1G0TA

Dsbc mutant c101s
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
total genus 68
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1g0tA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g0tA02
4DSRA 4ZXGA 2A2SA 2YWOA 2R6KA 1YZXA 4DSQA 1XW9A 2C0EA 1XCCA 3CMIA 2H1DA 2KHPA 3IOSA 3KH9A 3KM6A 3C73A 5IO2A 1XW6A 1VRSD 2LJKA 3KMNA 3FZ4A 4NMUA 3M3MA 4TKYA 1GL8A 2YZUA 2B5EA 1ERWA 4ISDA 4ACSA 3I9V2 2EIQA 3KEBA 3RHCA 2ZUPA 2YPMA 5ECLB 3HHVA 3FRCA 1PKWA 2B5YA 3C7MA 1OC9B 1B4PA 4AJ6A 5J9BA 3GNJA 1SU9A 4XCSA 4KB3A 2O8VB 3P8WA 1N2AA 4JEDA 4ML6A 1XVQA 3MSZA 4QL7A 2MMZA 3IRAA 3Q6OA 4POLA 1EOGA 3GV1A 2VM2A 4BL7A 4AJ7A 3EMPA 4Q5QA 3VURA 5CAXA 5GZZB 1MEKA 4BVXA 4K9ZA 1BYEA 2LJRA 3L9UA 2X64A 5D9WA 2IJYA 1BQ7A 3C71A 2PWJA 5LNKe 4HU9A 2F3MA 2JZSA 2CX3A 3W8JA 3LWAA 2DIYA 3GURA 2ES7A 2VM1A 2B3SA 4K7OA 4O5RA 2VCZA 2OE0A 1OE7A 1FVKA 4BPYA 1M2BA 3V1WA 3TRQA 1MTCA 4EDZA 2GQMA 3VK9A 2MMNA 3HY2A 5AIXA 5B8AA 1HD2A 3APOA 1U3AA 4PNGA 3F4RA 4AF2A 3MNGA 3QD9A 4ID0A 3CSJA 1BEDA 3GH9A 1TOFA 3O6TA 4MJBA 4X43A 3GA4A 2FLSA 1RQMA 5IOWA 1SKSB 4G19A 3LXTA 2FWHA 4POBA 2LRTA 4TOPA 1SD8A 1R26A 3D4TA 3KP9A 1ACVA 3KP8A 4EKZA 4IQ1A 1PL1A 3APSA 2LQOA 2VD1A 1URMA 1K3YA 1E6BA 2V41A 2GTUA 3RDWA 2MMAA 4WR4A 4OWYA 4EUYA 1TTZA 4IP6A 2IIYA 5D9VA 4GSTA 4BWSA 3E0UA 1R5AA 3QAVA 1WP0A 1T8EB 4IGJA 4N11A 6GSSA 2GGTA 1KBNA 1ON4A 1K0OA 2GZZA 1K0DA 3HKRA 4ZL9A 2LRNA 2CV4A 2DSAA 2O87A 3D6IA 2I4AA 5IMVA 3GX8A 3CYNA 2WS2A 5G1KA 5JCGA 3HJPA 1X0RA 4TR0A 2PBJA 4F0BA 1TKDB 3FR9A 3F3RA 1XWBA 2FWGA 4YAVA 2JSZA 4PURA 3M1GA 3O76A 1SKRB 4EDYA 1HQOA 4AJ8A 4LLRA 3J7Yb 1I9DA 5HFGA 4TXOB 4K1FA 4WEYA 1DSBA 2EIRA 3VI5A 5G30A 4ECCA 2VL9A 3F4SA 4JBBA 2RUFA 3CTFA 2XHFA 4HOJA 6GSVA 1WJKA 2HRFA 1OYJA 2VLTA 3EC3A 1ABAA 5J41A 3G7IA 5L71A 2VLUA 4GLTA 1T3BA 2IFQA 2FWFA 2R4VA 1O73A 2JZRA 3AY8A 1Z9HA 5DQYA 4ILFA 2C4JA 3LG6A 4MH2A 2TRXA 5J4UA 1AQVA 4NV5A 1VGLA 3KH7A 2VCQA 5KEJA 3LYKA 2DLXA 4J57E 3EYTA 2IL3A 1LJRA 1GUMA 1PRXA 4ML1A 3UIWA 2IYJA 1O7UA 5ELAA 1XVWA 3K8NA 2YP6A 5DALB 1JLWA 1A2LA 5AIVA 2IMKA 5ABRA 3IDVA 4JU5A 5IO0A 1W4VA 5J9CA 4EL1A 2L4QA 4WR5A 3WGXA 4I2UA 1QMVA 3L9VA 4EXJA 3HA9A 4GSNA 3LXZA 1FB6A 1FW1A 3H1NA 3Q74A 1YJ6A 2RLIA 3VI7A 4WXTA 9GSSA 1A8YA 1PQNA 1GSUA 2D2ZA 2HLSA 2VIMA 3DIEA 3F6DA 4ZL7A 1WMJA 1OC8A 5ECSA 3ZMLA 4JR4A 4I2TA 5DJMA 2MBSA 2H8LA 1Y25A 1XW5A 4RUVA 1OKDA 1EOHA 2WULA 1FHEA 3G9BA 3ERWA 1RW1A 4OD7A 3WT2A 2A4VA 1YQ1A 1X9WB 3DRNA 1GH2A 5ECNB 2HE3A 4EF0A 3NZNA 2P5RA 5D93A 6GSTA 4XS1A 4YAPA 2DMMA 3G7YA 5CP1A 1BG5A 1DUGA 3GTUA 1JLVA 2PU9C 3QAGA 7GSSA 3TDGA 1LU4A 1GTUA 3M0FA 4GQFA 1TI3A 19GSA 3F4TA 3N5OA 5B7CA 3CSIA 2R2JA 4EE0A 1K0MA 2JZTA 3TUEA 1GNEA 1JZOA 1AIUA 4LMWA 3IA1A 1U6TA 2OACA 3RBTA 1M0UA 2L57A 2REMA 4GRFA 3GSSA 1J9BA 2GVPA 1YEPA 1ILOA 1G6YA 2B1LA 2RIIA 3TKPA 2PERA 4F2IA 2M72A 2CX4A 2MYGA 3F0IA 2C0FA 3RHBA 4PNFA 1F3AA 3TKQA 1G0TA 2JU5A 2VD0A 4G2EA 1CQHA 3H8QA 3D0ZA 4V1Ag 4MMMA 3PR8A 1SK1A 1F9MA 5H5QA 1OC3A 4I97A 5CNWA 2B6MA 2K18A 2CZ2A 2GSSA 4WBJA 5J5NA 3L0HA 4V2LA 4ECJA 1Z5YE 4JE1A 2FWEA 4MH3A 3KMOA 5IMCA 3LSZA 1Y6EA 5B6NA 4XRAA 4KX4A 2PPTA 4GF0A 4WETA 2PVQA 4IHUA 3WT1A 2H66A 5G31A 3P90A 3HZ8A 4WF5A 1SYRA 3SWLA 2DIZA 5IM9A 5D9TA 5GAND 1J08A 3FZ9A 5CREA 1SYXA 3TGZA 2KOKA 4HI7A 1X9SB 4NXIA 4ZBDA 1A24A 4POKA 1GTBA 1AQWA 5LCZA 1KEBA 3QFAC 2FUG2 1OC9A 2YANA 2DJKA 2OE3A 5F8BA 4GCIA 2O7KA 2KP1A 3IE3A 2NVLA 1AXDA 3C1RA 3J7Yk 4GQCA 3UVHA 2B5XA 2HZEA 3UBKA 1OKTA 2HYXA 1F2EA 1OE8A 2JADA 4MPGA 4J2FA 1K3OA 2K9FA 2QGVA 2FA8A 4FYCA 3ZLPA 5DCHA 3BJ5A 1NHOA 1JFUA 1TU8A 5DBQA 4N30A 2XC2A 2DJ3A 3IAS2 5IMZA 2EIOA 2KUCA 3GKMA 5G2ZA 2HFDA 5FHIA 2GZPA 4ECBA 2I1UA 2H0HA 5DVBA 1SL1B 3P2AA 3P7XA 3TKSA 5E59A 5ID2A 5CRGA 2P5QA 3L4NA 5GSSA 4JR6A 5ID2B 1EP7A 4KW6A 1EV4A 3CSHA 3KTBA 2VL2C 3GKNA 3HVVA 2YWIA 12GSA 2IWTA 4O7HA 1QFNA 4KDXA 2HNLA 2FA4A 4N10A 1ZOFA 5JWRB 1PSQA 5D8IA 6GSXA 4X1UA 1VF2A 4HUAA 4G10A 4KCEA 2H30A 2LNTA 2YNXA 2YJHA 4MZBA 1R5PA 5D96A 1FVJA 2G2QA 5D73A 3ERGA 1Z3EA 3EU3A 5EY6A 3PH9A 2H6YA 4K8MA 4MF7A 2CQ9A 5AN1A 1UVZA 2YWMA 5KN1A 1S3DA 1GSYA 2F8AA 3QCPA 4TR1A 5HFIA 5HQPA 3U5RE 4PQ1A 1NSWA 3GSTA 3QOUA 2WGRA 4IJ3A 3ZFBA 5A4UA 4F82A 3ZITA 1UN2A 3IV4A 4MDCA 1TU7A 4XS4B 2LEGA 3C1SA 2VUPA 3CTGA 4IP1A 4L0WA 2VLVA 1T7PB 3D4MA 3GYKA 2C0GA 4KH7A 1GWCA 2H71A 2MMOA 1TRWA 2E2MA 2N5AA 3ED3A 1XIYA 4KGIA 5CRHA 3OR5A 4K0GA 3C8EA 2IMEA 2AUVA 16GSA 3PGTA 3QFBC 1ZCPA 3H93A 1FO5A 2V32A 1RK4A 3KGKA 3I6AA 3TKRA 2YCDA 5GSTA 2OBIA 2AV4A 1Z7PA 4GXZA 3A2WA 2IN3A 4JRRA 1U87A 3ZIJA 1NM3A 1TI1A 2O85A 2G0FA 1ERVA 2VCTA 4OMVA 1HYUA 5KN0A 3DEXA 3NIVA 2V6KA 3DXBA 5ECQB 4ZB8A 2R5GA 1BAYA 4D73B 2ON7A 3WGDA 4D73A 2X8HA 4Q5NA 3GL5A 3ZZXA 2I81A 2M46A 4PXOA 1LBKA 3NOFA 1F3BA 1T00A 3HJMA 3VPQA 3TKSE 4RQRA 1JZRA 2H75A 2GT5A 4HQZA 4KSMA 10GSA 4FYUA 4MF6A 1XWKA 2WRTA 3TJGA 3VPTA 4F9ZA 4OO5A 2GSTA 2ON5A 4TXVA 3HCZA 1J0FA 2C3QA 3UBLA 2CAQA 1I5GA 3IBHA 3VWVA 1GTIA 4ZL8A 1CQGA 2LQQA 3DWVA 4HQSA 2FNOA 3KIJA 3EMXA 4HDEA 5F0GA 1PGTA 2OBKA 1GSDA 1BX9A 1YF0A 1ML6A 2YN1A 3ZVJA 1VF3A 3VLNA 3D5JA 4MLYA 1X5CA 2VO4A 3VWXA 3ZL5A 1SKWB 1QGVA 4OCEA 3G7JA 3MWHA 2FCHA 3HDCA 2R3XA 3ZIVA 1WPIA 4TN8A 1EEJA 3L78A 6GSYA 3IR4A 2WB9A 3A2VA 4F03A 1A23A 2EC4A 4HZ2A 2N5BA 4IJIA 2OA7A 1GNWA 2HSHA 2BJXA 2C1YA 2HRNA 5ECOB 2E2GA 5CRDA 2WCIA 5EL8A 2O89A 5HR3A 2VCVA 4YQMA 3A5WA 2B7KA 3FHKA 2VCWA 1R4WA 4TVEA 5C00A 5JWQB 1MD3A 5DALA 3FEUA 2CT6A 4BA7A 2J23A 1PMTA 2AHEA 1FAAA 2IMFA 2V1MA 3F8UA 5HR1A 1K0NA 4NAXA 2I3YA 3E3EA 1B8XA 2PVOC 4YQUA 2H76A 1TDIA 3HVXA 1K0BA 2HI7A 4MJAA 1USBA 3DYRA 2KLXA 2GSRA 5ELGA 1HNCA 1U88A 1WRYA 3VFIA 4MK3A 1YY7A 3IHQA 4FO5A 1Q98A 1S3CA 1FB0A 18GSA 1SL0B 2PN8A 4N0VA 2L6DA 3ZRDA 2FD3A 1V2AA 3M8NA 3W6GA 2C8UA 3E9JB 3U6VA 5ECRB 2GS3A 4XS4A 4MABA 2RUEA 1MDIA 2VL2A 2BMXA 3QDNA 4MCUA 4MF5A 2WDUA 3ZFLA 1YEXA 4FIWA 2H1GA 1THOA 1GRXA 1EP8A 2GLRA 4L5LA 1H75A 3KD0A 4IS0A 3ERFA 5HR0A 3UMAA 3ZREA 1B9YC 2L5OA 4ZIJA 2E0QA 3CXGA 1EZKA 2OADA 1KTEA 3GKKA 3LJRA 1X9MB 1SK2A 2WJUA 3TRXA 2TRCP 4OFNA 2GQKA 2H19A 3TJFA 4HZ4A 1XWCA 5A4WA 1PA3A 2RM6A 2GDRA 5G1LA 1PL2A 4I8BA 1S3AA 2C3NA 3GHAA 5F07A 4WF4A 1ZZYA 3IPZA 4HEA2 4YQVA 5IOXA 4I5QA 2HXKA 2LUSA 4Q5RA 2E7PA 4PQHA 4TXOA 3FR6A 3EURA 2YWNA 2BTOT 1IYIA 2CZ3A 1K0AA 4XTSA 4XRDA 4F0CA 1TP9A 2H6XA 3SBCA 1F6MC 1E2YA 2YV9A 4OCFA 1WE0A 4YH2A 4TR3A 3TOUA 4O32A 4TRXA 2CAIA 3F6FA 1GSQA 2FHEA 3BOAA 3QR6A 1FOVA 1O6JA 2H72A 1N8JA 2GT6A 3H4KA 3H79A 1AW9A 2AYTA 5IQYA 2AJQB 1G7OA 1UC7A 3ISOA 3HZ4A 2LTKA 4OO4A 2YOIA 3TCOA 1O81A 2H1BA 2DJ1A 4ZB9A 4L0UA 2B7JA 3HVSA 2X8CA 1TXXA 2X99A 2A2RA 1GLQA 1Z7RA 4DSSB 3I43A 1XWAA 1XPVA 2OJLA 3ZYWA 5ECHB 1GP1A 5DAKA 3TKSC 2M80A 5ENUA 3GUSA 14GSA 1JHBA 1FG4A 2AAWA 3FW2A 4MJCA 1C72A 2GQLA 4IBPA 5G5EA 4E8EA 1KNGA 3DGQA 1ZYEA 3UARA 2OE1A 4MZWA 4CHSA 2V6OA 5F06A 2PUKC 1O8WA 1XXUA 2VL3A 3S9FA 1OVNA 4DVCA 3WGEA 2LV3A 3CRUA 3FK8A 5A5KA 2IMIA 5ECPB 1M9BA 2QKEA 5JCWA 3EWLA 2VCXA 5J3RA 3UEMA 3M9JA 3A3TA 4HU7A 4Q5FA 5JCUA 3TOTA 4KDUA 13GSA 1HNBA 4ZBBA 1ZL9A 4OFMA 1TJDA 4TR1B 1GSFA 4K7IA 2XBIA 1TRSA 2L59A 3D21A 1XWGA 4MPFA 4IW9A 5D9XA 4RI7A 2IPAA 2TIRA 1AC1A 3BBYA 5ECMB 2ALBA 2IY2A 3F63A 2PMTA 5DQSA 3UOMA 4BWQA 1QQ2A 2DC5A 11GSA 1TK8B 3GIXA 3Q19A 1YKAA 1PX7A 1V9WA 4J56E 2GSQA 1XOBA 1M2AA 4ULXA 4QL9A 2VAFA 4XS6A 4LL4B 2FGXA 2XPEA 4EC0A 1ZMAA 2Z9SA 2J9HA 5HR2A 1AUCA 1W89A 3PINA 3FKFA 2WFCA 1Q4JA 5INYA 2XPDA 2C3TA 1TW9A 5AGYA 2X8GA 5IMAA 3LGCA 2DMLA 2LS5A 3UVTA 1PD21 1G7EA 3WD6A 2H1AA 1ZGNA 4K0NA 3CBUA 4ZB6A 1BJXA 2LKUA 2N5FA 3KXOA 1ERUA 2LSTA 3APQA 3QPMA 4ECIA 1PKZA 1A2JA 