J5LB 3WFEL 3FONB 3VG9B 1D6VH 4NWUL 5E08L 4B7LA 1EJOL 2ZCLH 5BVJA 5IESH 3Q3GA 4PRBA 4ODHL 1X5YA 4HIXL 1A4KA 1YNLH 5F89B 3RY5A 4U1MB 2HTLD 3BYYA 2H26B 3WKMH 4XC3L 1FBIH 4ZFOL 25C8H 3V2AR 3BKYH 1I9RH 2OXGA 1ZEAH 3S7GA 4M6OL 1MLCB 3P2TA 1MOEA 1UACL 5TE4L 3OXSB 2ZPKH 1LQSR 1HHIB 2BVYA 1WBXA 2ZJSH 4ESKA 3ARFD 5DJYA 2RGSA 1JGVH 5E94A 1MHCB 5F1OB 2YPVL 5TGBA 3OKKB 4TQEH 4BQCA 3T3PE 3DGGA 5HHOA 1DE4A 3L3DB 1IAIM 3L9RA 4LEXL 4PJDB 1T7XA 4R4ND 5DRWA 2DLEA 5C08B 5SWZD 5GGRA 2FJHA 4I2XE 3MV9D 5CJ8A 2W9EL 4Y16C 5DD0H 3QO0B 3RU8L 3KXFE 3SDAB 3RZWA 3MFGB 3WSQL 1O7SA 4RBPH 1XMWA 2YD5A 4JFOB 1PEZA 3PDOA 3L5WB 3MTRA 1L0XA 1S7VB 4DCQA 1G0DA 2EE2A 2PW1A 5K9JL 3BZEA 2XTJC 3BIKA 5KAQG 4KKCD 1FQ9C 1A1NA 1B6DA 5C7XH 3HC4L 3K7UA 1FVDB 3OKOB 2HAZA 1N0XL 2GTZA 4XCCL 5CMAB 2XWBB 5T1MB 1J1XH 5E4EC 5D7SH 1RVFH 1KSRA 5C07A 3F58H 5BRZE 5HPOA 3T2QA 4LARL 4HUWB 2A73A 2P4AB 4JFPB 2EXYC 3EIFA 2V7NA 2E7LE 1B3JA 3MV8A 4ZXBD 3N1MC 3PWNA 4HIHB 5DWUL 4Y1AB 1BVZA 2NW2A 3TIDA 5E8NA 5D1QB 4Y16A 3C60A 1ZMYA 1QHPA 1JYWA 3D5OF 3EJZD 2K1MA 1KXVC 3LIZH 2VITB 4LEXH 3ZYIA 4KPHH 4YGVA 2BVEA 5CAYB 2OP4H 3B9VA 4U1KA 5F7FA 1OPGH 4FZ8L 3TPUB 5ALBL 3LHPL 2W9EH 2ZCLL 3SE4C 4XXDB 4L8DA 2DQUL 4YC2B 8CGTA 1I3UA 4ZS6C 1X5XA 4XVSL 1A7NH 4QOKD 4Y89A 5DSCB 1RUQL 3LAFA 5JDJA 2FGZA 1HYSD 2AK4E 3FZUD 3NFPB 3EKCA 5E6YA 1JFQL 4AEHL 2ZNXA 1HQRB 4XNUH 4C56B 1CL7H 3WLWC 5CHNA 4AM0B 4J12A 1GSMA 3S36L 4PJ7E 5ADOH 1EHXA 3I3EA 2VUOA 2CDEB 4NHCH 3ALWA 5GSVA 2BRRH 2AK1L 2FLRT 2IG2L 2YKLL 3TNMB 5ICXA 2Z4QA 1A47A 3F65A 2OSLB 1BQHG 2H45A 1EJOH 2SEBB 3U9UA 4PJ8A 2WWMD 4QOKE 3F62A 4DW2H 1E4KC 4KJPC 4H8WC 2UY6A 1RZIA 1Q0XL 5F3BA 3P9LB 