1G0RA

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). thymidine/glucose-1-phosphate complex.
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 99
structure length 292
sequence length 292
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g0rA00
3Q4SA 4CJBA 5C1GA 2AM5A 3I0DA 1S4NA 4B2XA 3SXDA 4Y7TA 2BO6A 1H5SC 4YS8A 2RJ9A 3K8DA 1R80A 4P00A 4D11A 2Y6PA 4C2SA 2VSIA 1YP2A 4Y7GA 5CQMX 3OH0A 1H7LA 2D0JA 2V0IA 4FCEA 1ZJ0A 4D0ZA 5IDTA 3OGZA 1G95A 3N9WA 5C4EA 4UEGA 4R7PA 1H7FA 2RJ4A 1ON8A 5AJPA 2RJ1A 1LL3A 4HO3A 1EYRA 3TQDA 1G2VA 1VZTA 4HO5A 2AH9A 1GX4A 1HM8A 4KPXA 2W0VA 2XWLA 2FYDB 2ZU9A 2ZU8A 2Y4LA 1H4CA 1TW5A 2VD4A 1PZTA 3I0CA 3I0IX 1FZWA 1INIA 1R81A 3LW6A 1G23A 2BO7A 2Y7AA 1ZJ3A 1E5KA 4FCUA 3TZTA 4DDZA 5I1FA 4FQWA 2OI6A 2X65A 4FRBA 1G97A 1V82A 2VS3A 4M2AA 5CQNX 1YP4A 5C4BA 4GBPA 4MNDA 1WT0A 1YROB 3I0EA 1VZUA 1IINA 3F1CA 1H5RB 1GQ9A 1R7TA 1G0RA 4NAKA 4B5BA 1W55A 2W0WA 1HJLA 3V0QA 1H4DA 1ZIZA 3FOQA 5CQPA 4KC1A 3O3PA 1EZIA 1JV3A 1WSZA 4Y64A 3I0FA 1ZHJA 4JD0A 2X5ZA 4G3PA 1NMMB 4FRHA 1KWSA 5EJ1A 3DUVA 4G3SA 4HOCA 2X5SA 5IFYA 1JV1A 4KT7A 3OH1A 1ZJPA 5C4CA 1OMZA 1K4VA 4XWIA 3E25A 3NGWA 3OAMA 2A8WA 2YQSA 2YC5A 1G1LA 3D8VA 4Y63A 4ASJA 1ZCTA 1W77A 2AGDA 4FRDA 3CKJA 4NANA 1VGWA 3GUEA 1MP5A 1INJA 1XHBA 2FFVA 1ZJOA 5EJZA 4AC3A 4B2WA 1H7TA 4EEGA 4EE3A 1ZCYA 4ZDQA 4HO2A 1GA8A 2VXMA 2OI5A 5CMFX 5CMJA 1TZFA 3JTJA 2WAWA 4Y7UA 4EE4A 5C4FA 1FXJA 4KNXA 3PKPA 1W57A 4HO6A 2VS5A 3BCVA 1LZ0A 2AECA 4KC2A 4KQLA 2NXVA 1Z90A 1FR9A 2AM3A 4FREA 1H5SD 2XWMA 4Y62A 4FROA 2FYAA 2P6WA 2WEEA 5C38A 1VH1A 2JCOA 2JCJA 3RMWA 4FRMA 4KPZA 2VS4A 1QGSA 3V0LA 1I52A 5C1LA 1GWVA 4CJ8A 4Y7FA 3JUKA 4M28A 1QG8A 4EEOA 3OKRA 1GX0A 3SXBA 3T7NA 2O1HA 3ST8A 2Y4KA 2UX8A 1TW1A 2VSHA 3U2UA 3I0HA 4AAWA 2E8BA 2I7BA 3CU0A 3OH2A 3IOHA 3SXEA 2Z87A 5CMGX 3R2WA 3CKQA 1HM9A 2GGQA 1WT1A 4M2BA 2V0JA 3U0YA 4BQHA 3I0LA 3K8EA 2RIZA 2YESA 4Y6UA 1ZDGA 3U2XA 2MZBA 1NKHB 1WVCA 3V0MA 1FXOA 1H5SA 1S4OA 4DECA 1GWWA 5C4DA 4HO9A 5AJNA 3SXAA 2XWNA 5C36A 1VM8A 2PA4A 3Q7UA 5FTSA 1H5SB 5FYEA 1H7EA 4LW3A 1XZ6A 5L6SA 1LL0A 5HS2A 2A8UA 2CU2A 4FRLA 2RIYA 1VGTA 1YP3A 4Y9XA 3BRKX 4K6RA 4KNRA 5CQLX 5CMHA 1QWJA 2P73A 3Q80A 2D7IA 3ZGGA 2QGIA 3QVBA 2FYBA 2D7RA 4KXOA 4ECMA 4P02A 2WVLA 1FG5N 4FRAA 3V0NA 1S4PA 3D5NA 1VICA 1LZ7A 4NAIA 2O1GA 1R7XA 3V90A 4AYJA 1R7VA 1ZJ2A 3D98A 5FV9A 2RJ6A 5C3BA 3OC9A 3SPTA 4B3UA 2O1FA 4D0TA 1H7GA 2V0KA 2AE7A 3USRA 1VGZA 1R7YA 5C1HA 4CJCA 4EEMA 3U2VA 1H4EA 3CKVA 5CQOA 5C49A 4D11C 4FRQA 2Y4JA 1H3MA 1R7UA 1LZIA 3I0GA 1FR8A 4KC4A 1G3LA 5C3AA 4B4BA 4M4KA 2OEGA 4IRPA 2WVKA 3V0PA 1HV9A 1G9RA 2OI7A 5DDTA 5JQQA 2RJ8A 3CGXA 4NALA 1FOAA 2PGYA 2JCLA 2Q4JA 2RIXA 4MYBA 1WT3A 4LW6A 2YQCA 2P72A 2FY7A 3T7MA 1V83A 1R82A 4G87A 1WT2A 3HL3A 2VXLA 3V8ZA 2WGZA 5L6VA 1FGGA 5C8RA 1PZYB 1NWGB 3T7OA 2APCA 3U2WA 3DK5A 2FFUA 1FO9A 4B42A 1TVYA 3EE5A 3F1YA 4BMAA 3FWWA 1HJJA 1O7QA 1OQMB 2RJ5A 1ZI3A 4IRQA 1MP3A 1FRWA 2WE9A 2ZU7A 2YC3A 1LZJA 1VGUA 1IIMA 1FGXA 5C3DA 2ICYA 3PNNA 4ARWA 4EVWA 1ZDFA 4HO8A 4Y7VA 1LL2A 1FO8A 2RJ0A 3OH3A 5FUHA 2XMEA 2E3DA 4L41C 1ZI5A 1H7HA 4B4GA 5AJOA 3U0XA 5C47A 1SS9A 1VZXA 1ZJ1A 5J49A 3RMVA 4HG6A 3ZF8A 2PGVA 3KIAA 2BO4A 1H5RA 2Z86A 2XMHA 1ZCUA 4HCQA 3ZLKA 2AM4A 3V91A 1FWYA 3E26A 1G93A 4JISA 5IDSA 1NQIB 1VPAA 3SX3A 3ZLLA 2YCMA 4FRPA 3ZGFA 2V0LA 3OH4A 5FU8A 3SX5A 1NF5B 2RJ7A 4D48A 3I0JA 4EEAA 1ZCVA 2FYCB 3SX7A 2WVMA 3USQA 1H7QA 3SXCA 2PX7A 1JVGA 4G3QA 2DPWA 4ASYA 3IOIA 2YQJA 2AESA 3I0KA 1QGQA 1JVDA 1ON6A 1MC3A 4DE7A 3SX8A 1O0RA 5FTVA 3U2TA 1VH3A 1HM0A 2VFZA 3POLA 1NHEB 3RSBA 4EE5A 3JUJA 3CKNA 4HO4A 4B4MA 3DJ4A 2I5KA 2QKXA 1ZI4A 2BO8A 1GQCA 3R3IA 5BXCA 2YQHA 5C48A 5DDVA 5FU0A 3V8YA 2V0HA 5EIYA 1G8OA 1JYKA 1OMXA 1H5TA 4HO0A 2ICXA 4AYLA 2X60A 1JYLA 2JCKA 2QH5A 2Y4MA 1H5TB 1LVWA 2RITA 1O7OA 3PKQA 1O23B 1ZI1A 2GGOA 4CVHA 4E1KA 2I5EA 3SXGA 1MP4A 1V84A 3IOJA 4KRVA 5CMIA 2OEFA 4Y6NA 3V0OA 4J18A 3CKOA