5ECIB 1GUHA 2JACA 2AB6A 4E8HA 1YKCA 3R2QA 3VWUA 3FY7A 1SL2B 1SK0A 3CRTA 1EGOA 2JL4A 4X0XA 3JCML 1G6WA 3LORA 5DJLA 4KSOA 2WZ9A 1Z6NA 1B9XC 1SJ6A 5FWGA 1OAZA 1GULA 5HFKA 3UL3A 2ZNMA 5H5SA 1JZDA 4IQAA 2F9SA 1M9AA 4P3YB 4RI6A 5DAKB 2K8VA 3HD5A 6GSWA 8GSSA 3O3TA 3GH6A 4KE3A 1A0FA 3TJJA 3US3A 4TW5A 2DJJA 2ZCTA 3D22A 3TB2A 2LRCA 4H86A 4LMVA 2NPBA 3HJOA 1A2MA 5KN3A 4NHWA 4BVYA 3GFKA 4KUNA 2QSIA 3GRXA 1GUKA 3BCIA 6GSUA 3EU4A 2H73A 3IXRA 1UA5A 5B6MA 1YDKA 1Z6MA 1DBYA 2L6CA 3LEFA 2L5LA 3ME7A 2H0IA 3Q18A 3M9KA 1EWXA 1DE1A 3IC4A 1XFLA 2IFQB 5G5FA 5GAPD 3ME8A 4HJMA 5IIZA 1B4QA 4G9HA 3KTLA 5KN2A 1MD4A 4KA0A 2P31A 1IYHA 2H70A 2CA8A 4XIHA 3GKXA 4I6XA 3DMLA 1AQXA 4IN0A 4V2NA 4AGSA 4GTUA 2RM5A 1U3IA 5CRWA 5FT3A 4OFTA 2JSYA 2HZFA 2NDOA 4JZQA 4KCAA 3RPNA 5EPFA 4HS1A 2CVDA 3LYPA 2HZEB 4N0ZA 2YJ7A 4FH8A 4PGTA 4K6XA 4QQ7A 5DCGA 3KCMA 2MZCA 2DJ0A 3QAWA 1QK8A 3BD2A 3DVXA 2CVBA 2VOCA 4Z7XA 3KZQA 2QC7A 4FYBA 1NW2A 1ST9A 2IMDA 1GTAA 4K7NA 20GSA 5A4VA 17GSA 5IPGA 3EINA 1PN9A 1X5DA 2C0DA 3IAM2 1MDKA 1XZOA 3DVWA 2V2GA 3LFLA 1EV9A 4O92A 5DDLA 1NHYA 5IMDA 1GSSA 1QXHA 1WIKA 3BCKA 3RPPA 1EGRA 2CVKA 5IMFA 1QUWA 4L8EA 3EVIA 3RAZA 3DD3A 4L5OA 3W8SA 1F37A 4XHMA 3MAKA 1T1VA 1VF4A 1M2DA 4MA9A 1ZYQB 1M99A 2NBSA 1XOAA 3I69A 4PUFC 4LA1A 22GSA 1TK0B 2H74A 1EEMA 2FY6A 2B1KA 4V1Ap 3TRPA 3UJ1A 3L9SA 5LD0A 5EVOA 1SJIA 5CO3A 1B48A 3KJYA 4EO3A 1ERTA 2P0GA 5E4WA 2I9HA 5COHA 3A2XA 3FZAA 1H4OA 1V98A 4IKHA 4DSSA 1YF1A 4V2MA 4IELA 1TRVA 5AISA 3F3QA 1X5EA 2OKAA 4HJ2A 5H5RA 3WYWA 2MBTA 3FYGA 3GX0A 1PX6A 1XBSA 4CDOA 2K8SA 4GWRA 4ZILA 2K6VA 3ZTLA 4GSSA 3LQ7A 3HYPA 2H01A 2R37A 4PX1A 5IPHA 4WBRD 4NHZA 2NTOA 2XBQA 3IK9A 2GZYA 4RQXA 2DJ2A 1SENA 1K0CA 2L4CA 4CW9A 4MZCA 4POMA 1JZWA 3GN3A 3FR3A 1DE2A 5ECKB 3GTUB 3TJKA 4KDYA 1T4YA 3IK7A 1GSEA 2DBCA 1WWJA 2HT9A 3MDKA 2F51A 1WOUA 1TRUA 1HNAA 4KNDA 5F05A 4NWYA 4IVFA 4LL1B 3FZ5A 4K2DA 3HXSA 2LJAA 1V40A 1O85A 1R7HA 4WKWA 4NPBA 4NV2A 1T4ZA 5CYYA 3N9JA 3GL3A 2KP2A 1A8LA 3F9UA 4TR4A 1SJZA 3ZMKA 1V57A 2C80A 1VF1A 3ZVJD 1V58A 2F8FA 3GMFA 4MJEA 4EVMA 2PGTA 2LNSA 5B8BA 1SD9A 2H6ZA 2YV7A 1THXA 1K3LA 1GLPA 1MDJA 4MP4A 1A0RP 2HSYA 2H0GA 2YZHA 4PQIA 3EE2A 3DKSA 4PUAA 1O8XA 3UAPA 5C04A 1AAZA 4DEJA 3QMXA 1TK5B 5JWOB 4KAEA 3VWWA 4ZBAA 3TJBA 1M7TA
chains in the Genus database with same CATH superfamily
4DSRA 1Q824 4ZXGA 2ZDJA 2A2SA 1KSIA 2YWOA 2R6KA 1YZXA 2XRXB 1SIIA 3PCRA 1RCKA 1XCCA 1XW9A 2C0EA 3CMIA 4DSQA 2H1DA 2KHPA 3IOSA 1CH0A 3KH9A 3S28A 4KFFA 1RKYA 1BNJA 1JJ22 3KM6A 3C73A 3LT9A 3WDGB 5IO2A 1XW6A 3D5IA 1VRSD 2LJKA 3AHWA 3FZ4A 3KMNA 4NMUA 3M3MA 4FMBA 4TKYA 1GL8A 1ASKA 3OX9A 1DMMA 5RNTA 4GSPA 2YZUA 2B5EA 1ERWA 4ISDA 4ACSA 3I9V2 3IHGA 2EIQA 3UB1A 2GU3A 3KEBA 3RHCA 2ZUPA 2YPMA 5ECLB 3HHVA 3FRCA 1PKWA 4K61A 1Q40B 2B5YA 3C7MA 5EVHA 1OC9B 4X4JA 1B4PA 4AJ6A 5J9BA 2ML6A 3GNJA 3S29A 1SU9A 4XCSA 4BL3A 4KB3A 2O8VB 1BRNL 1BANA 3P8WA 1NU3A 1N2AA 4JEDA 2WGQA 4LZIA 1OGZA 4ML6A 1XVQA 3MSZA 4MMYB 3HZPA 4QL7A 2QEX3 2MMZA 2B1XB 3IRAA 3Q6OA 4POLA 1EOGA 3CME3 3GV1A 4WYKB 1OUNA 1GOVA 2VM2A 4BL7A 3WOFB 4AJ7A 3OXAA 4H61A 4O8SA 3EMPA 4Q5QA 3VURA 1RSNA 5CAXA 5GZZB 1MEKA 3K0ZA 2ZA4A 4BVXA 4HZ9B 4O2HA 4K9ZA 1BYEA 4RZMA 1FGMA 2LJRA 4Z2TA 3OWSA 3MSOA 3L9UA 2X64A 4WHAA 5D9WA 2IJYA 2QA1A 1BQ7A 1FGQA 3C71A 4O02B 2PWJA 1QMAA 5LNKe 4HU9A 3DGNA 2F3MA 5AIGA 2JZSA 1TRQA 1I3FA 2CX3A 3W8JA 3LWAA 1DYUA 2DIYA 3GURA 4FCZA 2XFTA 1RN7A 1BNSA 2ES7A 3SX1A 2VM1A 2B3SA 4K7OA 4O5RA 4GL6A 2VCZA 2OE0A 1OE7A 1A2VA 1FVKA 2F4YA 4BPYA 3FKAA 1M2BA 3V1WA 3TRQA 1MTCA 4N6MA 4EDZA 2GQMA 3MYDA 3VK9A 2MMNA 3HY2A 5AIXA 5B8AA 1B2SA 2DKHA 1W6YA 1HD2A 3APOA 1U3AA 4PNGA 1N9JA 5BU4A 3F4RA 4AF2A 3MNGA 3QD9A 4ID0A 3CSJA 1BEDA 3WHOA 3GH9A 1TOFA 3O6TA 4MJBA 4X43A 2FXTA 3GA4A 2FLSA 4H3UA 1RQMA 5IOWA 4EC6A 1SKSB 4G19A 3LXTA 4BVXB 1RGCA 4HAAA 4R4KA 2FWHA 1FA3A 2AAEA 4POBA 2LRTA 4TOPA 1SD8A 1ULJB 3LTBA 2RSXA 1R26A 3D4TA 3KP9A 1ACVA 3KP8A 1O7PB 4EKZA 4IQ1A 1FZUA 1PL1A 3APSA 2LQOA 2VD1A 3F40A 1URMA 1SJWA 1K3YA 1E6BA 1I0VA 1EQKA 2BU4A 2V41A 1W00A 3BLZA 2GTUA 1ZYNA 3RDWA 2MMAA 1PFPA 4WR4A 4OWYA 3FSDA 1FOHA 1L5GB 3ALAA 4EUYA 1TTZA 4IP6A 2IIYA 5D9VA 4GSTA 4BWSA 3E0UA 1R5AA 4A5PA 4EV2A 3QAVA 1WP0A 1T8EB 4IGJA 4N11A 2D42A 2Y73A 6GSSA 2GGTA 1RN4A 3KN4A 2OWPA 1KBNA 1RNTA 2OCTA 3EC9A 4XB5A 3HIIA 1GMPA 3G16A 5BVBA 1ON4A 1K0OA 2GZZA 1RGAA 1K0DA 3HKRA 4ZL9A 2LRNA 2CV4A 2DSAA 1MWTA 2O87A 1JB4A 3D6IA 1AR0A 1I70A 3BNDA 1VQ83 4G0KA 2I4AA 5IMVA 2L1SA 2GBXB 3GX8A 3CYNA 5JPPA 1FGOA 2WS2A 5G1KA 3IPTA 2GEXA 2YFLB 5JCGA 3HJPA 1X0RA 2OOVC 4TR0A 2PBJA 1R4CA 4F0BA 1TKDB 4J9AA 3FR9A 3F3RA 1XWBA 2W9QA 2FWGA 4YAVA 3LTDA 2JSZA 4PURA 4GHOA 2QA43 2OQEA 3M1GA 2YFJB 1GOUA 3NBRA 2OTJ3 3O76A 1OGXA 1SKRB 4EDYA 1HQOA 4FCMA 4AJ8A 2OTL3 3HX8A 4LLRA 2B24B 5AIHA 5EEOA 3J7Yb 1I9DA 1O7MB 1ROAA 5AEUB 3GAXA 5HFGA 4TXOB 5GSPA 4K1FA 4WEYA 1DSBA 2EIRA 3VI5A 5G30A 4ECCA 2VL9A 3F4SA 4JBBA 2RUFA 2L4VA 3CTFA 2XHFA 4HOJA 6GSVA 1WJKA 2HRFA 1OYJA 1RGEA 1W4NA 2VLTA 2CKFB 2OOVA 3EC3A 1ABAA 5J41A 3G7IA 5L71A 2VLUA 4GLTA 1T3BA 3V99A 2IFQA 2FWFA 4EV5A 2R4VA 1O73A 2JZRA 3AY8A 1Z9HA 5DQYA 4ILFA 2C4JA 3LG6A 3KFQC 1OHPA 4MH2A 1ISKA 2TRXA 3LMLA 4WYKA 4CDLA 5J4UA 1AQVA 4NV5A 1VGLA 3KH7A 3HOHA 6RNTA 2VCQA 1UCIA 3CCS3 4HM6B 3CCL3 1E3VA 5KEJA 3LYKA 5DREA 1QALA 1TTOA 2DLXA 3FLJA 5LC7A 2UX0A 1Y4KA 4J57E 4K1UA 2XGNA 3EYTA 2F86B 2IL3A 1LJRA 1GUMA 1QVF2 1PRXA 4ML1A 3UIWA 5I97A 4BIKA 4O5QA 2IYJA 1O7UA 5ELAA 3A76A 1XVWA 3K8NA 2YP6A 4EBGA 1JLWA 3RNTA 1A2LA 5DALB 5AIVA 3DGMA 3MKIA 2IMKA 5ABRA 5IG3A 3IDVA 4JU5A 5IO0A 1W4VA 5M18A 5J9CA 4EL1A 2L4QA 1JN5B 4WR5A 3H3HA 3WGXA 6GSPA 2YFIB 4I2UA 1S723 1XG8A 1C7HA 2ZHXB 1QMVA 5LC6A 5STDA 3L9VA 4EXJA 3ZG5A 3HA9A 5CK6A 1VQ73 4GSNA 1UW1A 3RDEA 3LXZA 1IVUA 1M904 1FB6A 1FW1A 3H1NA 3Q74A 1YJ6A 2RLIA 1OPYA 3VI7A 4WXTA 2X49A 9GSSA 1E97A 1A8YA 1PQNA 1GSUA 2D2ZA 3UL6A 2HLSA 2VIMA 3DIEA 3F6DA 1RGFA 1WMJA 4ZL7A 1OC8A 5ECSA 4JR4A 3ZMLA 4I2TA 5DJMA 5IEOA 2H8LA 2MBSA 1Y25A 1XW5A 3SXXA 4RUVA 1OKDA 4WFOA 1EOHA 2WULA 3BNCA 1I2GA 1FHEA 3G9BA 3ERWA 2IA7A 1RW1A 4FCJA 2E2TA 4OD7A 3T0UA 3WT2A 2A4VA 1YQ1A 1X9WB 3DRNA 1BSBA 1GH2A 5ECNB 3KKGA 2MC8A 2HE3A 4EF0A 3NZNA 2P5RA 5D93A 6GSTA 4XS1A 4BTWA 4YAPA 3D5GA 4LSOA 1M3IA 2DMMA 2CIUA 3F7XA 3NUVA 5G2GA 3G7YA 5CP1A 2HSMA 1BG5A 1DUGA 2R0CA 3NHXA 3GTUA 1JLVA 4IT7A 3AGOA 2PU9C 3QAGA 7GSSA 3TDGA 1PYLA 1YNVX 2HMJB 1UUVB 1LU4A 1GTUA 1DVDA 3M0FA 4BTYA 4GQFA 2Q07A 1TI3A 19GSA 3F4TA 3N5OA 5B7CA 2CWTA 3CSIA 2R2JA 3CNXA 3N8BA 4EE0A 1K0MA 4EIQA 6STDA 2JZTA 3TUEA 1GNEA 1JZOA 1NO3A 1AIUA 4LMWA 3IA1A 1U6TA 2OACA 3RBTA 1M0UA 2L57A 1YGEA 1UGHI 2REMA 3CCQ3 4GRFA 3GSSA 2ZL8A 1KC84 1J9BA 1VQ93 2GVPA 1YEPA 1ILOA 1G6YA 1K734 2B1LA 2RIIA 3NQZA 5KOWA 3TKPA 1OHSA 2PERA 4F2IA 2M72A 3CCJ3 2CX4A 2MYGA 3F0IA 2C0FA 1UDII 1FGTA 2PNCA 3RHBA 1B3SA 1J2BA 4PNFA 1F3AA 3F9SA 3TKQA 1G0TA 4NHFA 2JU5A 2VD0A 1DMNA 3DMCA 4G2EA 1EKMA 1CQHA 3H8QA 1U5OA 3KZTA 2A15A 3D0ZA 5KP4A 4MMMA 4V1Ag 1BNGA 2SARA 3PR8A 1SK1A 1F9MA 5H5QA 1OC3A 4I97A 5CNWA 1NJI4 1UUGB 2HMNB 2B6MA 4ZM8A 2K18A 1UI8A 2CZ2A 2GSSA 4WBJA 5J5NA 3L0HA 4V2LA 4ECJA 1Z5YE 4JE1A 2FWEA 3KSPA 4MH3A 3DZLA 3KMOA 5IMCA 3LSZA 1Y6EA 1VQQA 5B6NA 4XRAA 3PXMA 1ZX2A 2FNQA 4KX4A 2PPTA 4GF0A 1AVKA 2PVQA 4IHUA 4WETA 3WT1A 2H66A 2CX0A 5G31A 1JRQA 3P90A 3HZ8A 4WF5A 1GMRA 1SYRA 3SWLA 2DIZA 5CF2A 5IM9A 5D9TA 5GAND 1J08A 3FZ9A 5CREA 1SYXA 1WMPA 3TGZA 2KOKA 2RBIA 4HI7A 1X9SB 4NXIA 4ZBDA 1A24A 4POKA 1GTBA 1AQWA 5LCZA 1BNEA 3CXC2 1KEBA 3QFAC 2FUG2 1OC9A 2YANA 2DJKA 1TFKA 2OE3A 5F8BA 3LYGA 4GCIA 2O7KA 2KP1A 3IE3A 2NVLA 1AXDA 