2YHGA 5I16A 2APFA 2BXYA 3E6HB 3H3BC 1MCJA 4PR5B 3TJHC 4MA3B 3BH9A 4P3DB 4XPFL 1JPTH 4LLYA 1BOGA 3I02A 5HVFB 5CD5D 1D9KD 1IAII 2HJKB 1T0MA 4YHOL 3VGEA 4G8GA 2VLLB 4APQA 2Y36L 5D70L 3DYOA 4L4TE 1W0YT 3V0WL 4PGDA 3IDGA 4YHLL 4Z95L 3QHZH 2ZUSA 1CZ8H 1ADQH 4NO3A 2IAMC 4U7KA 4W4OC 4XVSH 4JVWA 1UWGL 1JHKL 4X7FC 3IJYA 1MCPH 4XMLH 3DGCR 4WUUE 4NRYB 1QHOA 2H1PL 5CILL 5B39A 3WFCL 4XHJD 4IDLA 3S36H 1Z9MA 4PJGF 5FO7B 4XP9H 4IMKC 3KYNB 3WSQH 4X7EC 2GCYB 5C07B 7FABL 3EOAA 2GITA 3EO1A 4H1LB 3QPXH 1OL0A 5E6IA 3EGSA 5CJQH 1L6XA 4JO3H 4OQ1A 5FYLE 4YHYB 5EFIB 5KZCB 2ZKHH 3ARDC 4OAWA 1FNAA 5M7QA 3HTLX 4OCSH 4LSRH 4NO0B 4TYUA 3FB8A 3BKJL 1NBZA 1S9WB 4OUOA 2R0KH 2OXHA 2FWOA 4QRRE 1OTTD 3CFKB 3F58L 4XNXH 1GIGH 3MLUH 1OLZA 3G6AB 1RIVH 1HQ4B 4NO5B 1NMAL 1BEYL 3S37X 1FP5A 3U9PL 2IALA 3CK0L 4AEIL 1LO0H 4KVNH 2NW3B 1F58H 5CBAB 4I8DA 3F8UB 2BK8A 5DR5L 4GAJL 5FDWA 1AGDB 1QSVA 2VLJB 2AVGA 1JTOA 5EUOF 3F7YA 2DQCL 4L4TD 3ZKQD 2A74A 3CDFA 3D18B 3L3GB 4D8PB 3UYRL 1RUPH 1SM3L 4XPTL 1K2DB 4RDQG 4C83A 3D3VB 2P5WE 3CPLA 5EH1A 4XBPA 1G9NC 4LGRB 5I8CB 5IKCB 1I4FB 4XPBL 4OZHE 5T1LD 3GUTA 3JTTB 1S9XB 2FZ3B 2LU4A 5I8KH 4LGSB 4NQXA 2A77H 4OLXL 4P5TC 2XZAL 4R0LB 3V6BR 3MGTB 4HS3A 5HYJA 2EE3A 3GMPB 1RULH 1WBYA 2FX9L 3SDDA 4P2QE 1HINH 1F3DJ 3VWKD 1YC7A 5DQDL 1AXSA 4U1GC 3RWFA 3QIBC 1NGPL 1KN4L 1RMFL 1BLNB 2AKRA 4ZODA 3R8BB 1GIGL 1J05A 5D7LB 1AR2A 3O0RH 4LHUG 5IBUG 3K8KA 1REIA 3EJYD 4KKBD 2A6DA 1H15A 4N0UB 4OGZA 1E0OB 1F58L 3MRLA 5MEND 4RAVA 4TQEL 1FFPB 2HA1A 5HHOD 4PV9B 4EOWL 5EO1B 2NY6D 2QSQA 5F1NA 3VFPB 2DQCH 3HHRB 5D2LA 3QEHA 3DUUA 5CCKL 3KYMB 1ZWIB 2Y9RT 4H5SB 5DK2A 1QR1A 3K4DA 4JHAL 4JHZA 2OS7A 