chains in the Genus database with same CATH superfamily
3Q4SA 4CJBA 5C1GA 2AM5A 3I0DA 1S4NA 4B2XA 3SXDA 4Y7TA 2BO6A 1H5SC 4YS8A 2RJ9A 3K8DA 1R80A 4P00A 4D11A 2Y6PA 4C2SA 2VSIA 1YP2A 4Y7GA 5CQMX 3OH0A 1H7LA 2D0JA 2V0IA 4FCEA 1ZJ0A 4D0ZA 5IDTA 3OGZA 1G95A 3N9WA 5C4EA 4UEGA 4R7PA 1H7FA 2RJ4A 1ON8A 5AJPA 2RJ1A 1LL3A 4HO3A 1EYRA 3TQDA 1G2VA 1VZTA 4HO5A 2AH9A 1GX4A 1HM8A 4KPXA 2W0VA 2XWLA 2FYDB 2ZU9A 2ZU8A 2Y4LA 1H4CA 1TW5A 2VD4A 1PZTA 3I0CA 3I0IX 1FZWA 1INIA 1R81A 3LW6A 1G23A 2BO7A 2Y7AA 1ZJ3A 1E5KA 4FCUA 3TZTA 4FIYA 4DDZA 5I1FA 4FQWA 2OI6A 2X65A 4FRBA 1G97A 1V82A 2VS3A 4M2AA 2J0AA 5CQNX 1YP4A 5C4BA 4GBPA 4MNDA 1WT0A 1YROB 3I0EA 1VZUA 1IINA 3F1CA 1H5RB 1GQ9A 1R7TA 1G0RA 4NAKA 4B5BA 1W55A 2W0WA 1HJLA 3V0QA 1H4DA 1ZIZA 3FOQA 5D91A 5CQPA 4KC1A 3O3PA 1EZIA 1JV3A 1WSZA 4Y64A 3I0FA 1ZHJA 4JD0A 2X5ZA 4G3PA 1NMMB 4FRHA 1KWSA 5EJ1A 3DUVA 4G3SA 4HOCA 2X5SA 5IFYA 1JV1A 4KT7A 3OH1A 1ZJPA 5C4CA 1OMZA 1K4VA 4XWIA 3E25A 3NGWA 3OAMA 2A8WA 2YQSA 2YC5A 1G1LA 3D8VA 4Y63A 4ASJA 1ZCTA 1W77A 2AGDA 4FRDA 3CKJA 4NANA 1VGWA 3GUEA 1MP5A 1INJA 1XHBA 2FFVA 1ZJOA 5EJZA 4AC3A 4B2WA 1H7TA 4EEGA 4EE3A 1ZCYA 4ZDQA 4HO2A 1GA8A 2C0NA 2VXMA 2OI5A 5CMFX 5CMJA 1TZFA 3JTJA 2WAWA 4Y7UA 4EE4A 5C4FA 1FXJA 4KNXA 4O6NA 3PKPA 1W57A 4HO6A 2VS5A 3BCVA 1LZ0A 2AECA 4KC2A 4KQLA 2NXVA 1Z90A 1FR9A 2AM3A 4FREA 4FIXA 1H5SD 2XWMA 4Y62A 4FROA 2FYAA 2P6WA 2WEEA 5C38A 1VH1A 2JCOA 2JCJA 3RMWA 4FRMA 4KPZA 2VS4A 1QGSA 3V0LA 1I52A 5C1LA 1GWVA 4CJ8A 4Y7FA 3JUKA 4M28A 1QG8A 4EEOA 3OKRA 1GX0A 3SXBA 3T7NA 2O1HA 3ST8A 2Y4KA 2UX8A 1TW1A 2VSHA 3U2UA 3I0HA 4AAWA 2E8BA 2I7BA 3CU0A 3OH2A 3IOHA 3SXEA 2Z87A 5CMGX 3R2WA 3CKQA 1HM9A 2GGQA 1WT1A 4M2BA 2V0JA 3U0YA 4BQHA 3I0LA 3K8EA 2RIZA 2YESA 4Y6UA 1ZDGA 3U2XA 2MZBA 1NKHB 1WVCA 3V0MA 1FXOA 1H5SA 1S4OA 4DECA 1GWWA 5C4DA 4HO9A 5AJNA 3SXAA 2XWNA 5C36A 1VM8A 2PA4A 3Q7UA 5FTSA 1H5SB 5FYEA 1H7EA 4LW3A 1XZ6A 5L6SA 1LL0A 4MIXA 5HS2A 2A8UA 2CU2A 4FRLA 2RIYA 1VGTA 1YP3A 4Y9XA 3BRKX 4K6RA 4KNRA 5CQLX 5CMHA 1QWJA 2P73A 3Q80A 2D7IA 3ZGGA 2QGIA 3QVBA 2FYBA 2D7RA 4KXOA 4ECMA 4P02A 2WVLA 1FG5N 4FRAA 3V0NA 1S4PA 3D5NA 1VICA 1LZ7A 4NAIA 2O1GA 1R7XA 3V90A 4AYJA 1R7VA 1ZJ2A 3D98A 5FV9A 2RJ6A 5C3BA 3OC9A 5D92A 3SPTA 4B3UA 2O1FA 4D0TA 1H7GA 2V0KA 2AE7A 3USRA 1VGZA 1R7YA 5C1HA 4CJCA 4EEMA 3U2VA 1H4EA 3CKVA 5CQOA 5C49A 4D11C 4FRQA 2Y4JA 1H3MA 1R7UA 1LZIA 3I0GA 1FR8A 4KC4A 1G3LA 5C3AA 4B4BA 4M4KA 2OEGA 4IRPA 2WVKA 3V0PA 1HV9A 1G9RA 2OI7A 5DDTA 5JQQA 2RJ8A 3CGXA 4NALA 1FOAA 2PGYA 2JCLA 2Q4JA 2RIXA 4MYBA 1WT3A 4LW6A 2YQCA 2P72A 2FY7A 3T7MA 1V83A 1R82A 4G87A 1WT2A 3HL3A 2VXLA 3V8ZA 2WGZA 5L6VA 1FGGA 5C8RA 1PZYB 1NWGB 3T7OA 2APCA 3U2WA 3DK5A 2FFUA 1FO9A 4B42A 1TVYA 3EE5A 3F1YA 4BMAA 3FWWA 1HJJA 1O7QA 1OQMB 2RJ5A 1ZI3A 4IRQA 1MP3A 1FRWA 2WE9A 2ZU7A 2YC3A 1LZJA 1VGUA 1IIMA 1FGXA 5C3DA 2ICYA 3PNNA 4ARWA 4EVWA 1ZDFA 4HO8A 4Y7VA 1LL2A 1FO8A 2RJ0A 3OH3A 5FUHA 2XMEA 2E3DA 4L41C 1ZI5A 1H7HA 4B4GA 5AJOA 3U0XA 5C47A 4O6MA 1SS9A 1VZXA 1ZJ1A 5J49A 3RMVA 4HG6A 3ZF8A 2PGVA 3KIAA 2BO4A 1H5RA 2Z86A 2XMHA 1ZCUA 4HCQA 3ZLKA 2AM4A 3V91A 1FWYA 3E26A 1G93A 4JISA 5IDSA 1NQIB 1VPAA 3SX3A 3ZLLA 2YCMA 4FRPA 3ZGFA 