3C1RA 5HOHA 3J7Yk 4GQCA 3UVHA 2CWUA 4KF9A 1OH0A 4N6UA 2B5XA 3JUPA 2HZEA 3UBKA 1OKTA 2HMLB 2HYXA 1F2EA 1OE8A 2JADA 4MPGA 4XBXA 1W7CA 4J2FA 1K3OA 2K9FA 2QGVA 2V1LA 3JUQA 3WA3A 1S3RA 2UZ8A 2FA8A 3FH1A 4FYCA 1TUHA 3ZLPA 5DCHA 4PEJA 1MNLA 1STDA 1N9EA 3HK4A 3BJ5A 1NHOA 1JFUA 3CQFA 1TU8A 5DBQA 3CNMA 2PZVA 4N30A 2XC2A 3AHSA 2DJ3A 3IAS2 4USSA 5IMZA 2EIOA 2KUCA 3GKMA 2UGIA 5G2ZA 1IU7A 3FG1A 2HFDA 5FHIA 2GZPA 4HSCX 1RRHA 4ECBA 2E2UA 5CF1A 2I1UA 2H0HA 1VQ63 4Z2RA 1M1K4 5DVBA 1SL1B 2CWVA 3P2AA 1IYYA 2W6JH 1BGSA 4LYLB 1U8CB 4Z2UA 3P7XA 3TKSA 3FG4A 5E59A 4CPKA 1I3IA 5CRGA 5ID2A 2P5QA 3L4NA 5GSSA 2Z76A 4QWTA 4JR6A 1BRJA 1NB3I 4XBYA 5ID2B 1EP7A 4KW6A 4Q53A 1EV4A 4FMCA 3CSHA 3KTBA 1YHQ3 3KIIA 3VGNA 1PU4A 3I563 2VL2C 3X3XA 3GKNA 3HVVA 2YWIA 12GSA 2IWTA 4O7HA 1QFNA 1K9M4 1AY7A 3MYTA 4KDXA 2HNLA 2FA4A 4N10A 1ZOFA 5JWRB 1PSQA 4MMXB 5D8IA 3HVNA 1BSAA 6GSXA 4X1UA 1VF2A 4HUAA 1RRLA 2CFKA 3NM2A 3MHEA 4G10A 4KCEA 2H30A 3Q1CA 2LNTA 3G713 4EIPA 2YNXA 2YJHA 4MZBA 1R5PA 1WNHA 5D96A 1FVJA 2G2QA 3PYJA 5D73A 3PGBA 1Z3EA 3ERGA 3EU3A 5EY6A 1LXEA 3PH9A 4STDA 2H6YA 1BNFA 4K8MA 4MF7A 2CQ9A 1GOYA 5AN1A 4N6OB 1UVZA 2YWMA 5KN1A 1S3DA 1GSYA 2F8AA 3QCPA 4HVNA 4BL2A 4TR1A 5HFIA 5HQPA 1OACA 3U5RE 3EN1B 4YKFA 4PQ1A 1NSWA 3GSTA 3QOUA 2WGRA 4IJ3A 3ROBA 3ZFBA 1Q42A 1UGIA 5A4UA 5M19A 4F82A 3ZITA 1RGLA 3EN8A 2INXA 1UN2A 3K7CA 4G0IA 3IV4A 4HM5B 4MDCA 1TU7A 4XS4B 2LEGA 3C1SA 2VUPA 3CTGA 2KF5A 4IP1A 4L0WA 2VLVA 1T7PB 3D4MA 5IG4A 3GYKA 2C0GA 4KH7A 3LZAA 1GWCA 2H71A 2MMOA 1TRWA 2E2MA 4KFEA 1A90A 3WMDA 2N5AA 3ED3A 1XIYA 4XDVA 1BNIA 5JBSA 1PFOA 4KGIA 1RNBA 4HOHA 2XH9A 5CRHA 1HYFA 3OR5A 4K0GA 3C8EA 2IMEA 2AUVA 16GSA 3PGTA 3QFBC 1ZCPA 3H93A 1FO5A 4OK0A 2V32A 1RK4A 5KP1A 3KGKA 3I6AA 5IEPA 1UUWB 4MJDA 3TKRA 4JF8A 2YCDA 1KQS2 5GSTA 2OBIA 2AV4A 1Z7PA 4GXZA 5JPUA 3A2WA 3EX9A 2IN3A 4JRRA 1U87A 2XSHB 4J5KA 1I2FA 1I2EA 1IVXA 2HRAA 3ZIJA 1BSCA 1BUQA 1NM3A 1TI1A 2O85A 2G0FA 1MWSA 1ERVA 2VCTA 3WR2A 4OMVA 2XSOB 3DUKA 3D4AA 3GWRA 1FYSA 3EHCA 2F5WA 1N8R4 1HYUA 4N6V0 5KN0A 3DEXA 3NIVA 2V6KA 3DXBA 5ECQB 4ZB8A 2R5GA 1YJ93 1BAYA 4D73B 2ON7A 3BNEA 3WGDA 4D73A 2X8HA 3ECFA 4Q5NA 1MGRA 5AIIA 3GL5A 1B21A 2I81A 4PTSA 3ZZXA 2M46A 4PXOA 1LBKA 5CXOA 3NOFA 1F3BA 1T00A 3HJMA 3VPQA 2K0MA 4R9KA 3TKSE 4RQRA 1JZRA 2H75A 2GT5A 4HQZA 4KSMA 10GSA 4FYUA 2AADA 4MF6A 1XWKA 2WRTA 3TJGA 3VPTA 1RLSA 4F9ZA 4OO5A 7RNTA 2GSTA 2ON5A 2K54A 3N9HA 4TXVA 4KVHA 4R9LA 3HCZA 1J0FA 1A2PA 2D1WA 3CPW2 3FF2A 3X42A 1BSEA 3EPTA 1BUJA 2GSPA 3GZBA 3EQQB 2C3QA 2R0PA 3BIRA 3UBLA 1W02A 2CAQA 4FQUA 1I5GA 4L8OA 1QVG2 3IBHA 1MWRA 3VWVA 1GTIA 3B8LA 3LW9A 1Q814 2CFWA 4ZL8A 1CQGA 2LQQA 1LQMB 3DWVA 4HQSA 2FNOA 3KIJA 4BTXA 3SOAA 3EMXA 2W2CA 3X41A 1VZZA 4RNYA 1B27A 1A2KA 4HDEA 5F0GA 3DXOA 1PGTA 2OBKA 1GSDA 1BX9A 1YF0A 3G0KA 5D82A 2XEPA 5HGRA 1ZO2A 1ML6A 2YN1A 3Q3FA 3KCHA 3ZVJA 1VF3A 1LVNA 3D5JA 1B2XA 4MLYA 3VLNA 4NREA 1X5CA 2VO4A 3VWXA 3ZL5A 4EXRA 1SKWB 1QGVA 4OCEA 3G7JA 2QGUA 4MMZB 3MWHA 2FCHA 3HDCA 2R3XA 3ZIVA 1WPIA 5TGNA 3S67A 4N6NB 3B7CA 4TN8A 1JNQA 1EEJA 3L78A 6GSYA 3IR4A 2WB9A 3EF8A 1W2ZA 3A2VA 4F03A 1A23A 2EC4A 4HZ2A 2N5BA 4IJIA 2OA7A 1IV9A 2HMMB 1LOYA 1IVVA 1GNWA 2HSHA 2BJXA 2C1YA 2HRNA 5ECOB 2E2GA 3PCSA 4N6LA 2HRKA 3RGAA 5CRDA 2WCIA 2W9PA 2O89A 5EL8A 2GXFA 3LTCA 5HR3A 2VCVA 4DKIA 4YQMA 4BIRA 3A5WA 2XFSA 1TFOA 2W56A 1FUSA 2B7KA 2X4AA 3FHKA 2VCWA 1R4WA 4IPBA 3STDA 4TVEA 5C00A 4N6TA 5JWQB 1MD3A 5DALA 3FEUA 3HI7A 2CT6A 4BA7A 3ER7A 1W6CA 2J23A 1NWWA 1Z1SA 1PMTA 2AHEA 1C54A 1FAAA 5KP3A 2LQVA 2IMFA 2V1MA 3F8UA 3GZXB 2P0MA 5HR1A 4KZ1A 1K0NA 4NAXA 2Y74A 2I3YA 1G96A 3E3EA 1IVWA 1B8XA 2KRTA 2PVOC 4YQUA 2H76A 1TDIA 3HVXA 5IG5A 1K0BA 2HI7A 4MJAA 1USBA 3DYRA 2KLXA 1KWIA 3NBJA 2GSRA 5ELGA 5BRTA 1FUTA 1I8VA 2KCDA 3IMAB 3NM7A 2CW9A 1HNCA 1U88A 3PS8A 1WRYA 3A5EA 3VFIA 3MG3A 3NQYA 2O9UX 4MK3A 3G8ZA 1YY7A 3IHQA 4AKZA 2CG0A 2KF3A 5IG0A 1Q98A 4FO5A 1S3CA 1FB0A 3Q90A 18GSA 1SL0B 1GD3A 3FGYA 2PN8A 4N0VA 2J8XB 2L6DA 2C10A 4BU4A 3F8HA 2XGLA 3ZRDA 4K90B 1WMOA 4CY6A 1JN5A 3CC23 2FD3A 1V2AA 5DRVA 3M8NA 3W6GA 2C8UA 3E9JB 2GBWB 3U6VA 5ECRB 2GS3A 1TP6A 5AYRB 4XS4A 3D3LA 4MABA 2RUEA 1MDIA 1EA2A 2VL2A 2BMXA 3QDNA 4MCUA 3CCU3 4MF5A 1VQN3 1UI7A 2WDUA 3ZFLA 4G0LA 3NX0A 1YEXA 4FIWA 2H1GA 1THOA 1GS3A 1GRXA 1EP8A 2GLRA 4L5LA 2CH9A 1H75A 3KD0A 1Q40A 4IS0A 3ERFA 5HR0A 1RMSA 1UCKA 3UMAA 3ZREA 1B9YC 2L5OA 4ZIJA 2E0QA 3CXGA 2HMKB 3OWUA 1EZKA 1KTEA 2OADA 3GKKA 1AQZA 4CCVA 2A4HA 3LJRA 3CCM3 3A5IA 1NNVA 1X9MB 4HM7B 1K8A4 1SK2A 1BRIA 2WJUA 3TRXA 1MGWA 1YJN3 2TRCP 4OFNA 2GQKA 1B20A 2H19A 3TJFA 4HZ4A 1XWCA 2MF7A 5A4WA 1PY3A 1YIJ3 1PA3A 1QAKA 2RM6A 3RGRA 2GDRA 5G1LA 1IQXA 1PL2A 4I8BA 1S3AA 3O8YA 2C3NA 5IENA 3GHAA 5F07A 4WF4A 1ZZYA 3IPZA 4HEA2 4YQVA 5IOXA 4I5QA 2HXKA 1BRSA 3CC43 2LUSA 3MG1A 4Q5RA 2CK3H 2E7PA 4PQHA 4TXOA 1Q7HA 3FR6A 1YVSA 3X40A 1IDPA 3SVAA 3EURA 2YWNA 2BTOT 2BMQB 5IW9A 1IYIA 1X1XA 2CZ3A 2SBLA 1JV2B 1K0AA 4XTSA 1YJW3 4K1VA 3S27A 3I553 4XRDA 4F0CA 3K63A 5ELJA 1NB5I 1TP9A 1EG9B 1IT7A 2H6XA 3SBCA 1F6MC 3EE1A 1E2YA 2YV9A 4OCFA 1WE0A 4YH2A 1PN0A 2IMJA 4TR3A 3TOUA 4O32A 1O7HB 4TRXA 2CAIA 2LYXA 3F6FA 1BRHA 1GSQA 2FHEA 3BOAA 3QR6A 2BHMA 1FOVA 2RFRA 1IQ8A 1O6JA 2H72A 3JUMA 1N8JA 2GT6A 1D6UA 5BMUA 1JBSA 3H4KA 1AVLA 4FMAA 3LT8A 2QA2A 3BNBA 3H79A 1AW9A 2AYTA 5IQYA 1MWUA 1ZGXA 3H51A 1WTHA 1UC7A 2AJQB 1G7OA 3ISOA 4KFDA 3HZ4A 2LTKA 4OO4A 1BAOA 1SIHA 3CCV3 2YOIA 3TCOA 3J7Yd 1GYBA 1O81A 2H1BA 2DJ1A 3EJVA 4ZB9A 4L0UA 1HKXA 4MNNA 3G4S3 2B7JA 1BRKA 3D9RA 3HVSA 2X8CA 1TXXA 2X99A 2A2RA 3K9MC 1GLQA 1W5ZA 1Z7RA 1ULIB 4DSSB 3I43A 4J5GA 4EYCA 1XWAA 3LOYA 3FZWA 3AGNA 1XPVA 2OJLA 3X3YA 3ZYWA 5ECHB 1R4YA 1GP1A 5DAKA 2GU1A 3TKSC 2M80A 3UJMA 2W0QA 2JDIH 5ENUA 3GUSA 14GSA 5D83A 2KAAA 1T2HA 2I9WA 1JHBA 1FG4A 2AAWA 3FW2A 1SPUA 4MJCA 1C72A 2GQLA 3NV0A 4IBPA 5G5EA 1X1UA 4E8EA 2HOHA 1SARA 1B2UA 4BL7B 3IC8A 1RGGA 3CU3A 2P09A 1KNGA 3GRDA 3DGQA 1BU4A 1GMQA 4CY8A 1ZYEA 3UARA 2OE1A 2P0XA 1VQO3 4MZWA 4CHSA 2V6OA 5F06A 2PUKC 3K5TA 1O8WA 1BNRA 1XXUA 2VL3A 4GB5A 3GSPA 3S9FA 1OVNA 4DVCA 4FR9A 1CYVA 3WGEA 3N54B 2STDA 2LV3A 3CRUA 5BXQA 3U97A 3FK8A 5A5KA 2IMIA 5ECPB 1M9BA 2QKEA 5JCWA 2ML5A 3EWLA 2VCXA 2WOHA 5J3RA 3UEMA 3M9JA 1RGKA 1WMNA 3A3TA 4HU7A 5KOXA 4Q5FA 5JCUA 3TOTA 2GEYA 4KDUA 13GSA 8CHOA 1HNBA 4ZBBA 1ZL9A 1VQL3 4OFMA 3MPHA 1RTUA 2P38A 1TJDA 4CJNA 1NDOB 4TR1B 2C11A 1GSFA 4K7IA 2XBIA 1RGHA 1TRSA 3KE7A 2L59A 2CFLA 1TU5A 3D21A 1XWGA 1TRPA 4MPFA 1RHLA 3JVCA 4IW9A 5D9XA 3LXUX 4RI7A 3NBBA 4L8PA 3AMOA 2IPAA 2TIRA 1AC1A 3BBYA 5ECMB 1M9GA 1QAFA 2ALBA 2IY2A 2Z7AA 3F63A 4ICYA 2PMTA 5DQSA 3T8UA 3EBTA 3UOMA 1QJGA 4BWQA 1QQ2A 2DC5A 1BVIA 5CLKA 11GSA 2P05A 4HYZA 1TK8B 3DGOA 3GIXA 3Q19A 3UNLA 1YKAA 1PX7A 2WOFA 1V9WA 4J56E 2GSQA 3M8CA 5IF6A 1XOBA 1M2AA 4ULXA 4QL9A 2VAFA 4LGQA 4XS6A 4LL4B 2FGXA 2R4IA 5D81A 2XPEA 1K28A 1US1A 4EC0A 1ZMAA 2WO0A 2Z9SA 2J9HA 5HR2A 1W89A 1AUCA 3CD63 3OW22 3PINA 3FKFA 3BU4A 2WFCA 1DVCA 1Q4JA 3QRDA 3E99A 5INYA 4OVMA 2XPDA 4YKGA 2C3TA 1TW9A 5AGYA 2X8GA 3PPUA 1LNHA 5IMAA 3BB9A 3LGCA 2DMLA 1O7GB 2LS5A 3UVTA 1PD21 1G7EA 3WD6A 3SYUA 1IT8A 1ZGNA 2H1AA 4K0NA 1RDSA 3CBUA 4ZB6A 1BJXA 2LKUA 1BIRA 4LEHA 2N5FA 3KXOA 1ERUA 2LSTA 2HMOB 3APQA 3PZWA 3QPMA 2O3OA 4X2HA 2CX1A 4ECIA 3CCE3 1PKZA 1A2JA 5ECIB 1RN1A 1GUHA 3Q2PA 2JACA 2AB6A 4E8HA 1YKCA 3R2QA 3VWUA 7STDA 2F99A 3FY7A 1W01A 1SK0A 1SL2B 3DGLA 3CRTA 2W56B 1EGOA 2JL4A 3QK9A 4X0XA 3JCML 1LOVA 4K2XA 3NXJA 1G6WA 3LORA 3G6E3 1KD14 4KSOA 5DJLA 1B2MA 1AV4A 2WZ9A 1Z6NA 5FGOA 1A67A 1N8QA 2CG1A 4KT3B 1B9XC 1SJ6A 5FWGA 1OAZA 1GULA 5HFKA 3UL3A 2ZNMA 5H5SA 1UCLA 