4PY8I 3RPIB 5DJXA 5GGRY 4ODWA 1E28B 35C8H 3GSXA 5E00A 1XGQA 1MCPL 3IDGB 3RVXD 3O4OB 4AENB 2BHUA 1CXIA 3O3EA 4X83A 2C7UB 1QSFE 5IB4A 3WDHA 1HWHB 2HLAA 3JXAA 3PJSA 3D39A 1OTSD 5B22A 2X70A 1CXFA 3UTSA 3TIEA 5L2KE 4MAYB 1I1FB 1M05A 1UC6A 3KPPA 5EUKA 3QNYA 3RA7L 1D5BA 3CFDA 3V4UH 2AEQL 4JQIL 5D5MA 2W91A 3HI5L 4NUJA 4X4MA 1H3PH 3GRWL 5IBLC 1T1WA 1F4YH 1QBAA 1K85A 2GCYA 1FL6A 3QXAA 2ORBL 5IOPB 1OARH 2X4NA 5HI5D 1QBBA 4IIQB 4BM7A 4NIKB 1J1XL 4QRPD 2VQ1B 4P2QD 1DBML 3GO1L 2QQKH 4X7DC 3VGGA 4JDTL 4HIXH 1EGJH 5HD8D 2AEIT 1YYLH 3V4PL 2IPTH 4JREC 2GY5A 4OZIA 1IARB 4U6VL 4MXWL 4MAYA 4TN9A 4APQD 4YHYC 1EEQA 4P46D 1R3KA 4RA3A 4U1SB 4CVZA 4ERSL 3SPVB 2NZIA 1BJ8A 2AQ1A 3GIVA 5E2TL 3GBNH 4YFEA 2Q6WB 4WW2C 1TMCA 5A2JH 4LPYA 4ISVA 5I1CH 1CLYH 1YPZF 3G9AB 3QEGH 5HYQB 1EO8H 4FFEX 3VFNB 3QIWA 2VQ1A 1BFTA 3I50L 3O4LE 1NBQA 3RX8A 4EJ1C 2OTUB 1B6UA 3O2DL 3LS5H 4JZJC 5J56B 3SJVA 3BXNB 2YOCA 3LKNA 5HHMD 5FXCH 4K3DH 2P45B 4L8BA 1I7TB 3H2WA 4WO4A 4YWGL 3T0EC 1KV3A 1RUMH 1BZ9A 4F7TA 3RA7H 3KPSD 1N59B 1XGRB 3HI1A 43C9A 4M8QB 1QFUL 3AROA 5IT2L 4PJHB 5TPWL 3IVKB 2WV3A 1LO3H 4B41A 2YWYA 1K8IB 3LH2L 4PJCF 4WFHD 5JA8B 3ARXA 1JGEB 2XY2A 4KK5C 4UV4H 3SHSA 1RIUH 4Z0BH 1T0PB 3C2AL 4FZEL 4ZS6D 3X13B 4AIOA 1HSAA 3CDYA 5CEZD 4QRPB 2EH7L 2IADA 5F1IB 3OZ9H 5FYKD 3JVGC 1P2CA 1RI8A 3WIHL 1DQTA 1EH9A 2I24N 3UZEA 1I3RA 4HJ0D 1G9ML 4JM2A 3GKWL 1SY6A 1DLFL 3CXHK 8FABB 4P46B 3S88H 4IRZL 2ATKB 1C12B 1NCDL 3PP3K 3KPQB 2WAHA 4QF1A 4LCWB 3TVMA 5BXFA 5IGXL 3CVHL 3O2WL 2KDGA 4JY4A 4LSVH 5C0GA 1EFXD 2P8PB 1FL3A 1EVUA 5TFSL 3EW3B 3RIFF 1T89C 1MIEH 1D5MA 4NKDA 3S3SA 3H9SB 4QCIB 3BO8B 3HE7A 4LEOB 3ORJA 1OARL 