1G03A

Nmr structure of n-terminal domain of htlv-i ca1-134
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
b'PVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITSYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTLV-I CAPSID PROTEIN
publication title Structural analysis of the N-terminal domain of the human T-cell leukemia virus capsid protein.
pubmed doi rcsb
source organism Human t-lymphotropic virus 1
molecule tags Viral protein
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2000-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1g03A00
4U0EA 1M9CC 1EIAA 4U0CA 2WLVB 2M8LA 4XFXA 1U7KA 1P7NA 2WLVA 4XROA 2XDEA 2EIAA 1M9FC 5HGMA 2M8PA 4U0BA 4XRQA 4PH0A 2X82A 2X83A 4DGAC 3H47A 4HTWA 4PH3A 4E91A 3MGEA 4J93A 1M9DC 4DGEC 4XFYA 2X2DD 2PXRC 2GONA 3BP9A 1L6NA 5HGLA 3P05A 1QRJA 4LQWC 1G03A 2GOLB 4B4NA 4WYMA 1M9EC 4U0FA 4NX4C 3NTEA 1M9YC 4E92A 4QNBA 1E6JP 2XGUA 2XGVA 1GWPA 4XFZA 2PWOA 2XGYA 2LF4A 2KGFA 1EM9A 2M8NA 1AFVA 1AK4C 2PWMA 4U0DA 5HGKA 2V4XA 2JPRA 5JPAA 4INBA 1D1DA 1M9XC 2Y4ZA 5HGNA 4PH2A 4U0AA 5HGOA 3H4EA
chains in the Genus database with same CATH superfamily
4U0EA 1M9CC 1EIAA 4U0CA 2WLVB 2M8LA 4XFXA 1U7KA 1P7NA 2WLVA 4XROA 2XDEA 2EIAA 1M9FC 5HGMA 2M8PA 4U0BA 4XRQA 4PH0A 2X82A 2X83A 4DGAC 3H47A 4HTWA 4PH3A 4E91A 3MGEA 4J93A 1M9DC 4DGEC 4XFYA 2X2DD 2PXRC 2GONA 3BP9A 1L6NA 5HGLA 3P05A 1QRJA 4LQWC 1G03A 2GOLB 4B4NA 4WYMA 1M9EC 4U0FA 4NX4C 3NTEA 1M9YC 4E92A 4QNBA 1E6JP 2XGUA 2XGVA 1GWPA 4XFZA 2PWOA 2XGYA 2LF4A 2KGFA 1EM9A 2M8NA 1AFVA 1AK4C 2PWMA 4U0DA 5HGKA 2V4XA 2JPRA 5JPAA 4INBA 1D1DA 1M9XC 2Y4ZA 5HGNA 4PH2A 4U0AA 5HGOA 3H4EA
chains in the Genus database with same CATH topology
4U0EA 1M9CC 1EIAA 4U0CA 2WLVB 2M8LA 4XFXA 1U7KA 1P7NA 2WLVA 4XROA 2XDEA 2EIAA 1M9FC 5HGMA 2M8PA 4U0BA 4XRQA 4PH0A 2X82A 2X83A 4DGAC 3H47A 4HTWA 4PH3A 4E91A 3MGEA 4J93A 1M9DC 4DGEC 4XFYA 2X2DD 2PXRC 2GONA 3BP9A 1L6NA 5HGLA 3P05A 1QRJA 4LQWC 1G03A 2GOLB 4B4NA 4WYMA 1M9EC 4U0FA 4NX4C 3NTEA 1M9YC 4E92A 4QNBA 1E6JP 2XGUA 2XGVA 1GWPA 4XFZA 2PWOA 2XGYA 2LF4A 2KGFA 1EM9A 2M8NA 1AFVA 1AK4C 2PWMA 4U0DA 5HGKA 2V4XA 2JPRA 5JPAA 4INBA 1D1DA 1M9XC 2Y4ZA 5HGNA 4PH2A 4U0AA 5HGOA 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0E A;  1M9C C;  1EIA A;  4U0C A;  2WLV B;  2M8L A;  4XFX A;  1U7K