1JZDA 3L0RA 4IQAA 2F56A 2F9SA 1M9AA 4P3YB 4RI6A 3MG2A 5DAKB 4RNZA 1OCVA 2E2VA 2K8VA 3HD5A 1D6ZA 2Z6BA 6GSWA 8GSSA 1RCLA 2A2PA 3O3TA 3GH6A 4KE3A 1A0FA 3TJJA 4TW5A 3US3A 2DJJA 2ZCTA 3I0YA 3D22A 3KSED 3TB2A 2F5MA 4J8TA 2LRCA 4H86A 4LMVA 2NPBA 3HJOA 4XM4A 1A2MA 5KN3A 1VQM3 1LRAA 4NHWA 4BVYA 1FGRA 3GFKA 4KUNA 1JKGA 2QSIA 3GRXA 1BOXA 1GUKA 1N5PA 4LMIA 2BO9B 3BCIA 3JUOA 6GSUA 3EU4A 2H73A 3IXRA 1UA5A 5B6MA 1YDKA 1VQ43 1CQSA 2WGOA 4HM8B 3DGYA 1Z6MA 9RNTA 1EUIC 3FF0A 1DBYA 1STFI 2L6CA 3LEFA 2L5LA 3ME7A 2CHCA 1LNIA 5M1AA 2H0IA 3Q18A 3M9KA 1O7NB 2RCDA 1EWXA 1OF5A 4RNTA 1DE1A 3IC4A 2KXGA 1XFLA 2IFQB 5G5FA 2Z77A 1FUWA 1JBTA 5GAPD 3ME8A 4HJMA 2BMOB 2C4BA 3DY5A 5IIZA 1B4QA 4G9HA 1LOWA 3KTLA 5KN2A 1MD4A 3GZYB 3F14A 4KA0A 1S5AA 2P31A 5EQLA 1IYHA 2H70A 3U1WA 2CA8A 4XIHA 3GKXA 4G1MB 4I6XA 2CC3A 3DMLA 1AQXA 4IN0A 4V2NA 3ZG0A 3DM8A 3SOYA 4AGSA 4GTUA 4BVYB 2RM5A 5AEWB 4HM2B 1U3IA 5CRWA 3F7SA 5FT3A 3FCSB 4OFTA 2JSYA 2HZFA 1DETA 2NDOA 4JZQA 4KCAA 3RPNA 5EPFA 4HS1A 4N3VA 3WA2X 4HZBB 2CVDA 3V92A 3LYPA 2HZEB 4N0ZA 2YJ7A 4FH8A 1O7WB 4PGTA 4K6XA 4QQ7A 5DCGA 5A0OB 3KCMA 2MZCA 2DJ0A 4O5UA 3D79A 2IUKA 3QAWA 1X1WA 3SEDA 1DMQA 1QK8A 3BD2A 3DVXA 1FW7A 1ZYPA 2CVBA 2VOCA 1W2B2 4Z7XA 3KZQA 2QC7A 8RNTA 4FYBA 1NW2A 1ST9A 2IMDA 1LQGC 1GTAA 4K7NA 1GY7A 2IUJA 1T5YA 20GSA 5A4VA 17GSA 5IPGA 3EINA 1PN9A 1X5DA 3WODG 2C0DA 3IAM2 1MDKA 1XZOA 3DVWA 3GZRA 2V2GA 3LFLA 4ORLA 1EV9A 4O92A 1G02A 5DDLA 1NHYA 1ZS7A 1M1XB 2KF6A 5IMDA 3ZFZA 1QXHA 1GSSA 1WIKA 3WOEB 3BCKA 3RPPA 4R80A 1EGRA 2CVKA 4O3VA 3FG3A 1JB2A 2BMRB 5IMFA 1Q864 3AMOB 1QUWA 4L8EA 5ELUA 3EVIA 3RAZA 4HM1B 3R3EA 3DD3A 4L5OA 1F37A 3W8SA 4OUQA 3VSYA 4XHMA 3MAKA 1T1VA 1VF4A 5AI1A 1M2DA 4XBTA 4MA9A 1ZYQB 1TIJA 1M99A 1Q7Y4 2NBSA 1UCJA 1BRGA 1XOAA 3I69A 2RNTA 3CCR3 4PUFC 4LA1A 1GD4A 22GSA 1TK0B 1GY5A 1T2IA 1YVBI 1YI23 3SLUA 5BIRA 1EEMA 2H74A 1CYUA 4AEQA 1YIT3 1VQK3 1WQLB 2B1KA 2FY6A 2CFGA 4V1Ap 3TRPA 3UJ1A 3L9SA 5LD0A 2W04A 5EVOA 4HM0B 1SJIA 5CO3A 1B48A 3KJYA 4EO3A 5FW5A 4HM3B 1ERTA 2P0GA 3MIXA 5E4WA 4EW5A 2R0GA 2I9HA 4R1KA 1RJOA 5COHA 5AYSC 3A2XA 3FZAA 4FMDA 1H4OA 1V98A 1IV7A 1GSPA 3JUNA 3B4PA 2KF4A 4IKHA 4DSSA 1YF1A 4V2MA 4IELA 7GSPA 1TRVA 5AISA 1V74A 3F3QA 1X5EA 2OKAA 4HJ2A 5H5RA 1VQP3 1M3JA 3WYWA 2MBTA 3FYGA 1K41A 3B4OA 3GX0A 1PX6A 1XBSA 4CDOA 2K8SA 3T8NA 1ROVA 3LH4A 2BIRA 4GWRA 2K6VA 4ZILA 4HBRA 5IERA 3ZTLA 4GSSA 3LQ7A 3NV0B 1IK3A 1YGWA 3HYPA 2H01A 2R37A 4PX1A 4RBNA 1IQYA 5IPHA 3IJEB 4WBRD 4NHZA 2NTOA 1LOXA 4L7KA 4HKVB 1DE3A 1HU9A 2XBQA 3IK9A 4MEIA 2GZYA 4RQXA 2DJ2A 1SENA 1K0CA 2L4CA 3FMWA 1SQWA 4MZCA 1JZWA 4POMA 4CW9A 3GN3A 3F8XA 3FR3A 1DE2A 5ECKB 3GTUB 3TJKA 4KDYA 3CMA3 1T4YA 2XF3A 2BT3A 3IK7A 3EBYA 1GSEA 4WP5A 2RGQA 2DBCA 1MOLA 1WWJA 2W03A 2HT9A 3MDKA 3URPA 2F51A 1X1YA 2DKIA 2R41A 1GY6A 3VF1A 1WOUA 3CC73 1TRUA 2BNGA 2FGTA 1HNAA 4KNDA 2K3DA 5F05A 2CFDA 4NWYA 3OV4A 4TX4A 4IVFA 4LL1B 4XDWA 3FZ5A 4K2DA 3HXSA 2LJAA 1V40A 1O85A 3OWYA 1R7HA 4WKWA 3S5CA 4NPBA 2M7OA 4AKYA 1T4ZA 4NV2A 4K5RA 5CYYA 1CEWI 3N9JA 3GL3A 2KP2A 1A8LA 3F9UA 4TR4A 1SJZA 3ZMKA 3EB8A 1V57A 2C80A 1VF1A 3HIGA 3ZVJD 1I0XA 1V58A 2F8FA 1BSDA 3GMFA 4MJEA 4EVMA 2PGTA 2OQEC 2LNSA 1B2ZA 5B8BA 1VQ53 2XR8B 4I4KA 1SD9A 2H6ZA 2YV7A 3CPOA 1THXA 1K3LA 5AIFA 3V98A 2YX9A 1GLPA 1MDJA 1OF5B 4MP4A 1A0RP 1E3RA 1W6GA 2HSYA 2H0GA 2YZHA 2F98A 2JQ5A 4PQIA 4WWUC 4U13A 3EE2A 4HM4B 4K5SA 1F8NA 3DH2A 2UUGC 3LTAA 1HZ1A 4IIAA 3DKSA 4PUAA 4JRFA 1D6YA 1O8XA 3UAPA 1Q9EA 5C04A 1AAZA 4DEJA 2QIYA 1JKGB 3QMXA 3UL5A 1TK5B 3MWZA 5JWOB 4X2OA 1JBRA 3X3ZA 1JB5A 4KAEA 1OHOA 4HJLB 3VWWA 4ZBAA 3TJBA 1N5HA 1M7TA
chains in the Genus database with same CATH topology
4DSRA 4ZXGA 2A2SA 2YWOA 2R6KA 1YZXA 4DSQA 1XW9A 2C0EA 1XCCA 3CMIA 2H1DA 2KHPA 3IOSA 3KH9A 3KM6A 3C73A 5IO2A 1XW6A 1VRSD 2LJKA 3KMNA 3FZ4A 4NMUA 3M3MA 4TKYA 1GL8A 2YZUA 2B5EA 1ERWA 4ISDA 4ACSA 3I9V2 3IHGA 2EIQA 3KEBA 3RHCA 2ZUPA 2YPMA 5ECLB 3HHVA 3FRCA 1PKWA 2B5YA 3C7MA 1OC9B 4X4JA 1B4PA 4AJ6A 5J9BA 3GNJA 1SU9A 4XCSA 4KB3A 2O8VB 3P8WA 1N2AA 4JEDA 4ML6A 1XVQA 3MSZA 4QL7A 2MMZA 3IRAA 3Q6OA 4POLA 1EOGA 3GV1A 2VM2A 4BL7A 4AJ7A 3EMPA 4Q5QA 3VURA 5CAXA 5GZZB 1MEKA 4BVXA 4K9ZA 1BYEA 2LJRA 4Z2TA 3L9UA 2X64A 5D9WA 2IJYA 2QA1A 1BQ7A 3C71A 2PWJA 5LNKe 4HU9A 2F3MA 2JZSA 2CX3A 3W8JA 3LWAA 2DIYA 3GURA 2ES7A 2VM1A 2B3SA 4K7OA 4O5RA 2VCZA 2OE0A 1OE7A 1FVKA 4BPYA 1M2BA 3V1WA 3TRQA 1MTCA 4EDZA 2GQMA 3MYDA 3VK9A 2MMNA 3HY2A 5AIXA 5B8AA 2DKHA 1HD2A 3APOA 1U3AA 4PNGA 3F4RA 4AF2A 3MNGA 3QD9A 4ID0A 3CSJA 1BEDA 3GH9A 1TOFA 3O6TA 4MJBA 4X43A 3GA4A 2FLSA 1RQMA 5IOWA 1SKSB 4G19A 3LXTA 4BVXB 2FWHA 4POBA 2LRTA 4TOPA 1SD8A 1R26A 3D4TA 3KP9A 1ACVA 3KP8A 4EKZA 4IQ1A 1PL1A 3APSA 2LQOA 2VD1A 1URMA 1K3YA 1E6BA 2V41A 2GTUA 1ZYNA 3RDWA 2MMAA 4WR4A 4OWYA 1FOHA 4EUYA 1TTZA 4IP6A 2IIYA 5D9VA 4GSTA 4BWSA 3E0UA 1R5AA 4A5PA 3QAVA 1WP0A 1T8EB 4IGJA 4N11A 6GSSA 2GGTA 1KBNA 1ON4A 1K0OA 2GZZA 1K0DA 3HKRA 4ZL9A 2LRNA 2CV4A 2DSAA 2O87A 3D6IA 4G0KA 2I4AA 5IMVA 3GX8A 3CYNA 2WS2A 5G1KA 5JCGA 3HJPA 1X0RA 4TR0A 2PBJA 4F0BA 1TKDB 3FR9A 3F3RA 1XWBA 2FWGA 4YAVA 2JSZA 4PURA 3M1GA 3O76A 1SKRB 4EDYA 1HQOA 4AJ8A 4LLRA 3J7Yb 1I9DA 5HFGA 4TXOB 4K1FA 4WEYA 1DSBA 2EIRA 3VI5A 5G30A 4ECCA 2VL9A 3F4SA 4JBBA 2RUFA 3CTFA 2XHFA 4HOJA 6GSVA 1WJKA 2HRFA 1OYJA 2VLTA 3EC3A 1ABAA 5J41A 3G7IA 5L71A 2VLUA 4GLTA 1T3BA 2IFQA 2FWFA 2R4VA 1O73A 2JZRA 3AY8A 1Z9HA 5DQYA 4ILFA 2C4JA 3LG6A 4MH2A 2TRXA 5J4UA 1AQVA 4NV5A 1VGLA 3KH7A 2VCQA 5KEJA 3LYKA 2DLXA 4J57E 3EYTA 2IL3A 1LJRA 1GUMA 1PRXA 4ML1A 3UIWA 4O5QA 2IYJA 1O7UA 5ELAA 1XVWA 3K8NA 2YP6A 5DALB 1JLWA 1A2LA 5AIVA 2IMKA 5ABRA 3IDVA 4JU5A 5IO0A 1W4VA 5J9CA 4EL1A 2L4QA 4WR5A 3WGXA 4I2UA 1QMVA 3L9VA 4EXJA 3HA9A 4GSNA 3LXZA 1FB6A 1FW1A 3H1NA 3Q74A 1YJ6A 2RLIA 3VI7A 4WXTA 2X49A 9GSSA 1A8YA 1PQNA 1GSUA 2D2ZA 2HLSA 2VIMA 3DIEA 3F6DA 4ZL7A 1WMJA 1OC8A 5ECSA 4JR4A 3ZMLA 4I2TA 5DJMA 2MBSA 2H8LA 1Y25A 1XW5A 4RUVA 1OKDA 1EOHA 2WULA 1FHEA 3G9BA 3ERWA 1RW1A 4OD7A 3WT2A 2A4VA 1YQ1A 1X9WB 3DRNA 1GH2A 5ECNB 2HE3A 4EF0A 3NZNA 2P5RA 5D93A 6GSTA 4XS1A 4YAPA 2DMMA 3G7YA 5CP1A 2HSMA 1BG5A 1DUGA 2R0CA 3GTUA 1JLVA 2PU9C 3QAGA 7GSSA 3TDGA 1LU4A 1GTUA 3M0FA 4GQFA 1TI3A 19GSA 3F4TA 3N5OA 5B7CA 3CSIA 2R2JA 4EE0A 1K0MA 4EIQA 2JZTA 3TUEA 1GNEA 1JZOA 1AIUA 4LMWA 3IA1A 1U6TA 2OACA 3RBTA 1M0UA 2L57A 2REMA 4GRFA 3GSSA 1J9BA 2GVPA 1YEPA 1ILOA 1G6YA 2B1LA 2RIIA 5KOWA 3TKPA 2PERA 4F2IA 2M72A 2CX4A 2MYGA 3F0IA 2C0FA 3RHBA 4PNFA 1F3AA 3TKQA 1G0TA 2JU5A 2VD0A 4G2EA 1CQHA 3H8QA 3D0ZA 4V1Ag 4MMMA 3PR8A 1SK1A 1F9MA 5H5QA 1OC3A 4I97A 5CNWA 2B6MA 2K18A 2CZ2A 2GSSA 4WBJA 5J5NA 3L0HA 4V2LA 4ECJA 1Z5YE 4JE1A 2FWEA 4MH3A 3KMOA 5IMCA 3LSZA 1Y6EA 5B6NA 4XRAA 4KX4A 2PPTA 4GF0A 4WETA 2PVQA 4IHUA 3WT1A 2H66A 5G31A 3P90A 3HZ8A 4WF5A 1SYRA 3SWLA 2DIZA 5IM9A 5D9TA 5GAND 1J08A 3FZ9A 5CREA 1SYXA 3TGZA 2KOKA 4HI7A 1X9SB 4NXIA 4ZBDA 1A24A 4POKA 1GTBA 1AQWA 5LCZA 1KEBA 3QFAC 2FUG2 1OC9A 2YANA 2DJKA 2OE3A 5F8BA 4GCIA 2O7KA 2KP1A 3IE3A 2NVLA 1AXDA 3C1RA 3J7Yk 4GQCA 3UVHA 4KF9A 2B5XA 2HZEA 3UBKA 1OKTA 2HYXA 1F2EA 1OE8A 2JADA 4MPGA 4J2FA 1K3OA 2K9FA 2QGVA 2UZ8A 2FA8A 4FYCA 3ZLPA 5DCHA 3BJ5A 1NHOA 1JFUA 1TU8A 5DBQA 4N30A 2XC2A 2DJ3A 3IAS2 4USSA 5IMZA 2EIOA 2KUCA 3GKMA 5G2ZA 2HFDA 5FHIA 2GZPA 4ECBA 2I1UA 2H0HA 4Z2RA 5DVBA 1SL1B 3P2AA 4Z2UA 3P7XA 3TKSA 5E59A 5ID2A 5CRGA 2P5QA 3L4NA 5GSSA 4JR6A 5ID2B 1EP7A 4KW6A 1EV4A 3CSHA 3KTBA 2VL2C 3GKNA 3HVVA 2YWIA 12GSA 2IWTA 4O7HA 1QFNA 4KDXA 2HNLA 2FA4A 4N10A 1ZOFA 5JWRB 1PSQA 5D8IA 6GSXA 4X1UA 1VF2A 4HUAA 4G10A 4KCEA 2H30A 2LNTA 4EIPA 2YNXA 2YJHA 4MZBA 1R5PA 5D96A 1FVJA 