3DGGB 3VFOA 5GGSA 1RUML 1A7QL 4NQEB 5TGBB 3UO1H 5I8OH 3KYOA 5GS2D 4LAQH 1UKQA 4KQ4H 5B38G 1NQBA 4M48L 4PRPD 3ZYZA 3AUVA 4BSWA 2V17H 3VCLB 2YZ8A 4YXHL 5JUEL 2XNAA 4UB0L 5FUCC 2WINB 3B2UC 5KN5B 3K80A 4J8RA 3SGJC 5DJZB 2I9LA 5ADOL 2LVCA 3CC5A 4N5EC 2HTKD 4Y4KD 4YHOH 1F4YL 3TLRA 5JOEA 4JFOA 2CGRH 4XPHL 4Z7UE 5AZEL 4D2NA 2A38A 2F5AH 2FD6H 1JF1A 2X7LB 5A2IH 4PJEA 5E8EA 3RFZC 1SEBA 1P7KB 4BUGA 2KL6A 5FA4A 2CKBH 3UTQA 3NBNA 4E0RA 4OIAA 2XWBA 4D0BA 4WUKL 2VC2L 4PFEA 4MS8C 1MF2L 1FVDA 1IBGH 1JNNL 3EYVA 3ETBF 3PGCA 5D7IE 5H2BB 2PUQT 1BZ9B 1NGWB 2F54A 2AEPH 4X9HA 2APVA 4TSCL 4X0KA 3LKNB 1Q9OB 5FGCE 4ZQKB 3E2HB 2JK5A 1EHNA 2ATKA 1ETZB 4GKZB 3LS4H 2W9DL 1F4XL 4I77L 2IANB 5MP6H 1AKJD 1CLYL 2X4SA 3L5XH 4UDTA 1HKFA 4Y16B 2AJUH 3G6JA 3LKOB 4WHTA 3C5ZC 2ZKHL 2DOCA 2XG4A 4WEBL 1KBGH 3TO2B 4YDKH 5I18L 3WFDL 1RZKL 2A0LD 4Y5VA 5FYJL 3VFOB 3REVA 2X1WL 4R3SA 1TQCC 1ZT4B 4GG8A 4M7LT 5EBMB 3NGBB 3U0WL 5ETUB 3LEYH 3HC0B 3L3OB 2VRAA 1Z2KA 4U1LA 1BF2A 1UJ3A 1CXEA 2VWEE 1Q72H 2W59A 3BEWB 3D2UD 4JDZB 2ZNWA 3BP6B 4PJHF 4XPHH 5AZEH 1AHWA 2VUYA 4JQVA 3S4SB 5HYSB 4XMPL 5L9DH 3VFRB 3U9PH 3VE0A 1EVTC 3BGMB 3IFPB 3DV6B 3HZMB 1IM9D 1A6AA 2D7NA 4LK4A 4YE4H 2G75B 1KJVB 1RZ7H 1OAXL 1QFHA 3MO1A 4LRNH 3UROR 2EO9A 2VAJA 4JG0L 3OKNB 2ILLA 4PJXF 2AJZA 4ZS7L 4FQXB 3FB7B 1ZT4A 1DVFC 4HH9A 4P23B 5JXEA 1WUNT 3MRRA 4I0PA 1NLDH 3GI8L 1YEJL 4PLJD 5D8JL 2HVJA 3U6RA 2P8MA 4ZUUA 1JTPA 5J4MA 2ERJC 1QACA 3MLUL 1DDHB 2BNQB 5E5UB 5HYSA 4YXHH 3E6HA 2V2XA 1OB1A 4Z8FL 3W5MA 4LPCA 2COQA 2XWTB 2C3VA 1KGCD 4M03A 5I73C 3F12A 3QNYB 4FS0A 4YR6A 5DRZA 2BVTA 5DD3L 1JNLL 1N7MH 5JHDA 1OP9A 4LLUA 5LGHL 3MGOA 3PWPB 5J13C 3MRKA 