2V0LA 3OH4A 5FU8A 3SX5A 1NF5B 2RJ7A 4D48A 3I0JA 4EEAA 1ZCVA 2FYCB 3SX7A 2WVMA 4Q7CA 3USQA 1H7QA 3SXCA 2PX7A 1JVGA 4G3QA 2DPWA 4ASYA 3IOIA 2YQJA 2AESA 3I0KA 1QGQA 1JVDA 1ON6A 1MC3A 4DE7A 3SX8A 1O0RA 5FTVA 3U2TA 1VH3A 1HM0A 2VFZA 3POLA 1NHEB 3RSBA 4EE5A 3JUJA 3CKNA 4HO4A 4B4MA 3DJ4A 2I5KA 2QKXA 1ZI4A 2BO8A 1GQCA 3R3IA 5BXCA 2YQHA 5C48A 5DDVA 5FU0A 3V8YA 2V0HA 5EIYA 1G8OA 1JYKA 1OMXA 1H5TA 4HO0A 2ICXA 4AYLA 2X60A 1JYLA 2VK9A 2J0BA 2JCKA 2QH5A 2Y4MA 1H5TB 1LVWA 2RITA 1O7OA 3PKQA 1O23B 1ZI1A 2GGOA 4CVHA 4E1KA 2I5EA 3SXGA 1MP4A 1V84A 3IOJA 4KRVA 5CMIA 2OEFA 4Y6NA 3V0OA 4J18A 3CKOA
chains in the Genus database with same CATH topology
3Q4SA 4CJBA 5C1GA 2AM5A 3I0DA 1S4NA 4B2XA 3SXDA 4Y7TA 2BO6A 1H5SC 4YS8A 2RJ9A 3K8DA 1R80A 4P00A 4D11A 2Y6PA 4C2SA 2VSIA 1YP2A 4Y7GA 5CQMX 3OH0A 1H7LA 2D0JA 2V0IA 4FCEA 1ZJ0A 4D0ZA 5IDTA 3OGZA 1G95A 3N9WA 5C4EA 4UEGA 4R7PA 1H7FA 2RJ4A 1ON8A 5AJPA 2RJ1A 1LL3A 4HO3A 1EYRA 3TQDA 1G2VA 1VZTA 4HO5A 2AH9A 1GX4A 1HM8A 4KPXA 2W0VA 2XWLA 2FYDB 2ZU9A 2ZU8A 2Y4LA 1H4CA 1TW5A 2VD4A 1PZTA 3I0CA 3I0IX 1FZWA 1INIA 1R81A 3LW6A 1G23A 2BO7A 2Y7AA 1ZJ3A 1E5KA 4FCUA 3TZTA 4FIYA 4DDZA 5I1FA 4FQWA 2OI6A 2X65A 4FRBA 1G97A 1V82A 2VS3A 4M2AA 2J0AA 5CQNX 1YP4A 5C4BA 4GBPA 4MNDA 1WT0A 1YROB 3I0EA 1VZUA 1IINA 3F1CA 1H5RB 1GQ9A 1R7TA 1G0RA 4NAKA 4B5BA 1W55A 2W0WA 1HJLA 3V0QA 1H4DA 1ZIZA 3FOQA 5D91A 5CQPA 4KC1A 3O3PA 1EZIA 1JV3A 1WSZA 4Y64A 3I0FA 1ZHJA 4JD0A 2X5ZA 4G3PA 1NMMB 4FRHA 1KWSA 5EJ1A 3DUVA 4G3SA 4HOCA 2X5SA 5IFYA 1JV1A 4KT7A 3OH1A 1ZJPA 5C4CA 1OMZA 1K4VA 4XWIA 3E25A 3NGWA 3OAMA 2A8WA 2YQSA 2YC5A 1G1LA 3D8VA 4Y63A 4ASJA 1ZCTA 1W77A 2AGDA 4FRDA 3CKJA 4NANA 1VGWA 3GUEA 1MP5A 1INJA 1XHBA 2FFVA 1ZJOA 5EJZA 4AC3A 4B2WA 1H7TA 4EEGA 4EE3A 1ZCYA 4ZDQA 4HO2A 1GA8A 2C0NA 2VXMA 2OI5A 5CMFX 5CMJA 1TZFA 3JTJA 2WAWA 4Y7UA 4EE4A 5C4FA 1FXJA 4KNXA 4O6NA 3PKPA 1W57A 4HO6A 2VS5A 3BCVA 1LZ0A 2AECA 4KC2A 4KQLA 2NXVA 1Z90A 1FR9A 2AM3A 4FREA 4FIXA 1H5SD 2XWMA 4Y62A 4FROA 2FYAA 2P6WA 2WEEA 5C38A 1VH1A 2JCOA 2JCJA 3RMWA 4FRMA 4KPZA 2VS4A 1QGSA 3V0LA 1I52A 5C1LA 1GWVA 4CJ8A 4Y7FA 3JUKA 4M28A 1QG8A 4EEOA 3OKRA 1GX0A 3SXBA 3T7NA 2O1HA 3ST8A 2Y4KA 2UX8A 1TW1A 2VSHA 3U2UA 3I0HA 4AAWA 2E8BA 2I7BA 3CU0A 3OH2A 3IOHA 3SXEA 2Z87A 5CMGX 3R2WA 3CKQA 1HM9A 2GGQA 1WT1A 4M2BA 2V0JA 3U0YA 4BQHA 3I0LA 3K8EA 2RIZA 2YESA 4Y6UA 1ZDGA 3U2XA 2MZBA 1NKHB 1WVCA 3V0MA 1FXOA 1H5SA 1S4OA 4DECA 1GWWA 5C4DA 4HO9A 5AJNA 3SXAA 2XWNA 5C36A 1VM8A 2PA4A 3Q7UA 5FTSA 1H5SB 5FYEA 1H7EA 4LW3A 1XZ6A 5L6SA 1LL0A 4MIXA 5HS2A 2A8UA 2CU2A 4FRLA 2RIYA 1VGTA 1YP3A 4Y9XA 3BRKX 4K6RA 4KNRA 5CQLX 5CMHA 1QWJA 2P73A 3Q80A 2D7IA 3ZGGA 2QGIA 3QVBA 2FYBA 2D7RA 4KXOA 4ECMA 4P02A 2WVLA 1FG5N 4FRAA 3V0NA 1S4PA 3D5NA 1VICA 1LZ7A 4NAIA 2O1GA 1R7XA 3V90A 4AYJA 1R7VA 1ZJ2A 3D98A 5FV9A 2RJ6A 5C3BA 3OC9A 5D92A 3SPTA 4B3UA 2O1FA 4D0TA 1H7GA 2V0KA 2AE7A 3USRA 1VGZA 1R7YA 5C1HA 4CJCA 4EEMA 3U2VA 1H4EA 3CKVA 5CQOA 5C49A 4D11C 4FRQA 2Y4JA 1H3MA 1R7UA 1LZIA 3I0GA 1FR8A 4KC4A 1G3LA 5C3AA 4B4BA 4M4KA 2OEGA 4IRPA 2WVKA 3V0PA 1HV9A 1G9RA 2OI7A 5DDTA 5JQQA 2RJ8A 3CGXA 4NALA 1FOAA 2PGYA 2JCLA 2Q4JA 2RIXA 4MYBA 1WT3A 4LW6A 2YQCA 2P72A 2FY7A 3T7MA 1V83A 1R82A 4G87A 1WT2A 3HL3A 2VXLA 3V8ZA 2WGZA 5L6VA 1FGGA 5C8RA 1PZYB 1NWGB 3T7OA 2APCA 3U2WA 3DK5A 2FFUA 1FO9A 4B42A 1TVYA 3EE5A 3F1YA 4BMAA 3FWWA 1HJJA 1O7QA 1OQMB 2RJ5A 1ZI3A 4IRQA 1MP3A 1FRWA 2WE9A 2ZU7A 2YC3A 1LZJA 1VGUA 1IIMA 1FGXA 5C3DA 2ICYA 3PNNA 4ARWA 4EVWA 1ZDFA 4HO8A 4Y7VA 1LL2A 1FO8A 2RJ0A 3OH3A 5FUHA 2XMEA 2E3DA 4L41C 