2G2QA 5D73A 3ERGA 1Z3EA 3EU3A 5EY6A 3PH9A 2H6YA 4K8MA 4MF7A 2CQ9A 5AN1A 1UVZA 2YWMA 5KN1A 1S3DA 1GSYA 2F8AA 3QCPA 4TR1A 5HFIA 5HQPA 3U5RE 4YKFA 4PQ1A 1NSWA 3GSTA 3QOUA 2WGRA 4IJ3A 3ZFBA 5A4UA 4F82A 3ZITA 1UN2A 4G0IA 3IV4A 4MDCA 1TU7A 4XS4B 2LEGA 3C1SA 2VUPA 3CTGA 4IP1A 4L0WA 2VLVA 1T7PB 3D4MA 3GYKA 2C0GA 4KH7A 1GWCA 2H71A 2MMOA 1TRWA 2E2MA 2N5AA 3ED3A 1XIYA 4KGIA 5CRHA 3OR5A 4K0GA 3C8EA 2IMEA 2AUVA 16GSA 3PGTA 3QFBC 1ZCPA 3H93A 1FO5A 2V32A 1RK4A 3KGKA 3I6AA 3TKRA 2YCDA 5GSTA 2OBIA 2AV4A 1Z7PA 4GXZA 3A2WA 2IN3A 4JRRA 1U87A 2HRAA 3ZIJA 1NM3A 1TI1A 2O85A 2G0FA 1ERVA 2VCTA 4OMVA 1HYUA 5KN0A 3DEXA 3NIVA 2V6KA 3DXBA 5ECQB 4ZB8A 2R5GA 1BAYA 4D73B 2ON7A 3WGDA 4D73A 2X8HA 4Q5NA 3GL5A 4PTSA 2I81A 3ZZXA 2M46A 4PXOA 1LBKA 3NOFA 1F3BA 1T00A 3HJMA 3VPQA 3TKSE 4RQRA 1JZRA 2H75A 2GT5A 4HQZA 4KSMA 10GSA 4FYUA 4MF6A 1XWKA 2WRTA 3TJGA 3VPTA 4F9ZA 4OO5A 2GSTA 2ON5A 4TXVA 3HCZA 1J0FA 3EPTA 2C3QA 2R0PA 3UBLA 2CAQA 4FQUA 1I5GA 3IBHA 3VWVA 1GTIA 3LW9A 4ZL8A 1CQGA 2LQQA 3DWVA 4HQSA 2FNOA 3KIJA 3EMXA 4HDEA 5F0GA 1PGTA 2OBKA 1GSDA 1BX9A 1YF0A 1ML6A 2YN1A 3ZVJA 1VF3A 3D5JA 4MLYA 3VLNA 1X5CA 2VO4A 3VWXA 3ZL5A 1SKWB 1QGVA 4OCEA 3G7JA 3MWHA 2FCHA 3HDCA 2R3XA 3ZIVA 1WPIA 4TN8A 1EEJA 3L78A 6GSYA 3IR4A 2WB9A 3A2VA 4F03A 1A23A 2EC4A 4HZ2A 2N5BA 4IJIA 2OA7A 1GNWA 2HSHA 2BJXA 2C1YA 2HRNA 5ECOB 2E2GA 2HRKA 5CRDA 2WCIA 5EL8A 2O89A 5HR3A 2VCVA 4YQMA 3A5WA 2X4AA 2B7KA 3FHKA 2VCWA 1R4WA 4TVEA 5C00A 5JWQB 1MD3A 5DALA 3FEUA 2CT6A 4BA7A 2J23A 1PMTA 2AHEA 1FAAA 2IMFA 2V1MA 3F8UA 5HR1A 1K0NA 4NAXA 2I3YA 3E3EA 1B8XA 2PVOC 4YQUA 2H76A 1TDIA 3HVXA 1K0BA 2HI7A 4MJAA 1USBA 3DYRA 2KLXA 2GSRA 5ELGA 5BRTA 1HNCA 1U88A 1WRYA 3VFIA 4MK3A 1YY7A 3IHQA 4FO5A 1Q98A 1S3CA 1FB0A 18GSA 1SL0B 2PN8A 4N0VA 2L6DA 3ZRDA 4CY6A 2FD3A 1V2AA 3M8NA 3W6GA 2C8UA 3E9JB 3U6VA 5ECRB 2GS3A 4XS4A 4MABA 2RUEA 1MDIA 2VL2A 2BMXA 3QDNA 4MCUA 4MF5A 2WDUA 3ZFLA 4G0LA 1YEXA 4FIWA 2H1GA 1THOA 1GRXA 1EP8A 2GLRA 4L5LA 1H75A 3KD0A 4IS0A 3ERFA 5HR0A 3UMAA 3ZREA 1B9YC 2L5OA 4ZIJA 2E0QA 3CXGA 1EZKA 2OADA 1KTEA 3GKKA 2A4HA 3LJRA 3A5IA 1X9MB 1SK2A 2WJUA 3TRXA 2TRCP 4OFNA 2GQKA 2H19A 3TJFA 4HZ4A 1XWCA 5A4WA 1PA3A 2RM6A 2GDRA 5G1LA 1PL2A 4I8BA 1S3AA 2C3NA 3GHAA 5F07A 4WF4A 1ZZYA 3IPZA 4HEA2 4YQVA 5IOXA 4I5QA 2HXKA 2LUSA 4Q5RA 2E7PA 4PQHA 4TXOA 3FR6A 3EURA 2YWNA 2BTOT 1IYIA 2CZ3A 1K0AA 4XTSA 4XRDA 4F0CA 1TP9A 2H6XA 3SBCA 1F6MC 1E2YA 2YV9A 4OCFA 1WE0A 4YH2A 1PN0A 4TR3A 3TOUA 4O32A 4TRXA 2CAIA 3F6FA 1GSQA 2FHEA 3BOAA 3QR6A 1FOVA 1O6JA 2H72A 1N8JA 2GT6A 5BMUA 3H4KA 2QA2A 3H79A 1AW9A 2AYTA 5IQYA 2AJQB 1G7OA 1UC7A 3ISOA 3HZ4A 2LTKA 4OO4A 2YOIA 3TCOA 1O81A 2H1BA 2DJ1A 4ZB9A 4L0UA 4MNNA 2B7JA 3HVSA 2X8CA 1TXXA 2X99A 2A2RA 1GLQA 1Z7RA 4DSSB 3I43A 1XWAA 1XPVA 2OJLA 3ZYWA 5ECHB 1GP1A 5DAKA 3TKSC 2M80A 5ENUA 3GUSA 14GSA 1JHBA 1FG4A 2AAWA 3FW2A 4MJCA 1C72A 2GQLA 4IBPA 5G5EA 4E8EA 4BL7B 3IC8A 1KNGA 3DGQA 4CY8A 1ZYEA 3UARA 2OE1A 4MZWA 4CHSA 2V6OA 5F06A 2PUKC 1O8WA 1XXUA 2VL3A 3S9FA 1OVNA 4DVCA 3WGEA 2LV3A 3CRUA 3FK8A 5A5KA 2IMIA 5ECPB 1M9BA 2QKEA 5JCWA 3EWLA 2VCXA 5J3RA 3UEMA 3M9JA 3A3TA 4HU7A 5KOXA 4Q5FA 5JCUA 3TOTA 4KDUA 13GSA 1HNBA 4ZBBA 1ZL9A 4OFMA 1TJDA 4TR1B 1GSFA 4K7IA 2XBIA 1TRSA 2L59A 3D21A 1XWGA 4MPFA 4IW9A 5D9XA 4RI7A 2IPAA 2TIRA 1AC1A 3BBYA 5ECMB 2ALBA 2IY2A 3F63A 4ICYA 2PMTA 5DQSA 3UOMA 4BWQA 1QQ2A 2DC5A 11GSA 1TK8B 3GIXA 3Q19A 1YKAA 1PX7A 1V9WA 4J56E 2GSQA 1XOBA 1M2AA 4ULXA 4QL9A 2VAFA 4XS6A 4LL4B 2FGXA 2XPEA 4EC0A 1ZMAA 2Z9SA 2J9HA 5HR2A 1AUCA 1W89A 3PINA 3FKFA 2WFCA 1Q4JA 5INYA 2XPDA 4YKGA 2C3TA 1TW9A 5AGYA 2X8GA 3PPUA 5IMAA 3LGCA 2DMLA 2LS5A 3UVTA 1PD21 1G7EA 3WD6A 2H1AA 1ZGNA 4K0NA 3CBUA 4ZB6A 1BJXA 2LKUA 2N5FA 3KXOA 1ERUA 2LSTA 3APQA 3QPMA 4ECIA 1PKZA 1A2JA 5ECIB 1GUHA 2JACA 2AB6A 4E8HA 1YKCA 3R2QA 3VWUA 3FY7A 1SL2B 1SK0A 3CRTA 1EGOA 2JL4A 4X0XA 3JCML 4K2XA 1G6WA 3LORA 5DJLA 4KSOA 2WZ9A 1Z6NA 1B9XC 1SJ6A 5FWGA 1OAZA 1GULA 5HFKA 3UL3A 2ZNMA 5H5SA 1JZDA 4IQAA 2F9SA 1M9AA 4P3YB 4RI6A 5DAKB 2K8VA 3HD5A 6GSWA 8GSSA 2A2PA 3O3TA 3GH6A 4KE3A 1A0FA 3TJJA 4TW5A 3US3A 2DJJA 2ZCTA 3D22A 3TB2A 2LRCA 4H86A 4LMVA 2NPBA 3HJOA 1A2MA 5KN3A 4NHWA 4BVYA 3GFKA 4KUNA 2QSIA 3GRXA 1GUKA 3BCIA 6GSUA 3EU4A 2H73A 3IXRA 1UA5A 5B6MA 1YDKA 1Z6MA 1DBYA 2L6CA 3LEFA 2L5LA 3ME7A 2H0IA 3Q18A 3M9KA 1EWXA 1DE1A 3IC4A 1XFLA 2IFQB 5G5FA 5GAPD 3ME8A 4HJMA 5IIZA 1B4QA 4G9HA 3KTLA 5KN2A 1MD4A 4KA0A 2P31A 1IYHA 2H70A 2CA8A 4XIHA 3GKXA 4I6XA 3DMLA 1AQXA 4IN0A 4V2NA 4AGSA 4GTUA 4BVYB 2RM5A 1U3IA 5CRWA 5FT3A 4OFTA 2JSYA 2HZFA 2NDOA 4JZQA 4KCAA 3RPNA 5EPFA 4HS1A 2CVDA 3LYPA 2HZEB 4N0ZA 2YJ7A 4FH8A 4PGTA 4K6XA 4QQ7A 5DCGA 3KCMA 2MZCA 2DJ0A 4O5UA 3QAWA 1QK8A 3BD2A 3DVXA 2CVBA 1ZYPA 2VOCA 4Z7XA 3KZQA 2QC7A 4FYBA 1NW2A 1ST9A 2IMDA 1GTAA 4K7NA 20GSA 5A4VA 17GSA 5IPGA 3EINA 1PN9A 1X5DA 2C0DA 3IAM2 1MDKA 1XZOA 3DVWA 2V2GA 3LFLA 1EV9A 4O92A 5DDLA 1NHYA 5IMDA 1GSSA 1QXHA 1WIKA 3BCKA 3RPPA 1EGRA 2CVKA 5IMFA 1QUWA 4L8EA 3EVIA 3RAZA 3R3EA 3DD3A 4L5OA 1F37A 3W8SA 4XHMA 3MAKA 1T1VA 1VF4A 1M2DA 4MA9A 1ZYQB 1M99A 2NBSA 1XOAA 3I69A 4PUFC 4LA1A 22GSA 1TK0B 2H74A 1EEMA 2FY6A 2B1KA 4V1Ap 3TRPA 3UJ1A 3L9SA 5LD0A 5EVOA 1SJIA 5CO3A 1B48A 3KJYA 4EO3A 1ERTA 2P0GA 3MIXA 5E4WA 2R0GA 2I9HA 5COHA 3A2XA 3FZAA 1H4OA 1V98A 4IKHA 4DSSA 1YF1A 4V2MA 4IELA 1TRVA 5AISA 3F3QA 1X5EA 2OKAA 4HJ2A 5H5RA 3WYWA 2MBTA 3FYGA 3GX0A 1PX6A 1XBSA 4CDOA 2K8SA 4GWRA 4ZILA 2K6VA 3ZTLA 4GSSA 3LQ7A 3HYPA 2H01A 2R37A 4PX1A 5IPHA 4WBRD 4NHZA 2NTOA 2XBQA 3IK9A 2GZYA 4RQXA 2DJ2A 1SENA 1K0CA 2L4CA 3FMWA 4CW9A 4MZCA 4POMA 1JZWA 3GN3A 3FR3A 1DE2A 5ECKB 3GTUB 3TJKA 4KDYA 1T4YA 3IK7A 1GSEA 2DBCA 1WWJA 2HT9A 3MDKA 2F51A 2DKIA 1WOUA 1TRUA 1HNAA 4KNDA 5F05A 4NWYA 4IVFA 4LL1B 3FZ5A 4K2DA 3HXSA 2LJAA 1V40A 1O85A 1R7HA 4WKWA 4NPBA 4NV2A 1T4ZA 4K5RA 5CYYA 3N9JA 3GL3A 2KP2A 1A8LA 3F9UA 4TR4A 1SJZA 3ZMKA 1V57A 2C80A 1VF1A 3ZVJD 1V58A 2F8FA 3GMFA 4MJEA 4EVMA 2PGTA 2LNSA 5B8BA 1SD9A 2H6ZA 2YV7A 1THXA 1K3LA 1GLPA 1MDJA 4MP4A 1A0RP 2HSYA 2H0GA 2YZHA 4PQIA 3EE2A 4K5SA 3DKSA 4PUAA 1O8XA 3UAPA 5C04A 1AAZA 4DEJA 3QMXA 1TK5B 5JWOB 4KAEA 3VWWA 4ZBAA 3TJBA 1M7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSR A;  4ZXG A;  2A2S A;  2YWO A;  2R6K A;  1YZX A;  4DSQ A;  1XW9 A;  2C0E A;  1XCC A;  3CMI A;  2H1D A;  2KHP A;  3IOS A;  3KH9 A;  3KM6 A;  3C73 A;  5IO2 A;  1XW6 A;  1VRS D;  2LJK A;  3KMN A;  3FZ4 A;  4NMU A;  3M3M A;  4TKY A;  1GL8 A;  2YZU A;  2B5E A;  1ERW A;  4ISD A;  4ACS A;  3I9V 2;  2EIQ A;  3KEB A;  3RHC A;  2ZUP A;  2YPM A;  5ECL B;  3HHV A;  3FRC A;  1PKW A;  2B5Y A;  3C7M A;  1OC9 B;  1B4P A;  4AJ6 A;  5J9B A;  3GNJ A;  1SU9 A;  4XCS A;  4KB3 A;  2O8V B;  3P8W A;  1N2A A;  4JED A;  4ML6 A;  1XVQ A;  3MSZ A;  4QL7 A;  2MMZ A;  3IRA A;  3Q6O A;  4POL A;  1EOG A;  3GV1 A;  2VM2 A;  4BL7 A;  4AJ7 A;  3EMP A;  4Q5Q A;  3VUR A;  5CAX A;  5GZZ B;  1MEK A;  4BVX A;  4K9Z A;  1BYE A;  2LJR A;  3L9U A;  2X64 A;  5D9W A;  2IJY A;  1BQ7 A;  3C71 A;  2PWJ A;  5LNK e;  4HU9 A;  2F3M A;  2JZS A;  2CX3 A;  3W8J A;  3LWA A;  2DIY A;  3GUR A;  2ES7 A;  2VM1 A;  2B3S A;  4K7O A;  4O5R A;  2VCZ A;  2OE0 A;  1OE7 A;  1FVK A;  4BPY A;  1M2B A;  3V1W A;  3TRQ A;  1MTC A;  4EDZ A;  2GQM A;  3VK9 A;  2MMN A;  3HY2 A;  5AIX A;  5B8A A;  1HD2 A;  3APO A;  1U3A A;  4PNG A;  3F4R A;  4AF2 A;  3MNG A;  3QD9 A;  4ID0 A;  3CSJ A;  1BED A;  3GH9 A;  1TOF A;  3O6T A;  4MJB A;  4X43 A;  3GA4 A;  2FLS A;  1RQM A;  5IOW A;  1SKS B;  4G19 A;  3LXT A;  2FWH A;  4POB A;  2LRT A;  4TOP A;  1SD8 A;  1R26 A;  3D4T A;  3KP9 A;  1ACV