2OL3A 2R2EA 3HZKB 5C70A 2GQHA 5ANMA 4Y1AE 2DRUA 4WI8A 4LSSL 4HWUA 5IMMB 2JCCE 1UCBH 2MTPA 3MYJB 4DKFL 2UV3A 5I74B 2D31A 1A4KB 4JM4L 3KYKL 5FUZL 1FSKB 4U6HB 1L9MA 5H37H 4G6MH 2OZ4H 4NJ9H 3MR9A 3M07A 3BQUD 3C6LC 5E7BA 3V5DA 4PTUA 5K33A 3PV6A 2WINA 1QFWI 3QSKB 2RAMA 1FSKC 5F7HA 5D5MF 4KRPD 1X9QA 1ED3B 1WQVT 2D7TH 2YZ1A 2AK4B 3X17A 4F7MB 1AQKH 2Q8BL 2R29L 1IQDB 1QSEB 1CGWA 4HUVB 4FFZL 4PJAF 1IE5A 1Q0YH 1Q94B 4Z77B 2N7BA 4JFQB 1IBGL 3TNNA 3VFGL 2DLIA 2QR0B 4CJ1A 5T3XH 2AP2A 2VXVL 5EPMA 1CGUA 1MCNA 2YD8A 4FMKA 3ES6B 4TVSa 5TF1L 2AK1H 4OF6A 3NCYS 3TYGH 1KENL 3EJYC 4M5YL 4OQTL 1EPFA 2E27H 1KEGH 1UM6H 1FZKA 3VFTB 1FIGH 4R96B 1WITA 5F7EL 1MHEB 2EC8A 4PJIA 3QWRD 2FEDD 4DCQB 4LCUA 4LLMB 3LRSA 43CAB 1DQLH 1EAJA 1QFUH 1BBDL 4M02A 4XP4H 2IPTL 1WZ1H 3DURA 4Y4HD 2HVJB 2ITCA 1LO4H 3FO2A 1HIML 4OZGE 4OCWL 3MLRH 2CK0H 1KCKA 4KTEH 5JIHA 3E0GA 4Z0XB 2AV1B 1QLEL 5ERWB 5GGRB 1U8OA 1T1ZB 1S9XA 4XXCA 1H3PL 2CJUL 4DFIA 1KN2H 2VXTH 3DSFL 4JHWH 1VENA 5T1KD 1H0DA 1KCUL 3D0LA 3DI3B 2EDBA 1Q0YL 3I6KA 2NLJB 3LKQA 5SX4I 3VRLF 1CT8B 2CRMA 4NUGH 1QEWB 5DFVC 3VMNA 1MCOH 3L7EB 4PGCA 2BSSA 1QO3A 4BA8A 1S5HA 1S5IH 4QHMA 3WNKA 4GO6B 3O2WH 2OR8A 2V7HA 1QNZL 3JV0A 5IQ7L 3TEUA 4LU5H 4RWYH 5E2TH 2IFGA 3VXME 1FYTE 3JUZA 4XXDA 4XB8A 1MFDH 4YK4B 4XCEB 1TVBB 4ODSH 3GB7A 3T8XB 2HJFA 5BO1H 4GMTH 3LH2H 5JQ6L 4LHUA 3ZE0E 4PP1D 4ZDHB 1T20B 1EMTL 2FBJL 1MEXH 1YNTB 5FHAL 1AKJA 4WUUB 2DQEL 4LLUB 4GS7B 3QUXD 1MRCL 5DMIH 1EV2E 3L5JA 4YXLL 5FKAA 4Y5XB 2R56H 4HC1H 3K4AA 4A2LA 4M9PA 1G9MH 5F9JB 2ADFL 3MRGA 4G6AD 3ZLQC 4NZUH 3LD8B 4KKAD 4YAQA 4ZOCA 5L7XL 3VXQB 4LQFL 4U6XB 3WJLC 2J6EH 1I9EA 3WUZA 4JKMA 4OJFH 5DD5L 