1ZI5A 1H7HA 4B4GA 5AJOA 3U0XA 5C47A 4O6MA 1SS9A 1VZXA 1ZJ1A 5J49A 3RMVA 4HG6A 3ZF8A 2PGVA 3KIAA 2BO4A 1H5RA 2Z86A 2XMHA 1ZCUA 4HCQA 3ZLKA 2AM4A 3V91A 1FWYA 3E26A 1G93A 4JISA 5IDSA 1NQIB 1VPAA 3SX3A 3ZLLA 2YCMA 4FRPA 3ZGFA 2V0LA 3OH4A 5FU8A 3SX5A 1NF5B 2RJ7A 4D48A 3I0JA 4EEAA 1ZCVA 2FYCB 3SX7A 2WVMA 4Q7CA 3USQA 1H7QA 3SXCA 2PX7A 1JVGA 4G3QA 2DPWA 4ASYA 3IOIA 2YQJA 2AESA 3I0KA 1QGQA 1JVDA 1ON6A 1MC3A 4DE7A 3SX8A 1O0RA 5FTVA 3U2TA 1VH3A 1HM0A 2VFZA 3POLA 1NHEB 3RSBA 4EE5A 3JUJA 3CKNA 4HO4A 4B4MA 3DJ4A 2I5KA 2QKXA 1ZI4A 2BO8A 1GQCA 3R3IA 5BXCA 2YQHA 5C48A 5DDVA 5FU0A 3V8YA 2V0HA 5EIYA 1G8OA 1JYKA 1OMXA 1H5TA 4HO0A 2ICXA 4AYLA 2X60A 1JYLA 2VK9A 2J0BA 2JCKA 2QH5A 2Y4MA 1H5TB 1LVWA 2RITA 1O7OA 3PKQA 1O23B 1ZI1A 2GGOA 4CVHA 4E1KA 2I5EA 3SXGA 1MP4A 1V84A 3IOJA 4KRVA 5CMIA 2OEFA 4Y6NA 3V0OA 4J18A 3CKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q4S A;  4CJB A;  5C1G A;  2AM5 A;  3I0D A;  1S4N A;  4B2X A;  3SXD A;  4Y7T A;  2BO6 A;  1H5S C;  4YS8 A;  2RJ9 A;  3K8D A;  1R80 A;  4P00 A;  4D11 A;  2Y6P A;  4C2S A;  2VSI A;  1YP2 A;  4Y7G A;  5CQM X;  3OH0 A;  1H7L A;  2D0J A;  2V0I A;  4FCE A;  1ZJ0 A;  4D0Z A;  5IDT A;  3OGZ A;  1G95 A;  3N9W A;  5C4E A;  4UEG A;  4R7P A;  1H7F A;  2RJ4 A;  1ON8 A;  5AJP A;  2RJ1 A;  1LL3 A;  4HO3 A;  1EYR A;  3TQD A;  1G2V A;  1VZT A;  4HO5 A;  2AH9 A;  1GX4 A;  1HM8 A;  4KPX A;  2W0V A;  2XWL A;  2FYD B;  2ZU9 A;  2ZU8 A;  2Y4L A;  1H4C A;  1TW5 A;  2VD4 A;  1PZT A;  3I0C A;  3I0I X;  1FZW A;  1INI A;  1R81 A;  3LW6 A;  1G23 A;  2BO7 A;  2Y7A A;  1ZJ3 A;  1E5K A;  4FCU A;  3TZT A;  4DDZ A;  5I1F A;  4FQW A;  2OI6 A;  2X65 A;  4FRB A;  1G97 A;  1V82 A;  2VS3 A;  4M2A A;  5CQN X;  1YP4 A;  5C4B A;  4GBP A;  4MND A;  1WT0 A;  1YRO B;  3I0E A;  1VZU A;  1IIN A;  3F1C A;  1H5R B;  1GQ9 A;  1R7T A;  1G0R A;  4NAK A;  4B5B A;  1W55 A;  2W0W A;  1HJL A;  3V0Q A;  1H4D A;  1ZIZ A;  3FOQ A;  5CQP A;  4KC1 A;  3O3P A;  1EZI A;  1JV3 A;  1WSZ A;  4Y64 A;  3I0F A;  1ZHJ A;  4JD0 A;  2X5Z A;  4G3P A;  1NMM B;  4FRH A;  1KWS A;  5EJ1 A;  3DUV A;  4G3S A;  4HOC A;  2X5S A;  5IFY A;  1JV1 A;  4KT7 A;  3OH1 A;  1ZJP A;  5C4C A;  1OMZ A;  1K4V A;  4XWI A;  3E25 A;  3NGW A;  3OAM A;  2A8W A;  2YQS A;  2YC5 A;  1G1L A;  3D8V A;  4Y63 A;  4ASJ A;  1ZCT A;  1W77 A;  2AGD A;  4FRD A;  3CKJ A;  4NAN A;  1VGW A;  3GUE A;  1MP5 A;  1INJ A;  1XHB A;  2FFV A;  1ZJO A;  5EJZ A;  4AC3 A;  4B2W A;  1H7T A;  4EEG A;  4EE3 A;  1ZCY A;  4ZDQ A;  4HO2 A;  1GA8 A;  2VXM A;  2OI5 A;  5CMF X;  5CMJ A;  1TZF A;  3JTJ A;  2WAW A;  4Y7U A;  4EE4 A;  5C4F A;  1FXJ A;  4KNX A;  3PKP A;  1W57 A;  4HO6 A;  2VS5 A;  3BCV A;  1LZ0 A;  2AEC A;  4KC2 A;  4KQL A;  2NXV A;  1Z90 A;  1FR9 A;  2AM3 A;  4FRE A;  1H5S D;  2XWM A;  4Y62 A;  4FRO A;  2FYA A;  2P6W A;  2WEE A;  5C38 A;  1VH1 A;  2JCO A;  2JCJ A;  3RMW A;  4FRM A;  4KPZ A;  2VS4 A;  1QGS A;  3V0L A;  1I52 A;  5C1L A;  1GWV A;  4CJ8 A;  4Y7F A;  3JUK A;  4M28 A;  1QG8 A;  4EEO A;  3OKR A;  1GX0 A;  3SXB A;  3T7N A;  2O1H A;  3ST8 A;  2Y4K A;  2UX8 A;  1TW1 A;  2VSH A;  3U2U A;  3I0H A;  4AAW A;  2E8B A;  2I7B A;  3CU0 A;  3OH2 A;  3IOH A;  3SXE A;  2Z87 A;  5CMG X;  3R2W A;  3CKQ A;  1HM9 A;  2GGQ A;  1WT1 A;  4M2B A;  2V0J A;  3U0Y A;  4BQH A;  3I0L A;  3K8E A;  2RIZ A;  2YES A;  4Y6U A;  1ZDG A;  3U2X A;  2MZB A;  1NKH B;  1WVC A;  3V0M A;  1FXO A;  1H5S A;  1S4O A;  4DEC A;  1GWW A;  5C4D A;  4HO9 A;  5AJN A;  3SXA A;  2XWN A;  5C36 A;  