A;  3KP8 A;  4EKZ A;  4IQ1 A;  1PL1 A;  3APS A;  2LQO A;  2VD1 A;  1URM A;  1K3Y A;  1E6B A;  2V41 A;  2GTU A;  3RDW A;  2MMA A;  4WR4 A;  4OWY A;  4EUY A;  1TTZ A;  4IP6 A;  2IIY A;  5D9V A;  4GST A;  4BWS A;  3E0U A;  1R5A A;  3QAV A;  1WP0 A;  1T8E B;  4IGJ A;  4N11 A;  6GSS A;  2GGT A;  1KBN A;  1ON4 A;  1K0O A;  2GZZ A;  1K0D A;  3HKR A;  4ZL9 A;  2LRN A;  2CV4 A;  2DSA A;  2O87 A;  3D6I A;  2I4A A;  5IMV A;  3GX8 A;  3CYN A;  2WS2 A;  5G1K A;  5JCG A;  3HJP A;  1X0R A;  4TR0 A;  2PBJ A;  4F0B A;  1TKD B;  3FR9 A;  3F3R A;  1XWB A;  2FWG A;  4YAV A;  2JSZ A;  4PUR A;  3M1G A;  3O76 A;  1SKR B;  4EDY A;  1HQO A;  4AJ8 A;  4LLR A;  3J7Y b;  1I9D A;  5HFG A;  4TXO B;  4K1F A;  4WEY A;  1DSB A;  2EIR A;  3VI5 A;  5G30 A;  4ECC A;  2VL9 A;  3F4S A;  4JBB A;  2RUF A;  3CTF A;  2XHF A;  4HOJ A;  6GSV A;  1WJK A;  2HRF A;  1OYJ A;  2VLT A;  3EC3 A;  1ABA A;  5J41 A;  3G7I A;  5L71 A;  2VLU A;  4GLT A;  1T3B A;  2IFQ A;  2FWF A;  2R4V A;  1O73 A;  2JZR A;  3AY8 A;  1Z9H A;  5DQY A;  4ILF A;  2C4J A;  3LG6 A;  4MH2 A;  2TRX A;  5J4U A;  1AQV A;  4NV5 A;  1VGL A;  3KH7 A;  2VCQ A;  5KEJ A;  3LYK A;  2DLX A;  4J57 E;  3EYT A;  2IL3 A;  1LJR A;  1GUM A;  1PRX A;  4ML1 A;  3UIW A;  2IYJ A;  1O7U A;  5ELA A;  1XVW A;  3K8N A;  2YP6 A;  5DAL B;  1JLW A;  1A2L A;  5AIV A;  2IMK A;  5ABR A;  3IDV A;  4JU5 A;  5IO0 A;  1W4V A;  5J9C A;  4EL1 A;  2L4Q A;  4WR5 A;  3WGX A;  4I2U A;  1QMV A;  3L9V A;  4EXJ A;  3HA9 A;  4GSN A;  3LXZ A;  1FB6 A;  1FW1 A;  3H1N A;  3Q74 A;  1YJ6 A;  2RLI A;  3VI7 A;  4WXT A;  9GSS A;  1A8Y A;  1PQN A;  1GSU A;  2D2Z A;  2HLS A;  2VIM A;  3DIE A;  3F6D A;  4ZL7 A;  1WMJ A;  1OC8 A;  5ECS A;  3ZML A;  4JR4 A;  4I2T A;  5DJM A;  2MBS A;  2H8L A;  1Y25 A;  1XW5 A;  4RUV A;  1OKD A;  1EOH A;  2WUL A;  1FHE A;  3G9B A;  3ERW A;  1RW1 A;  4OD7 A;  3WT2 A;  2A4V A;  1YQ1 A;  1X9W B;  3DRN A;  1GH2 A;  5ECN B;  2HE3 A;  4EF0 A;  3NZN A;  2P5R A;  5D93 A;  6GST A;  4XS1 A;  4YAP A;  2DMM A;  3G7Y A;  5CP1 A;  1BG5 A;  1DUG A;  3GTU A;  1JLV A;  2PU9 C;  3QAG A;  7GSS A;  3TDG A;  1LU4 A;  1GTU A;  3M0F A;  4GQF A;  1TI3 A;  19GS A;  3F4T A;  3N5O A;  5B7C A;  3CSI A;  2R2J A;  4EE0 A;  1K0M A;  2JZT A;  3TUE A;  1GNE A;  1JZO A;  1AIU A;  4LMW A;  3IA1 A;  1U6T A;  2OAC A;  3RBT A;  1M0U A;  2L57 A;  2REM A;  4GRF A;  3GSS A;  1J9B A;  2GVP A;  1YEP A;  1ILO A;  1G6Y A;  2B1L A;  2RII A;  3TKP A;  2PER A;  4F2I A;  2M72 A;  2CX4 A;  2MYG A;  3F0I A;  2C0F A;  3RHB A;  4PNF A;  1F3A A;  3TKQ A;  1G0T A;  2JU5 A;  2VD0 A;  4G2E A;  1CQH A;  3H8Q A;  3D0Z A;  4V1A g;  4MMM A;  3PR8 A;  1SK1 A;  1F9M A;  5H5Q A;  1OC3 A;  4I97 A;  5CNW A;  2B6M A;  2K18 A;  2CZ2 A;  2GSS A;  4WBJ A;  5J5N A;  3L0H A;  4V2L A;  4ECJ A;  1Z5Y E;  4JE1 A;  2FWE A;  4MH3 A;  3KMO A;  5IMC A;  3LSZ A;  1Y6E A;  5B6N A;  4XRA A;  4KX4 A;  2PPT A;  4GF0 A;  4WET A;  2PVQ A;  4IHU A;  3WT1 A;  2H66 A;  5G31 A;  3P90 A;  3HZ8 A;  4WF5 A;  1SYR A;  3SWL A;  2DIZ A;  5IM9 A;  5D9T A;  5GAN D;  1J08 A;  3FZ9 A;  5CRE A;  1SYX A;  3TGZ A;  2KOK A;  4HI7 A;  1X9S B;  4NXI A;  4ZBD A;  1A24 A;  4POK A;  1GTB A;  1AQW A;  5LCZ A;  1KEB A;  3QFA C;  2FUG 2;  1OC9 A;  2YAN A;  2DJK A;  2OE3 A;  5F8B A;  4GCI A;  2O7K A;  2KP1 A;  3IE3 A;  2NVL A;  1AXD A;  3C1R A;  3J7Y k;  4GQC A;  3UVH A;  2B5X A;  2HZE A;  3UBK A;  1OKT A;  2HYX A;  1F2E A;  1OE8 A;  2JAD A;  4MPG A;  4J2F A;  1K3O A;  2K9F A;  2QGV A;  2FA8 A;  4FYC A;  3ZLP A;  5DCH A;  3BJ5 A;  1NHO A;  1JFU A;  1TU8 A;  5DBQ A;  4N30 A;  2XC2 A;  2DJ3 A;  3IAS 2;  5IMZ A;  2EIO A;  2KUC A;  3GKM A;  5G2Z A;  2HFD A;  5FHI A;  2GZP A;  4ECB A;  2I1U A;  2H0H A;  5DVB A;  1SL1 B;  3P2A A;  3P7X A;  3TKS A;  5E59 A;  5ID2 A;  5CRG A;  2P5Q A;  3L4N A;  5GSS A;  4JR6 A;  5ID2 B;  1EP7 A;  4KW6 A;  1EV4 A;  3CSH A;  3KTB A;  2VL2 C;  3GKN A;  3HVV A;  2YWI A;  12GS A;  2IWT A;  4O7H A;  1QFN A;  4KDX A;  2HNL A;  2FA4 A;  4N10 A;  1ZOF A;  5JWR B;  1PSQ A;  5D8I A;  6GSX A;  4X1U A;  1VF2 A;  4HUA A;  4G10 A;  4KCE A;  2H30 A;  2LNT A;  2YNX A;  2YJH A;  4MZB A;  1R5P A;  5D96 A;  1FVJ A;  2G2Q A;  5D73 A;  3ERG A;  1Z3E A;  3EU3 A;  5EY6 A;  3PH9 A;  2H6Y A;  4K8M A;  4MF7 A;  2CQ9 A;  5AN1 A;  1UVZ A;  2YWM A;  5KN1 A;  1S3D A;  1GSY A;  2F8A A;  3QCP A;  4TR1 A;  5HFI A;  5HQP A;  3U5R E;  4PQ1 A;  1NSW A;  3GST A;  3QOU A;  2WGR A;  4IJ3 A;  3ZFB A;  5A4U A;  4F82 A;  3ZIT A;  1UN2 A;  3IV4 A;  4MDC A;  1TU7 A;  4XS4 B;  2LEG A;  3C1S A;  2VUP A;  3CTG A;  4IP1 A;  4L0W A;  2VLV A;  1T7P B;  3D4M A;  3GYK A;  2C0G A;  4KH7 A;  1GWC A;  2H71 A;  2MMO A;  1TRW A;  2E2M A;  2N5A A;  3ED3 A;  1XIY A;  4KGI A;  5CRH A;  3OR5 A;  4K0G A;  3C8E A;  2IME A;  2AUV A;  16GS A;  3PGT A;  3QFB C;  1ZCP A;  3H93 A;  1FO5 A;  2V32 A;  1RK4 A;  3KGK A;  3I6A A;  3TKR A;  2YCD A;  5GST A;  2OBI A;  2AV4 A;  1Z7P A;  4GXZ A;  3A2W A;  2IN3 A;  4JRR A;  1U87 A;  3ZIJ A;  1NM3 A;  1TI1 A;  2O85 A;  2G0F A;  1ERV A;  2VCT A;  4OMV A;  1HYU A;  5KN0 A;  3DEX A;  3NIV A;  2V6K A;  3DXB A;  5ECQ B;  4ZB8 A;  2R5G A;  1BAY A;  4D73 B;  2ON7 A;  3WGD A;  4D73 A;  2X8H A;  4Q5N A;  3GL5 A;  3ZZX A;  2I81 A;  2M46 A;  4PXO A;  1LBK A;  3NOF A;  1F3B A;  1T00 A;  3HJM A;  3VPQ A;  3TKS E;  4RQR A;  1JZR A;  2H75 A;  2GT5 A;  4HQZ A;  4KSM A;  10GS A;  4FYU A;  4MF6 A;  1XWK A;  2WRT A;  3TJG A;  3VPT A;  4F9Z A;  4OO5 A;  2GST A;  2ON5 A;  4TXV A;  3HCZ A;  1J0F A;  2C3Q A;  3UBL A;  2CAQ A;  1I5G A;  3IBH A;  3VWV A;  1GTI A;  4ZL8 A;  1CQG A;  2LQQ A;  3DWV A;  4HQS A;  2FNO A;  3KIJ A;  3EMX A;  4HDE A;  5F0G A;  1PGT A;  2OBK A;  1GSD A;  1BX9 A;  1YF0 A;  1ML6 A;  2YN1 A;  3ZVJ A;  1VF3 A;  3VLN A;  3D5J A;  4MLY A;  1X5C A;  2VO4 A;  3VWX A;  3ZL5 A;  1SKW B;  1QGV A;  4OCE A;  3G7J A;  3MWH A;  2FCH A;  3HDC A;  2R3X A;  3ZIV A;  1WPI A;  4TN8 A;  1EEJ A;  3L78 A;  6GSY A;  3IR4 A;  2WB9 A;  3A2V A;  4F03 A;  1A23 A;  2EC4 A;  4HZ2 A;  2N5B A;  4IJI A;  2OA7 A;  1GNW A;  2HSH A;  2BJX A;  2C1Y A;  2HRN A;  5ECO B;  2E2G A;  5CRD A;  2WCI A;  5EL8 A;  2O89 A;  5HR3 A;  2VCV A;  4YQM A;  3A5W A;  2B7K A;  3FHK A;  2VCW A;  1R4W A;  4TVE A;  5C00 A;  5JWQ B;  1MD3 A;  5DAL A;  3FEU A;  2CT6 A;  4BA7 A;  2J23 A;  1PMT A;  2AHE A;  1FAA A;  2IMF A;  2V1M A;  3F8U A;  5HR1 A;  1K0N A;  4NAX A;  2I3Y A;  3E3E A;  1B8X A;  2PVO C;  4YQU A;  2H76 A;  1TDI A;  3HVX A;  1K0B A;  2HI7 A;  4MJA A;  1USB A;  3DYR A;  2KLX A;  2GSR A;  5ELG A;  1HNC A;  1U88 A;  1WRY A;  3VFI A;  4MK3 A;  1YY7 A;  3IHQ A;  4FO5 A;  1Q98 A;  1S3C A;  1FB0 A;  18GS A;  1SL0 B;  2PN8 A;  4N0V A;  2L6D A;  3ZRD A;  2FD3 A;  1V2A A;  3M8N A;  3W6G A;  2C8U A;  3E9J B;  3U6V A;  5ECR B;  2GS3 A;  4XS4 A;  4MAB A;  2RUE A;  1MDI A;  2VL2 A;  2BMX A;  3QDN A;  4MCU A;  4MF5 A;  2WDU A;  3ZFL A;  1YEX A;  4FIW A;  2H1G A;  1THO A;  1GRX A;  1EP8 A;  2GLR A;  4L5L A;  1H75 A;  3KD0 A;  4IS0 A;  3ERF A;  5HR0 A;  3UMA A;  3ZRE A;  1B9Y C;  2L5O A;  4ZIJ A;  2E0Q A;  3CXG A;  1EZK A;  2OAD A;  1KTE A;  3GKK A;  3LJR A;  1X9M B;  1SK2 A;  2WJU A;  3TRX A;  2TRC P;  4OFN A;  2GQK A;  2H19 A;  3TJF A;  4HZ4 A;  1XWC A;  5A4W A;  1PA3 A;  2RM6 A;  2GDR A;  5G1L A;  1PL2 A;  4I8B A;  1S3A A;  2C3N A;  3GHA A;  5F07 A;  4WF4 A;  1ZZY A;  3IPZ A;  4HEA 2;  4YQV A;  5IOX A;  4I5Q A;  2HXK A;  2LUS A;  4Q5R A;  2E7P A;  4PQH A;  4TXO A;  3FR6 