A;  1P7N A;  2WLV A;  4XRO A;  2XDE A;  2EIA A;  1M9F C;  5HGM A;  2M8P A;  4U0B A;  4XRQ A;  4PH0 A;  2X82 A;  2X83 A;  4DGA C;  3H47 A;  4HTW A;  4PH3 A;  4E91 A;  3MGE A;  4J93 A;  1M9D C;  4DGE C;  4XFY A;  2X2D D;  2PXR C;  2GON A;  3BP9 A;  1L6N A;  5HGL A;  3P05 A;  1QRJ A;  4LQW C;  1G03 A;  2GOL B;  4B4N A;  4WYM A;  1M9E C;  4U0F A;  4NX4 C;  3NTE A;  1M9Y C;  4E92 A;  4QNB A;  1E6J P;  2XGU A;  2XGV A;  1GWP A;  4XFZ A;  2PWO A;  2XGY A;  2LF4 A;  2KGF A;  1EM9 A;  2M8N A;  1AFV A;  1AK4 C;  2PWM A;  4U0D A;  5HGK A;  2V4X A;  2JPR A;  5JPA A;  4INB A;  1D1D A;  1M9X C;  2Y4Z A;  5HGN A;  4PH2 A;  4U0A A;  5HGO A;  3H4E A; 
#chains in the Genus database with same CATH topology
 4U0E A;  1M9C C;  1EIA A;  4U0C A;  2WLV B;  2M8L A;  4XFX A;  1U7K A;  1P7N A;  2WLV A;  4XRO A;  2XDE A;  2EIA A;  1M9F C;  5HGM A;  2M8P A;  4U0B A;  4XRQ A;  4PH0 A;  2X82 A;  2X83 A;  4DGA C;  3H47 A;  4HTW A;  4PH3 A;  4E91 A;  3MGE A;  4J93 A;  1M9D C;  4DGE C;  4XFY A;  2X2D D;  2PXR C;  2GON A;  3BP9 A;  1L6N A;  5HGL A;  3P05 A;  1QRJ A;  4LQW C;  1G03 A;  2GOL B;  4B4N A;  4WYM A;  1M9E C;  4U0F A;  4NX4 C;  3NTE A;  1M9Y C;  4E92 A;  4QNB A;  1E6J P;  2XGU A;  2XGV A;  1GWP A;  4XFZ A;  2PWO A;  2XGY A;  2LF4 A;  2KGF A;  1EM9 A;  2M8N A;  1AFV A;  1AK4 C;  2PWM A;  4U0D A;  5HGK A;  2V4X A;  2JPR A;  5JPA A;  4INB A;  1D1D A;  1M9X C;  2Y4Z A;  5HGN A;  4PH2 A;  4U0A A;  5HGO A;  3H4E A; 
#chains in the Genus database with same CATH homology
 4U0E A;  1M9C C;  1EIA A;  4U0C A;  2WLV B;  2M8L A;  4XFX A;  1U7K A;  1P7N A;  2WLV A;  4XRO A;  2XDE A;  2EIA A;  1M9F C;  5HGM A;  2M8P A;  4U0B A;  4XRQ A;  4PH0 A;  2X82 A;  2X83 A;  4DGA C;  3H47 A;  4HTW A;  4PH3 A;  4E91 A;  3MGE A;  4J93 A;  1M9D C;  4DGE C;  4XFY A;  2X2D D;  2PXR C;  2GON A;  3BP9 A;  1L6N A;  5HGL A;  3P05 A;  1QRJ A;  4LQW C;  1G03 A;  2GOL B;  4B4N A;  4WYM A;  1M9E C;  4U0F A;  4NX4 C;  3NTE A;  1M9Y C;  4E92 A;  4QNB A;  1E6J P;  2XGU A;  2XGV A;  1GWP A;  4XFZ A;  2PWO A;  2XGY A;  2LF4 A;  2KGF A;  1EM9 A;  2M8N A;  1AFV A;  1AK4 C;  2PWM A;  4U0D A;  5HGK A;  2V4X A;  2JPR A;  5JPA A;  4INB A;  1D1D A;  1M9X C;  2Y4Z A;  5HGN A;  4PH2 A;  4U0A A;  5HGO A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...