1VM8 A;  2PA4 A;  3Q7U A;  5FTS A;  1H5S B;  5FYE A;  1H7E A;  4LW3 A;  1XZ6 A;  5L6S A;  1LL0 A;  5HS2 A;  2A8U A;  2CU2 A;  4FRL A;  2RIY A;  1VGT A;  1YP3 A;  4Y9X A;  3BRK X;  4K6R A;  4KNR A;  5CQL X;  5CMH A;  1QWJ A;  2P73 A;  3Q80 A;  2D7I A;  3ZGG A;  2QGI A;  3QVB A;  2FYB A;  2D7R A;  4KXO A;  4ECM A;  4P02 A;  2WVL A;  1FG5 N;  4FRA A;  3V0N A;  1S4P A;  3D5N A;  1VIC A;  1LZ7 A;  4NAI A;  2O1G A;  1R7X A;  3V90 A;  4AYJ A;  1R7V A;  1ZJ2 A;  3D98 A;  5FV9 A;  2RJ6 A;  5C3B A;  3OC9 A;  3SPT A;  4B3U A;  2O1F A;  4D0T A;  1H7G A;  2V0K A;  2AE7 A;  3USR A;  1VGZ A;  1R7Y A;  5C1H A;  4CJC A;  4EEM A;  3U2V A;  1H4E A;  3CKV A;  5CQO A;  5C49 A;  4D11 C;  4FRQ A;  2Y4J A;  1H3M A;  1R7U A;  1LZI A;  3I0G A;  1FR8 A;  4KC4 A;  1G3L A;  5C3A A;  4B4B A;  4M4K A;  2OEG A;  4IRP A;  2WVK A;  3V0P A;  1HV9 A;  1G9R A;  2OI7 A;  5DDT A;  5JQQ A;  2RJ8 A;  3CGX A;  4NAL A;  1FOA A;  2PGY A;  2JCL A;  2Q4J A;  2RIX A;  4MYB A;  1WT3 A;  4LW6 A;  2YQC A;  2P72 A;  2FY7 A;  3T7M A;  1V83 A;  1R82 A;  4G87 A;  1WT2 A;  3HL3 A;  2VXL A;  3V8Z A;  2WGZ A;  5L6V A;  1FGG A;  5C8R A;  1PZY B;  1NWG B;  3T7O A;  2APC A;  3U2W A;  3DK5 A;  2FFU A;  1FO9 A;  4B42 A;  1TVY A;  3EE5 A;  3F1Y A;  4BMA A;  3FWW A;  1HJJ A;  1O7Q A;  1OQM B;  2RJ5 A;  1ZI3 A;  4IRQ A;  1MP3 A;  1FRW A;  2WE9 A;  2ZU7 A;  2YC3 A;  1LZJ A;  1VGU A;  1IIM A;  1FGX A;  5C3D A;  2ICY A;  3PNN A;  4ARW A;  4EVW A;  1ZDF A;  4HO8 A;  4Y7V A;  1LL2 A;  1FO8 A;  2RJ0 A;  3OH3 A;  5FUH A;  2XME A;  2E3D A;  4L41 C;  1ZI5 A;  1H7H A;  4B4G A;  5AJO A;  3U0X A;  5C47 A;  1SS9 A;  1VZX A;  1ZJ1 A;  5J49 A;  3RMV A;  4HG6 A;  3ZF8 A;  2PGV A;  3KIA A;  2BO4 A;  1H5R A;  2Z86 A;  2XMH A;  1ZCU A;  4HCQ A;  3ZLK A;  2AM4 A;  3V91 A;  1FWY A;  3E26 A;  1G93 A;  4JIS A;  5IDS A;  1NQI B;  1VPA A;  3SX3 A;  3ZLL A;  2YCM A;  4FRP A;  3ZGF A;  2V0L A;  3OH4 A;  5FU8 A;  3SX5 A;  1NF5 B;  2RJ7 A;  4D48 A;  3I0J A;  4EEA A;  1ZCV A;  2FYC B;  3SX7 A;  2WVM A;  3USQ A;  1H7Q A;  3SXC A;  2PX7 A;  1JVG A;  4G3Q A;  2DPW A;  4ASY A;  3IOI A;  2YQJ A;  2AES A;  3I0K A;  1QGQ A;  1JVD A;  1ON6 A;  1MC3 A;  4DE7 A;  3SX8 A;  1O0R A;  5FTV A;  3U2T A;  1VH3 A;  1HM0 A;  2VFZ A;  3POL A;  1NHE B;  3RSB A;  4EE5 A;  3JUJ A;  3CKN A;  4HO4 A;  4B4M A;  3DJ4 A;  2I5K A;  2QKX A;  1ZI4 A;  2BO8 A;  1GQC A;  3R3I A;  5BXC A;  2YQH A;  5C48 A;  5DDV A;  5FU0 A;  3V8Y A;  2V0H A;  5EIY A;  1G8O A;  1JYK A;  1OMX A;  1H5T A;  4HO0 A;  2ICX A;  4AYL A;  2X60 A;  1JYL A;  2JCK A;  2QH5 A;  2Y4M A;  1H5T B;  1LVW A;  2RIT A;  1O7O A;  3PKQ A;  1O23 B;  1ZI1 A;  2GGO A;  4CVH A;  4E1K A;  2I5E A;  3SXG A;  1MP4 A;  1V84 A;  3IOJ A;  4KRV A;  5CMI A;  2OEF A;  4Y6N A;  3V0O A;  4J18 A;  3CKO A; 
#chains in the Genus database with same CATH topology
 3Q4S A;  4CJB A;  5C1G A;  2AM5 A;  3I0D A;  1S4N A;  4B2X A;  3SXD A;  4Y7T A;  2BO6 A;  1H5S C;  4YS8 A;  2RJ9 A;  3K8D A;  1R80 A;  4P00 A;  4D11 A;  2Y6P A;  4C2S A;  2VSI A;  1YP2 A;  4Y7G A;  5CQM X;  3OH0 A;  1H7L A;  2D0J A;  2V0I A;  4FCE A;  1ZJ0 A;  4D0Z A;  5IDT A;  3OGZ A;  1G95 A;  3N9W A;  5C4E A;  4UEG A;  4R7P A;  1H7F A;  2RJ4 A;  1ON8 A;  5AJP A;  2RJ1 A;  1LL3 A;  4HO3 A;  1EYR A;  3TQD A;  1G2V A;  1VZT A;  4HO5 A;  2AH9 A;  1GX4 A;  1HM8 A;  4KPX A;  2W0V A;  2XWL A;  2FYD B;  2ZU9 A;  2ZU8 A;  2Y4L A;  1H4C A;  1TW5 A;  2VD4 A;  1PZT A;  3I0C A;  3I0I X;  1FZW A;  1INI A;  1R81 A;  