A;  3EUR A;  2YWN A;  2BTO T;  1IYI A;  2CZ3 A;  1K0A A;  4XTS A;  4XRD A;  4F0C A;  1TP9 A;  2H6X A;  3SBC A;  1F6M C;  1E2Y A;  2YV9 A;  4OCF A;  1WE0 A;  4YH2 A;  4TR3 A;  3TOU A;  4O32 A;  4TRX A;  2CAI A;  3F6F A;  1GSQ A;  2FHE A;  3BOA A;  3QR6 A;  1FOV A;  1O6J A;  2H72 A;  1N8J A;  2GT6 A;  3H4K A;  3H79 A;  1AW9 A;  2AYT A;  5IQY A;  2AJQ B;  1G7O A;  1UC7 A;  3ISO A;  3HZ4 A;  2LTK A;  4OO4 A;  2YOI A;  3TCO A;  1O81 A;  2H1B A;  2DJ1 A;  4ZB9 A;  4L0U A;  2B7J A;  3HVS A;  2X8C A;  1TXX A;  2X99 A;  2A2R A;  1GLQ A;  1Z7R A;  4DSS B;  3I43 A;  1XWA A;  1XPV A;  2OJL A;  3ZYW A;  5ECH B;  1GP1 A;  5DAK A;  3TKS C;  2M80 A;  5ENU A;  3GUS A;  14GS A;  1JHB A;  1FG4 A;  2AAW A;  3FW2 A;  4MJC A;  1C72 A;  2GQL A;  4IBP A;  5G5E A;  4E8E A;  1KNG A;  3DGQ A;  1ZYE A;  3UAR A;  2OE1 A;  4MZW A;  4CHS A;  2V6O A;  5F06 A;  2PUK C;  1O8W A;  1XXU A;  2VL3 A;  3S9F A;  1OVN A;  4DVC A;  3WGE A;  2LV3 A;  3CRU A;  3FK8 A;  5A5K A;  2IMI A;  5ECP B;  1M9B A;  2QKE A;  5JCW A;  3EWL A;  2VCX A;  5J3R A;  3UEM A;  3M9J A;  3A3T A;  4HU7 A;  4Q5F A;  5JCU A;  3TOT A;  4KDU A;  13GS A;  1HNB A;  4ZBB A;  1ZL9 A;  4OFM A;  1TJD A;  4TR1 B;  1GSF A;  4K7I A;  2XBI A;  1TRS A;  2L59 A;  3D21 A;  1XWG A;  4MPF A;  4IW9 A;  5D9X A;  4RI7 A;  2IPA A;  2TIR A;  1AC1 A;  3BBY A;  5ECM B;  2ALB A;  2IY2 A;  3F63 A;  2PMT A;  5DQS A;  3UOM A;  4BWQ A;  1QQ2 A;  2DC5 A;  11GS A;  1TK8 B;  3GIX A;  3Q19 A;  1YKA A;  1PX7 A;  1V9W A;  4J56 E;  2GSQ A;  1XOB A;  1M2A A;  4ULX A;  4QL9 A;  2VAF A;  4XS6 A;  4LL4 B;  2FGX A;  2XPE A;  4EC0 A;  1ZMA A;  2Z9S A;  2J9H A;  5HR2 A;  1AUC A;  1W89 A;  3PIN A;  3FKF A;  2WFC A;  1Q4J A;  5INY A;  2XPD A;  2C3T A;  1TW9 A;  5AGY A;  2X8G A;  5IMA A;  3LGC A;  2DML A;  2LS5 A;  3UVT A;  1PD2 1;  1G7E A;  3WD6 A;  2H1A A;  1ZGN A;  4K0N A;  3CBU A;  4ZB6 A;  1BJX A;  2LKU A;  2N5F A;  3KXO A;  1ERU A;  2LST A;  3APQ A;  3QPM A;  4ECI A;  1PKZ A;  1A2J A;  5ECI B;  1GUH A;  2JAC A;  2AB6 A;  4E8H A;  1YKC A;  3R2Q A;  3VWU A;  3FY7 A;  1SL2 B;  1SK0 A;  3CRT A;  1EGO A;  2JL4 A;  4X0X A;  3JCM L;  1G6W A;  3LOR A;  5DJL A;  4KSO A;  2WZ9 A;  1Z6N A;  1B9X C;  1SJ6 A;  5FWG A;  1OAZ A;  1GUL A;  5HFK A;  3UL3 A;  2ZNM A;  5H5S A;  1JZD A;  4IQA A;  2F9S A;  1M9A A;  4P3Y B;  4RI6 A;  5DAK B;  2K8V A;  3HD5 A;  6GSW A;  8GSS A;  3O3T A;  3GH6 A;  4KE3 A;  1A0F A;  3TJJ A;  3US3 A;  4TW5 A;  2DJJ A;  2ZCT A;  3D22 A;  3TB2 A;  2LRC A;  4H86 A;  4LMV A;  2NPB A;  3HJO A;  1A2M A;  5KN3 A;  4NHW A;  4BVY A;  3GFK A;  4KUN A;  2QSI A;  3GRX A;  1GUK A;  3BCI A;  6GSU A;  3EU4 A;  2H73 A;  3IXR A;  1UA5 A;  5B6M A;  1YDK A;  1Z6M A;  1DBY A;  2L6C A;  3LEF A;  2L5L A;  3ME7 A;  2H0I A;  3Q18 A;  3M9K A;  1EWX A;  1DE1 A;  3IC4 A;  1XFL A;  2IFQ B;  5G5F A;  5GAP D;  3ME8 A;  4HJM A;  5IIZ A;  1B4Q A;  4G9H A;  3KTL A;  5KN2 A;  1MD4 A;  4KA0 A;  2P31 A;  1IYH A;  2H70 A;  2CA8 A;  4XIH A;  3GKX A;  4I6X A;  3DML A;  1AQX A;  4IN0 A;  4V2N A;  4AGS A;  4GTU A;  2RM5 A;  1U3I A;  5CRW A;  5FT3 A;  4OFT A;  2JSY A;  2HZF A;  2NDO A;  4JZQ A;  4KCA A;  3RPN A;  5EPF A;  4HS1 A;  2CVD A;  3LYP A;  2HZE B;  4N0Z A;  2YJ7 A;  4FH8 A;  4PGT A;  4K6X A;  4QQ7 A;  5DCG A;  3KCM A;  2MZC A;  2DJ0 A;  3QAW A;  1QK8 A;  3BD2 A;  3DVX A;  2CVB A;  2VOC A;  4Z7X A;  3KZQ A;  2QC7 A;  4FYB A;  1NW2 A;  1ST9 A;  2IMD A;  1GTA A;  4K7N A;  20GS A;  5A4V A;  17GS A;  5IPG A;  3EIN A;  1PN9 A;  1X5D A;  2C0D A;  3IAM 2;  1MDK A;  1XZO A;  3DVW A;  2V2G A;  3LFL A;  1EV9 A;  4O92 A;  5DDL A;  1NHY A;  5IMD A;  1GSS A;  1QXH A;  1WIK A;  3BCK A;  3RPP A;  1EGR A;  2CVK A;  5IMF A;  1QUW A;  4L8E A;  3EVI A;  3RAZ A;  3DD3 A;  4L5O A;  3W8S A;  1F37 A;  4XHM A;  3MAK A;  1T1V A;  1VF4 A;  1M2D A;  4MA9 A;  1ZYQ B;  1M99 A;  2NBS A;  1XOA A;  3I69 A;  4PUF C;  4LA1 A;  22GS A;  1TK0 B;  2H74 A;  1EEM A;  2FY6 A;  2B1K A;  4V1A p;  3TRP A;  3UJ1 A;  3L9S A;  5LD0 A;  5EVO A;  1SJI A;  5CO3 A;  1B48 A;  3KJY A;  4EO3 A;  1ERT A;  2P0G A;  5E4W A;  2I9H A;  5COH A;  3A2X A;  3FZA A;  1H4O A;  1V98 A;  4IKH A;  4DSS A;  1YF1 A;  4V2M A;  4IEL A;  1TRV A;  5AIS A;  3F3Q A;  1X5E A;  2OKA A;  4HJ2 A;  5H5R A;  3WYW A;  2MBT A;  3FYG A;  3GX0 A;  1PX6 A;  1XBS A;  4CDO A;  2K8S A;  4GWR A;  4ZIL A;  2K6V A;  3ZTL A;  4GSS A;  3LQ7 A;  3HYP A;  2H01 A;  2R37 A;  4PX1 A;  5IPH A;  4WBR D;  4NHZ A;  2NTO A;  2XBQ A;  3IK9 A;  2GZY A;  4RQX A;  2DJ2 A;  1SEN A;  1K0C A;  2L4C A;  4CW9 A;  4MZC A;  4POM A;  1JZW A;  3GN3 A;  3FR3 A;  1DE2 A;  5ECK B;  3GTU B;  3TJK A;  4KDY A;  1T4Y A;  3IK7 A;  1GSE A;  2DBC A;  1WWJ A;  2HT9 A;  3MDK A;  2F51 A;  1WOU A;  1TRU A;  1HNA A;  4KND A;  5F05 A;  4NWY A;  4IVF A;  4LL1 B;  3FZ5 A;  4K2D A;  3HXS A;  2LJA A;  1V40 A;  1O85 A;  1R7H A;  4WKW A;  4NPB A;  4NV2 A;  1T4Z A;  5CYY A;  3N9J A;  3GL3 A;  2KP2 A;  1A8L A;  3F9U A;  4TR4 A;  1SJZ A;  3ZMK A;  1V57 A;  2C80 A;  1VF1 A;  3ZVJ D;  1V58 A;  2F8F A;  3GMF A;  4MJE A;  4EVM A;  2PGT A;  2LNS A;  5B8B A;  1SD9 A;  2H6Z A;  2YV7 A;  1THX A;  1K3L A;  1GLP A;  1MDJ A;  4MP4 A;  1A0R P;  2HSY A;  2H0G A;  2YZH A;  4PQI A;  3EE2 A;  3DKS A;  4PUA A;  1O8X A;  3UAP A;  5C04 A;  1AAZ A;  4DEJ A;  3QMX A;  1TK5 B;  5JWO B;  4KAE A;  3VWW A;  4ZBA A;  3TJB A;  1M7T A; 
#chains in the Genus database with same CATH topology
 4DSR A;  1Q82 4;  4ZXG A;  2ZDJ A;  2A2S A;  1KSI A;  2YWO A;  2R6K A;  1YZX A;  2XRX B;  1SII A;  3PCR A;  1RCK A;  1XCC A;  1XW9 A;  2C0E A;  3CMI A;  4DSQ A;  2H1D A;  2KHP A;  3IOS A;  1CH0 A;  3KH9 A;  3S28 A;  4KFF A;  1RKY A;  1BNJ A;  1JJ2 2;  3KM6 A;  3C73 A;  3LT9 A;  3WDG B;  5IO2 A;  1XW6 A;  3D5I A;  1VRS D;  2LJK A;  3AHW A;  3FZ4 A;  3KMN A;  4NMU A;  3M3M A;  4FMB A;  4TKY A;  1GL8 A;  1ASK A;  3OX9 A;  1DMM A;  5RNT A;  4GSP A;  2YZU A;  2B5E A;  1ERW A;  4ISD A;  4ACS A;  3I9V 2;  3IHG A;  2EIQ A;  3UB1 A;  2GU3 A;  3KEB A;  3RHC A;  2ZUP A;  2YPM A;  5ECL B;  3HHV A;  3FRC A;  1PKW A;  4K61 A;  1Q40 B;  2B5Y A;  3C7M A;  5EVH A;  1OC9 B;  4X4J A;  1B4P A;  4AJ6 A;  5J9B A;  2ML6 A;  3GNJ A;  3S29 A;  1SU9 A;  4XCS A;  4BL3 A;  4KB3 A;  2O8V B;  1BRN L;  1BAN A;  3P8W A;  1NU3 A;  1N2A A;  4JED A;  2WGQ A;  4LZI A;  1OGZ A;  4ML6 A;  1XVQ A;  3MSZ A;  4MMY B;  3HZP A;  4QL7 A;  2QEX 3;  2MMZ A;  2B1X B;  3IRA A;  3Q6O A;  4POL A;  1EOG A;  3CME 3;  3GV1 A;  4WYK B;  1OUN A;  1GOV A;  2VM2 A;  4BL7 A;  3WOF B;  4AJ7 A;  3OXA A;  4H61 A;  4O8S A;  3EMP A;  4Q5Q A;  3VUR A;  1RSN A;  5CAX A;  5GZZ B;  1MEK A;  3K0Z A;  2ZA4 A;  4BVX A;  4HZ9 B;  4O2H A;  4K9Z A;  1BYE A;  4RZM A;  1FGM A;  2LJR A;  4Z2T A;  3OWS A;  3MSO A;  3L9U A;  2X64 A;  4WHA A;  5D9W A;  2IJY A;  2QA1 A;  1BQ7 A;  1FGQ A;  3C71 A;  4O02 B;  2PWJ A;  1QMA A;  5LNK e;  4HU9 A;  3DGN A;  2F3M A;  5AIG A;  2JZS A;  1TRQ A;  1I3F A;  2CX3 A;  3W8J A;  3LWA A;  1DYU A;  2DIY A;  3GUR A;  4FCZ A;  2XFT A;  1RN7 A;  1BNS A;  2ES7 A;  3SX1 A;  2VM1 A;  2B3S A;  4K7O A;  4O5R A;  4GL6 A;  2VCZ A;  2OE0 A;  1OE7 A;  1A2V A;  1FVK A;  2F4Y A;  4BPY A;  3FKA A;  1M2B A;  3V1W A;  3TRQ A;  1MTC A;  4N6M A;  4EDZ A;  2GQM A;  3MYD A;  3VK9 A;  2MMN A;  3HY2 A;  5AIX A;  5B8A A;  1B2S A;  2DKH A;  1W6Y A;  1HD2 A;  3APO A;  1U3A A;  4PNG A;  1N9J A;  5BU4 A;  3F4R A;  4AF2 A;  3MNG A;  3QD9 A;  4ID0 A;  3CSJ A;  1BED A;  3WHO A;  