5DEZA 4CU6A 1T5WA 3MRMB 1BQLL 5JA9A 2VKXA 4G3YL 3MLXL 1SJVA 5BV7H 5A2KH 5DHXB 3UTZA 3H9YA 3OG6B 4WUKH 4ZSOE 4MQSB 3BDYH 3LKRB 3GM0A 3ARFB 1VB9A 3CLEL 2Y6SC 1J12A 1NJ9A 3QDGB 1MFNA 4LU5L 2EIZB 1KIQA 4KWUA 5KSUA 3GJFB 5LXGH 1BJ1J 1P7QD 3CSGA 3V6FA 4CMMB 1MREL 2DS4A 3PQYB 4XAWL 3TNMA 4ODXA 3MACH 4IRZH 5M95B 4ODSL 3P4MB 4RMVA 3WFHB 3TYFA 5ABDE 1AY1L 1UJTA 1CTOA 1CGSH 3T2NL 3MLVL 3VXMD 3RL1B 2YS4A 5FHAH 2BOCA 1LEKB 4GSDL 5C2UB 3P77B 4DEPC 1CDIA 1KCUH 2OI9C 4YZFE 1EBAA 3SDCD 2D0FA 3O41A 2EE9A 3T0EB 1JI1A 5I8OL 4I4WB 1NJ9B 1H0DB 2MJWA 4QXGH 5KVGH 4L29A 1H5BA 3DHJA 4D0DB 3RWIA 4Z7NF 2ADFH 4F9LC 2VH5L 3QEHB 1FFQA 3BPNB 1EEYB 4PLNC 1XCTB 3V5HA 4WCYL 2VLKE 3RY6C 1IAOA 5DD0L 1TETH 4JGJA 3B83A 4WI2A 5AUMB 5C92A 3STZB 5DRXB 1T5WB 2BVOB 3WDIA 4NBYB 2XTLA 3HRZB 5D1XD 1NAMA 4G7YH 5ADPH 3LMJL 4KUZH 3LV3B 3V7AG 1FNFA 3DOSA 5C0ND 5KG9A 1OOAA 5JQ6H 4NKOA 3U4AA 5SWZE 3V52L 2D9QB 4R7NA 3EDEA 3ZKXB 2VLKD 5DO2D 2FB4H 4HFUH 5SV4A 2ZOLA 3F7VA 2VR4A 5HYIA 1MCOL 3QI9C 1YECH 3KXFD 1RPQA 4JPVL 2VXQH 2WP3T 2CIIB 1JYVA 3ULUH 3NN8A 3MV7A 4GAYA 3BPCB 5DEGB 4LPXA 2AEPL 2HYMA 4YDVB 4LVHC 4YHNB 1G7QA 4GXVL 1EZVY 2GJZA 4XZUB 3NA4A 1LDPL 4BH8B 2DQFB 5EZJB 2Q7NA 4KMTL 3UZVB 1TDQA 2DLTA 1BFVH 3HG1B 1ES0B 4HK3N 3L1OH 3BGAA 3FT2A 1XIWB 5IROA 4CVXB 1L4IA 4FQ1L 1G7MB 4M3KB 2R0WL 4NP4L 2WANA 1RD6A 4JDTH 1VEPA 1CN4A 3GDBA 3LQZB 2DQDH 2A9ML 4N0CC 3HE6C 4OQTA 4IRSD 5KJRH 4KDTA 3RKDC 3HE7B 4LEOA 4Y4KC 1WVZA 5DFTA 3QDJB 1KJMB 1IAOB 1U42A 3TN0C 1C08B 4HUXA 1AGDA 4Q9RL 4V3DB 2GJ6E 3UPRA 3RIFK 1PKQE 1CXKA 5CBAA 1XF3A 4K8RH 1SJEB 3P11L 4K7FB 2AXJA 2OR9H 5KW9L 2I60H 3RJDA 4I0PC 1H3VA 2RHEA 4AEHH 3ARFC 5MEOB