3LW6 A;  1G23 A;  2BO7 A;  2Y7A A;  1ZJ3 A;  1E5K A;  4FCU A;  3TZT A;  4FIY A;  4DDZ A;  5I1F A;  4FQW A;  2OI6 A;  2X65 A;  4FRB A;  1G97 A;  1V82 A;  2VS3 A;  4M2A A;  2J0A A;  5CQN X;  1YP4 A;  5C4B A;  4GBP A;  4MND A;  1WT0 A;  1YRO B;  3I0E A;  1VZU A;  1IIN A;  3F1C A;  1H5R B;  1GQ9 A;  1R7T A;  1G0R A;  4NAK A;  4B5B A;  1W55 A;  2W0W A;  1HJL A;  3V0Q A;  1H4D A;  1ZIZ A;  3FOQ A;  5D91 A;  5CQP A;  4KC1 A;  3O3P A;  1EZI A;  1JV3 A;  1WSZ A;  4Y64 A;  3I0F A;  1ZHJ A;  4JD0 A;  2X5Z A;  4G3P A;  1NMM B;  4FRH A;  1KWS A;  5EJ1 A;  3DUV A;  4G3S A;  4HOC A;  2X5S A;  5IFY A;  1JV1 A;  4KT7 A;  3OH1 A;  1ZJP A;  5C4C A;  1OMZ A;  1K4V A;  4XWI A;  3E25 A;  3NGW A;  3OAM A;  2A8W A;  2YQS A;  2YC5 A;  1G1L A;  3D8V A;  4Y63 A;  4ASJ A;  1ZCT A;  1W77 A;  2AGD A;  4FRD A;  3CKJ A;  4NAN A;  1VGW A;  3GUE A;  1MP5 A;  1INJ A;  1XHB A;  2FFV A;  1ZJO A;  5EJZ A;  4AC3 A;  4B2W A;  1H7T A;  4EEG A;  4EE3 A;  1ZCY A;  4ZDQ A;  4HO2 A;  1GA8 A;  2C0N A;  2VXM A;  2OI5 A;  5CMF X;  5CMJ A;  1TZF A;  3JTJ A;  2WAW A;  4Y7U A;  4EE4 A;  5C4F A;  1FXJ A;  4KNX A;  4O6N A;  3PKP A;  1W57 A;  4HO6 A;  2VS5 A;  3BCV A;  1LZ0 A;  2AEC A;  4KC2 A;  4KQL A;  2NXV A;  1Z90 A;  1FR9 A;  2AM3 A;  4FRE A;  4FIX A;  1H5S D;  2XWM A;  4Y62 A;  4FRO A;  2FYA A;  2P6W A;  2WEE A;  5C38 A;  1VH1 A;  2JCO A;  2JCJ A;  3RMW A;  4FRM A;  4KPZ A;  2VS4 A;  1QGS A;  3V0L A;  1I52 A;  5C1L A;  1GWV A;  4CJ8 A;  4Y7F A;  3JUK A;  4M28 A;  1QG8 A;  4EEO A;  3OKR A;  1GX0 A;  3SXB A;  3T7N A;  2O1H A;  3ST8 A;  2Y4K A;  2UX8 A;  1TW1 A;  2VSH A;  3U2U A;  3I0H A;  4AAW A;  2E8B A;  2I7B A;  3CU0 A;  3OH2 A;  3IOH A;  3SXE A;  2Z87 A;  5CMG X;  3R2W A;  3CKQ A;  1HM9 A;  2GGQ A;  1WT1 A;  4M2B A;  2V0J A;  3U0Y A;  4BQH A;  3I0L A;  3K8E A;  2RIZ A;  2YES A;  4Y6U A;  1ZDG A;  3U2X A;  2MZB A;  1NKH B;  1WVC A;  3V0M A;  1FXO A;  1H5S A;  1S4O A;  4DEC A;  1GWW A;  5C4D A;  4HO9 A;  5AJN A;  3SXA A;  2XWN A;  5C36 A;  1VM8 A;  2PA4 A;  3Q7U A;  5FTS A;  1H5S B;  5FYE A;  1H7E A;  4LW3 A;  1XZ6 A;  5L6S A;  1LL0 A;  4MIX A;  5HS2 A;  2A8U A;  2CU2 A;  4FRL A;  2RIY A;  1VGT A;  1YP3 A;  4Y9X A;  3BRK X;  4K6R A;  4KNR A;  5CQL X;  5CMH A;  1QWJ A;  2P73 A;  3Q80 A;  2D7I A;  3ZGG A;  2QGI A;  3QVB A;  2FYB A;  2D7R A;  4KXO A;  4ECM A;  4P02 A;  2WVL A;  1FG5 N;  4FRA A;  3V0N A;  1S4P A;  3D5N A;  1VIC A;  1LZ7 A;  4NAI A;  2O1G A;  1R7X A;  3V90 A;  4AYJ A;  1R7V A;  1ZJ2 A;  3D98 A;  5FV9 A;  2RJ6 A;  5C3B A;  3OC9 A;  5D92 A;  3SPT A;  4B3U A;  2O1F A;  4D0T A;  1H7G A;  2V0K A;  2AE7 A;  3USR A;  1VGZ A;  1R7Y A;  5C1H A;  4CJC A;  4EEM A;  3U2V A;  1H4E A;  3CKV A;  5CQO A;  5C49 A;  4D11 C;  4FRQ A;  2Y4J A;  1H3M A;  1R7U A;  1LZI A;  3I0G A;  1FR8 A;  4KC4 A;  1G3L A;  5C3A A;  4B4B A;  4M4K A;  2OEG A;  4IRP A;  2WVK A;  3V0P A;  1HV9 A;  1G9R A;  2OI7 A;  5DDT A;  5JQQ A;  2RJ8 A;  3CGX A;  4NAL A;  1FOA A;  2PGY A;  2JCL A;  2Q4J A;  2RIX A;  4MYB A;  1WT3 A;  4LW6 A;  2YQC A;  2P72 A;  2FY7 A;  3T7M A;  1V83 A;  1R82 A;  4G87 A;  1WT2 A;  3HL3 A;  2VXL A;  3V8Z A;  2WGZ A;  5L6V A;  1FGG A;  5C8R A;  1PZY B;  1NWG B;  3T7O A;  2APC A;  3U2W A;  3DK5 A;  2FFU A;  1FO9 A;  4B42 A;  1TVY A;  3EE5 A;  3F1Y A;  4BMA A;  3FWW A;  1HJJ A;  1O7Q A;  1OQM B;  2RJ5 A;  1ZI3 A;  4IRQ A;  1MP3 A;  1FRW A;  2WE9 A;  2ZU7 A;  2YC3 A;  1LZJ A;  1VGU A;  1IIM A;  1FGX A;  5C3D A;  2ICY A;  3PNN A;  4ARW A;  4EVW A;  1ZDF A;  4HO8 A;  4Y7V A;  1LL2 A;  1FO8 A;  2RJ0 A;  3OH3 A;  5FUH A;  2XME A;  2E3D A;  4L41 C;  1ZI5 A;  1H7H A;  4B4G A;  5AJO A;  3U0X A;  5C47 A;  4O6M A;  1SS9 A;  1VZX A;  1ZJ1 A;  5J49 A;  3RMV A;  4HG6 A;  3ZF8 A;  2PGV A;  3KIA A;  2BO4 A;  1H5R A;  2Z86 A;  2XMH A;  1ZCU A;  4HCQ A;  3ZLK A;  2AM4 A;  3V91 A;  1FWY A;  3E26 A;  1G93 A;  4JIS A;  5IDS A;  1NQI B;  1VPA A;  3SX3 A;  3ZLL A;  2YCM A;  4FRP A;  3ZGF A;  2V0L A;  3OH4 A;  5FU8 A;  3SX5 A;  1NF5 B;  2RJ7 A;  4D48 A;  3I0J A;  4EEA A;  1ZCV A;  2FYC B;  3SX7 A;  2WVM A;  4Q7C A;  3USQ A;  1H7Q A;  3SXC A;  2PX7 A;  1JVG A;  4G3Q A;  2DPW A;  4ASY A;  3IOI A;  2YQJ A;  2AES A;  3I0K A;  1QGQ A;  1JVD A;  1ON6 A;  1MC3 A;  4DE7 A;  3SX8 A;  1O0R A;  5FTV A;  3U2T A;  1VH3 A;  1HM0 A;  2VFZ A;  3POL A;  1NHE B;  3RSB A;  4EE5 A;  3JUJ A;  3CKN A;  4HO4 A;  4B4M A;  3DJ4 A;  2I5K A;  2QKX A;  1ZI4 A;  2BO8 A;  1GQC A;  3R3I A;  5BXC A;  2YQH A;  5C48 A;  5DDV A;  5FU0 A;  3V8Y A;  2V0H A;  5EIY A;  1G8O A;  1JYK A;  1OMX A;  1H5T A;  4HO0 A;  2ICX A;  4AYL A;  2X60 A;  1JYL A;  2VK9 A;  2J0B A;  2JCK A;  2QH5 A;  2Y4M A;  1H5T B;  1LVW A;  2RIT A;  1O7O A;  3PKQ A;  1O23 B;  1ZI1 A;  2GGO A;  4CVH A;  4E1K A;  2I5E A;  3SXG A;  1MP4 A;  1V84 A;  3IOJ A;  4KRV A;  5CMI A;  2OEF A;  4Y6N A;  3V0O A;  4J18 A;  3CKO A; 
#chains in the Genus database with same CATH homology
 3Q4S A;  4CJB A;  5C1G A;  2AM5 A;  3I0D A;  1S4N A;  4B2X A;  3SXD A;  4Y7T A;  2BO6 A;  1H5S C;  4YS8 A;  2RJ9 A;  3K8D A;  1R80 A;  4P00 A;  4D11 A;  2Y6P A;  4C2S A;  2VSI A;  1YP2 A;  4Y7G A;  5CQM X;  3OH0 A;  1H7L A;  2D0J A;  2V0I A;  4FCE A;  1ZJ0 A;  4D0Z A;  5IDT A;  3OGZ A;  1G95 A;  3N9W A;  5C4E A;  4UEG A;  4R7P A;  1H7F A;  2RJ4 A;  1ON8 A;  5AJP A;  2RJ1 A;  1LL3 A;  4HO3 A;  1EYR A;  3TQD A;  1G2V A;  1VZT A;  4HO5 A;  2AH9 A;  1GX4 A;  1HM8 A;  4KPX A;  2W0V A;  2XWL A;  2FYD B;  2ZU9 A;  2ZU8 A;  2Y4L A;  1H4C A;  1TW5 A;  2VD4 A;  1PZT A;  3I0C A;  3I0I X;  1FZW A;  1INI A;  1R81 A;  3LW6 A;  1G23 A;  2BO7 A;  2Y7A A;  1ZJ3 A;  1E5K A;  4FCU A;  3TZT A;  4FIY A;  4DDZ A;  5I1F A;  4FQW A;  2OI6 A;  2X65 A;  4FRB A;  1G97 A;  1V82 A;  2VS3 A;  4M2A A;  2J0A A;  5CQN X;  1YP4 A;  5C4B A;  4GBP A;  4MND A;  1WT0 A;  1YRO B;  3I0E A;  1VZU A;  1IIN A;  3F1C A;  1H5R B;  1GQ9 A;  1R7T A;  1G0R A;  4NAK A;  4B5B A;  1W55 A;  2W0W A;  1HJL A;  3V0Q A;  1H4D A;  1ZIZ A;  3FOQ A;  5D91 A;  5CQP A;  4KC1 A;  3O3P A;  1EZI A;  1JV3 A;  1WSZ A;  4Y64 A;  3I0F A;  1ZHJ A;  4JD0 A;  2X5Z A;  4G3P A;  1NMM B;  4FRH A;  1KWS A;  5EJ1 A;  3DUV A;  4G3S A;  4HOC A;  2X5S A;  5IFY A;  1JV1 A;  4KT7 A;  3OH1 A;  1ZJP A;  5C4C A;  1OMZ A;  1K4V A;  4XWI A;  3E25 A;  3NGW A;  3OAM A;  2A8W A;  2YQS A;  2YC5 A;  1G1L A;  3D8V A;  4Y63 A;  4ASJ A;  1ZCT A;  1W77 A;  2AGD A;  4FRD A;  3CKJ A;  4NAN A;  1VGW A;  3GUE A;  1MP5 A;  1INJ A;  1XHB A;  2FFV A;  1ZJO A;  5EJZ A;  4AC3 A;  4B2W A;  1H7T A;  4EEG A;  4EE3 A;  1ZCY A;  4ZDQ A;  4HO2 A;  1GA8 A;  2C0N A;  2VXM A;  2OI5 A;  5CMF X;  5CMJ A;  1TZF A;  3JTJ A;  2WAW A;  4Y7U A;  4EE4 A;  5C4F A;  1FXJ A;  4KNX A;  4O6N A;  3PKP A;  1W57 A;  4HO6 A;  2VS5 A;  3BCV A;  1LZ0 A;  2AEC A;  4KC2 A;  4KQL A;  2NXV A;  1Z90 A;  1FR9 A;  2AM3 A;  4FRE A;  4FIX A;  1H5S D;  2XWM A;  4Y62 A;  4FRO A;  2FYA A;  2P6W A;  2WEE A;  5C38 A;  1VH1 A;  2JCO A;  2JCJ A;  3RMW A;  4FRM A;  4KPZ A;  2VS4 A;  1QGS A;  3V0L A;  1I52 A;  5C1L A;  1GWV A;  4CJ8 A;  4Y7F A;  3JUK A;  4M28 A;  1QG8 A;  4EEO A;  3OKR A;  1GX0 A;  3SXB A;  3T7N A;  2O1H A;  3ST8 A;  2Y4K A;  2UX8 A;  1TW1 A;  2VSH A;  3U2U A;  3I0H A;  4AAW A;  2E8B A;  2I7B A;  3CU0 A;  3OH2 A;  3IOH A;  3SXE A;  2Z87 A;  5CMG X;  3R2W A;  3CKQ A;  1HM9 A;  2GGQ A;  1WT1 A;  4M2B A;  2V0J A;  3U0Y A;  4BQH A;  3I0L A;  3K8E A;  2RIZ A;  2YES A;  4Y6U A;  1ZDG A;  3U2X A;  2MZB A;  1NKH B;  1WVC A;  3V0M A;  1FXO A;  1H5S A;  1S4O A;  4DEC A;  1GWW A;  5C4D A;  4HO9 A;  5AJN A;  3SXA A;  2XWN A;  5C36 A;  1VM8 A;  2PA4 A;  3Q7U A;  5FTS A;  1H5S B;  5FYE A;  1H7E A;  4LW3 A;  1XZ6 A;  5L6S A;  1LL0 A;  4MIX A;  5HS2 A;  2A8U A;  2CU2 A;  4FRL A;  2RIY A;  1VGT A;  1YP3 A;  4Y9X A;  3BRK X;  4K6R A;  4KNR A;  5CQL X;  5CMH A;  1QWJ A;  2P73 A;  3Q80 A;  2D7I A;  3ZGG A;  2QGI A;  3QVB A;  2FYB A;  2D7R A;  4KXO A;  4ECM A;  4P02 A;  2WVL A;  1FG5 N;  4FRA A;  3V0N A;  1S4P A;  3D5N A;  1VIC A;  1LZ7 A;  4NAI A;  2O1G A;  1R7X A;  3V90 A;  4AYJ A;  1R7V A;  1ZJ2 A;  3D98 A;  5FV9 A;  2RJ6 A;  5C3B A;  3OC9 A;  5D92 A;  3SPT A;  4B3U A;  2O1F A;  4D0T A;  1H7G A;  2V0K A;  2AE7 A;  3USR A;  1VGZ A;  1R7Y A;  5C1H A;  4CJC A;  4EEM A;  3U2V A;  1H4E A;  3CKV A;  5CQO A;  5C49 A;  4D11 C;  4FRQ A;  2Y4J A;  1H3M A;  1R7U A;  1LZI A;  3I0G A;  1FR8 A;  4KC4 A;  1G3L A;  5C3A A;  4B4B A;  4M4K A;  2OEG A;  4IRP A;  2WVK A;  3V0P A;  1HV9 A;  1G9R A;  2OI7 A;  5DDT A;  5JQQ A;  2RJ8 A;  3CGX A;  4NAL A;  1FOA A;  2PGY A;  2JCL A;  2Q4J A;  2RIX A;  4MYB A;  1WT3 A;  4LW6 A;  2YQC A;  2P72 A;  2FY7 A;  3T7M A;  1V83 A;  1R82 A;  4G87 A;  1WT2 A;  3HL3 A;  2VXL A;  3V8Z A;  2WGZ A;  5L6V A;  1FGG A;  5C8R A;  1PZY B;  1NWG B;  3T7O A;  2APC A;  3U2W A;  3DK5 A;  2FFU A;  1FO9 A;  4B42 A;  1TVY A;  3EE5 A;  3F1Y A;  4BMA A;  3FWW A;  1HJJ A;  1O7Q A;  1OQM B;  2RJ5 A;  1ZI3 A;  4IRQ A;  1MP3 A;  1FRW A;  2WE9 A;  2ZU7 A;  2YC3 A;  1LZJ A;  1VGU A;  1IIM A;  1FGX A;  5C3D A;  2ICY A;  3PNN A;  4ARW A;  4EVW A;  1ZDF A;  4HO8 A;  4Y7V A;  1LL2 A;  1FO8 A;  2RJ0 A;  3OH3 A;  5FUH A;  2XME A;  2E3D A;  4L41 C;  1ZI5 A;  1H7H A;  4B4G A;  5AJO A;  3U0X A;  5C47 A;  4O6M A;  1SS9 A;  1VZX A;  1ZJ1 A;  5J49 A;  3RMV A;  4HG6 A;  3ZF8 A;  2PGV A;  3KIA A;  2BO4 A;  1H5R A;  2Z86 A;  2XMH A;  1ZCU A;  4HCQ A;  3ZLK A;  2AM4 A;  3V91 A;  1FWY A;  3E26 A;  1G93 A;  4JIS A;  5IDS A;  1NQI B;  1VPA A;  3SX3 A;  3ZLL A;  2YCM A;  4FRP A;  3ZGF A;  2V0L A;  3OH4 A;  5FU8 A;  3SX5 A;  1NF5 B;  2RJ7 A;  4D48 A;  3I0J A;  4EEA A;  1ZCV A;  2FYC B;  3SX7 A;  2WVM A;  4Q7C A;  3USQ A;  1H7Q A;  3SXC A;  2PX7 A;  1JVG A;  4G3Q A;  2DPW A;  4ASY A;  3IOI A;  2YQJ A;  2AES A;  3I0K A;  1QGQ A;  1JVD A;  1ON6 A;  1MC3 A;  4DE7 A;  3SX8 A;  1O0R A;  5FTV A;  3U2T A;  1VH3 A;  1HM0 A;  2VFZ A;  3POL A;  1NHE B;  3RSB A;  4EE5 A;  3JUJ A;  3CKN A;  4HO4 A;  4B4M A;  3DJ4 A;  2I5K A;  2QKX A;  1ZI4 A;  2BO8 A;  1GQC A;  3R3I A;  5BXC A;  2YQH A;  5C48 A;  5DDV A;  5FU0 A;  3V8Y A;  2V0H A;  5EIY A;  1G8O A;  1JYK A;  1OMX A;  1H5T A;  4HO0 A;  2ICX A;  4AYL A;  2X60 A;  1JYL A;  2VK9 A;  2J0B A;  2JCK A;  2QH5 A;  2Y4M A;  1H5T B;  1LVW A;  2RIT A;  1O7O A;  3PKQ A;  1O23 B;  1ZI1 A;  2GGO A;  4CVH A;  4E1K A;  2I5E A;  3SXG A;  1MP4 A;  1V84 A;  3IOJ A;  4KRV A;  5CMI A;  2OEF A;  4Y6N A;  3V0O A;  4J18 A;  3CKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...