3GH9 A;  1TOF A;  3O6T A;  4MJB A;  4X43 A;  2FXT A;  3GA4 A;  2FLS A;  4H3U A;  1RQM A;  5IOW A;  4EC6 A;  1SKS B;  4G19 A;  3LXT A;  4BVX B;  1RGC A;  4HAA A;  4R4K A;  2FWH A;  1FA3 A;  2AAE A;  4POB A;  2LRT A;  4TOP A;  1SD8 A;  1ULJ B;  3LTB A;  2RSX A;  1R26 A;  3D4T A;  3KP9 A;  1ACV A;  3KP8 A;  1O7P B;  4EKZ A;  4IQ1 A;  1FZU A;  1PL1 A;  3APS A;  2LQO A;  2VD1 A;  3F40 A;  1URM A;  1SJW A;  1K3Y A;  1E6B A;  1I0V A;  1EQK A;  2BU4 A;  2V41 A;  1W00 A;  3BLZ A;  2GTU A;  1ZYN A;  3RDW A;  2MMA A;  1PFP A;  4WR4 A;  4OWY A;  3FSD A;  1FOH A;  1L5G B;  3ALA A;  4EUY A;  1TTZ A;  4IP6 A;  2IIY A;  5D9V A;  4GST A;  4BWS A;  3E0U A;  1R5A A;  4A5P A;  4EV2 A;  3QAV A;  1WP0 A;  1T8E B;  4IGJ A;  4N11 A;  2D42 A;  2Y73 A;  6GSS A;  2GGT A;  1RN4 A;  3KN4 A;  2OWP A;  1KBN A;  1RNT A;  2OCT A;  3EC9 A;  4XB5 A;  3HII A;  1GMP A;  3G16 A;  5BVB A;  1ON4 A;  1K0O A;  2GZZ A;  1RGA A;  1K0D A;  3HKR A;  4ZL9 A;  2LRN A;  2CV4 A;  2DSA A;  1MWT A;  2O87 A;  1JB4 A;  3D6I A;  1AR0 A;  1I70 A;  3BND A;  1VQ8 3;  4G0K A;  2I4A A;  5IMV A;  2L1S A;  2GBX B;  3GX8 A;  3CYN A;  5JPP A;  1FGO A;  2WS2 A;  5G1K A;  3IPT A;  2GEX A;  2YFL B;  5JCG A;  3HJP A;  1X0R A;  2OOV C;  4TR0 A;  2PBJ A;  1R4C A;  4F0B A;  1TKD B;  4J9A A;  3FR9 A;  3F3R A;  1XWB A;  2W9Q A;  2FWG A;  4YAV A;  3LTD A;  2JSZ A;  4PUR A;  4GHO A;  2QA4 3;  2OQE A;  3M1G A;  2YFJ B;  1GOU A;  3NBR A;  2OTJ 3;  3O76 A;  1OGX A;  1SKR B;  4EDY A;  1HQO A;  4FCM A;  4AJ8 A;  2OTL 3;  3HX8 A;  4LLR A;  2B24 B;  5AIH A;  5EEO A;  3J7Y b;  1I9D A;  1O7M B;  1ROA A;  5AEU B;  3GAX A;  5HFG A;  4TXO B;  5GSP A;  4K1F A;  4WEY A;  1DSB A;  2EIR A;  3VI5 A;  5G30 A;  4ECC A;  2VL9 A;  3F4S A;  4JBB A;  2RUF A;  2L4V A;  3CTF A;  2XHF A;  4HOJ A;  6GSV A;  1WJK A;  2HRF A;  1OYJ A;  1RGE A;  1W4N A;  2VLT A;  2CKF B;  2OOV A;  3EC3 A;  1ABA A;  5J41 A;  3G7I A;  5L71 A;  2VLU A;  4GLT A;  1T3B A;  3V99 A;  2IFQ A;  2FWF A;  4EV5 A;  2R4V A;  1O73 A;  2JZR A;  3AY8 A;  1Z9H A;  5DQY A;  4ILF A;  2C4J A;  3LG6 A;  3KFQ C;  1OHP A;  4MH2 A;  1ISK A;  2TRX A;  3LML A;  4WYK A;  4CDL A;  5J4U A;  1AQV A;  4NV5 A;  1VGL A;  3KH7 A;  3HOH A;  6RNT A;  2VCQ A;  1UCI A;  3CCS 3;  4HM6 B;  3CCL 3;  1E3V A;  5KEJ A;  3LYK A;  5DRE A;  1QAL A;  1TTO A;  2DLX A;  3FLJ A;  5LC7 A;  2UX0 A;  1Y4K A;  4J57 E;  4K1U A;  2XGN A;  3EYT A;  2F86 B;  2IL3 A;  1LJR A;  1GUM A;  1QVF 2;  1PRX A;  4ML1 A;  3UIW A;  5I97 A;  4BIK A;  4O5Q A;  2IYJ A;  1O7U A;  5ELA A;  3A76 A;  1XVW A;  3K8N A;  2YP6 A;  4EBG A;  1JLW A;  3RNT A;  1A2L A;  5DAL B;  5AIV A;  3DGM A;  3MKI A;  2IMK A;  5ABR A;  5IG3 A;  3IDV A;  4JU5 A;  5IO0 A;  1W4V A;  5M18 A;  5J9C A;  4EL1 A;  2L4Q A;  1JN5 B;  4WR5 A;  3H3H A;  3WGX A;  6GSP A;  2YFI B;  4I2U A;  1S72 3;  1XG8 A;  1C7H A;  2ZHX B;  1QMV A;  5LC6 A;  5STD A;  3L9V A;  4EXJ A;  3ZG5 A;  3HA9 A;  5CK6 A;  1VQ7 3;  4GSN A;  1UW1 A;  3RDE A;  3LXZ A;  1IVU A;  1M90 4;  1FB6 A;  1FW1 A;  3H1N A;  3Q74 A;  1YJ6 A;  2RLI A;  1OPY A;  3VI7 A;  4WXT A;  2X49 A;  9GSS A;  1E97 A;  1A8Y A;  1PQN A;  1GSU A;  2D2Z A;  3UL6 A;  2HLS A;  2VIM A;  3DIE A;  3F6D A;  1RGF A;  1WMJ A;  4ZL7 A;  1OC8 A;  5ECS A;  4JR4 A;  3ZML A;  4I2T A;  5DJM A;  5IEO A;  2H8L A;  2MBS A;  1Y25 A;  1XW5 A;  3SXX A;  4RUV A;  1OKD A;  4WFO A;  1EOH A;  2WUL A;  3BNC A;  1I2G A;  1FHE A;  3G9B A;  3ERW A;  2IA7 A;  1RW1 A;  4FCJ A;  2E2T A;  4OD7 A;  3T0U A;  3WT2 A;  2A4V A;  1YQ1 A;  1X9W B;  3DRN A;  1BSB A;  1GH2 A;  5ECN B;  3KKG A;  2MC8 A;  2HE3 A;  4EF0 A;  3NZN A;  2P5R A;  5D93 A;  6GST A;  4XS1 A;  4BTW A;  4YAP A;  3D5G A;  4LSO A;  1M3I A;  2DMM A;  2CIU A;  3F7X A;  3NUV A;  5G2G A;  3G7Y A;  5CP1 A;  2HSM A;  1BG5 A;  1DUG A;  2R0C A;  3NHX A;  3GTU A;  1JLV A;  4IT7 A;  3AGO A;  2PU9 C;  3QAG A;  7GSS A;  3TDG A;  1PYL A;  1YNV X;  2HMJ B;  1UUV B;  1LU4 A;  1GTU A;  1DVD A;  3M0F A;  4BTY A;  4GQF A;  2Q07 A;  1TI3 A;  19GS A;  3F4T A;  3N5O A;  5B7C A;  2CWT A;  3CSI A;  2R2J A;  3CNX A;  3N8B A;  4EE0 A;  1K0M A;  4EIQ A;  6STD A;  2JZT A;  3TUE A;  1GNE A;  1JZO A;  1NO3 A;  1AIU A;  4LMW A;  3IA1 A;  1U6T A;  2OAC A;  3RBT A;  1M0U A;  2L57 A;  1YGE A;  1UGH I;  2REM A;  3CCQ 3;  4GRF A;  3GSS A;  2ZL8 A;  1KC8 4;  1J9B A;  1VQ9 3;  2GVP A;  1YEP A;  1ILO A;  1G6Y A;  1K73 4;  2B1L A;  2RII A;  3NQZ A;  5KOW A;  3TKP A;  1OHS A;  2PER A;  4F2I A;  2M72 A;  3CCJ 3;  2CX4 A;  2MYG A;  3F0I A;  2C0F A;  1UDI I;  1FGT A;  2PNC A;  3RHB A;  1B3S A;  1J2B A;  4PNF A;  1F3A A;  3F9S A;  3TKQ A;  1G0T A;  4NHF A;  2JU5 A;  2VD0 A;  1DMN A;  3DMC A;  4G2E A;  1EKM A;  1CQH A;  3H8Q A;  1U5O A;  3KZT A;  2A15 A;  3D0Z A;  5KP4 A;  4MMM A;  4V1A g;  1BNG A;  2SAR A;  3PR8 A;  1SK1 A;  1F9M A;  5H5Q A;  1OC3 A;  4I97 A;  5CNW A;  1NJI 4;  1UUG B;  2HMN B;  2B6M A;  4ZM8 A;  2K18 A;  1UI8 A;  2CZ2 A;  2GSS A;  4WBJ A;  5J5N A;  3L0H A;  4V2L A;  4ECJ A;  1Z5Y E;  4JE1 A;  2FWE A;  3KSP A;  4MH3 A;  3DZL A;  3KMO A;  5IMC A;  3LSZ A;  1Y6E A;  1VQQ A;  5B6N A;  4XRA A;  3PXM A;  1ZX2 A;  2FNQ A;  4KX4 A;  2PPT A;  4GF0 A;  1AVK A;  2PVQ A;  4IHU A;  4WET A;  3WT1 A;  2H66 A;  2CX0 A;  5G31 A;  1JRQ A;  3P90 A;  3HZ8 A;  4WF5 A;  1GMR A;  1SYR A;  3SWL A;  2DIZ A;  5CF2 A;  5IM9 A;  5D9T A;  5GAN D;  1J08 A;  3FZ9 A;  5CRE A;  1SYX A;  1WMP A;  3TGZ A;  2KOK A;  2RBI A;  4HI7 A;  1X9S B;  4NXI A;  4ZBD A;  1A24 A;  4POK A;  1GTB A;  1AQW A;  5LCZ A;  1BNE A;  3CXC 2;  1KEB A;  3QFA C;  2FUG 2;  1OC9 A;  2YAN A;  2DJK A;  1TFK A;  2OE3 A;  5F8B A;  3LYG A;  4GCI A;  2O7K A;  2KP1 A;  3IE3 A;  2NVL A;  1AXD A;  3C1R A;  5HOH A;  3J7Y k;  4GQC A;  3UVH A;  2CWU A;  4KF9 A;  1OH0 A;  4N6U A;  2B5X A;  3JUP A;  2HZE A;  3UBK A;  1OKT A;  2HML B;  2HYX A;  1F2E A;  1OE8 A;  2JAD A;  4MPG A;  4XBX A;  1W7C A;  4J2F A;  1K3O A;  2K9F A;  2QGV A;  2V1L A;  3JUQ A;  3WA3 A;  1S3R A;  2UZ8 A;  2FA8 A;  3FH1 A;  4FYC A;  1TUH A;  3ZLP A;  5DCH A;  4PEJ A;  1MNL A;  1STD A;  1N9E A;  3HK4 A;  3BJ5 A;  1NHO A;  1JFU A;  3CQF A;  1TU8 A;  5DBQ A;  3CNM A;  2PZV A;  4N30 A;  2XC2 A;  3AHS A;  2DJ3 A;  3IAS 2;  4USS A;  5IMZ A;  2EIO A;  2KUC A;  3GKM A;  2UGI A;  5G2Z A;  1IU7 A;  3FG1 A;  2HFD A;  5FHI A;  2GZP A;  4HSC X;  1RRH A;  4ECB A;  2E2U A;  5CF1 A;  2I1U A;  2H0H A;  1VQ6 3;  4Z2R A;  1M1K 4;  5DVB A;  1SL1 B;  2CWV A;  3P2A A;  1IYY A;  2W6J H;  1BGS A;  4LYL B;  1U8C B;  4Z2U A;  3P7X A;  3TKS A;  3FG4 A;  5E59 A;  4CPK A;  1I3I A;  5CRG A;  5ID2 A;  2P5Q A;  3L4N A;  5GSS A;  2Z76 A;  4QWT A;  4JR6 A;  1BRJ A;  1NB3 I;  4XBY A;  5ID2 B;  1EP7 A;  4KW6 A;  4Q53 A;  1EV4 A;  4FMC A;  3CSH A;  3KTB A;  1YHQ 3;  3KII A;  3VGN A;  1PU4 A;  3I56 3;  2VL2 C;  3X3X A;  3GKN A;  3HVV A;  2YWI A;  12GS A;  2IWT A;  4O7H A;  1QFN A;  1K9M 4;  1AY7 A;  3MYT A;  4KDX A;  2HNL A;  2FA4 A;  4N10 A;  1ZOF A;  5JWR B;  1PSQ A;  4MMX B;  5D8I A;  3HVN A;  1BSA A;  6GSX A;  4X1U A;  1VF2 A;  4HUA A;  1RRL A;  2CFK A;  3NM2 A;  3MHE A;  4G10 A;  4KCE A;  2H30 A;  3Q1C A;  2LNT A;  3G71 3;  4EIP A;  2YNX A;  2YJH A;  4MZB A;  1R5P A;  1WNH A;  5D96 A;  1FVJ A;  2G2Q A;  3PYJ A;  5D73 A;  3PGB A;  1Z3E A;  3ERG A;  3EU3 A;  5EY6 A;  1LXE A;  3PH9 A;  4STD A;  2H6Y A;  1BNF A;  4K8M A;  4MF7 A;  2CQ9 A;  1GOY A;  5AN1 A;  4N6O B;  1UVZ A;  2YWM A;  5KN1 A;  1S3D A;  1GSY A;  2F8A A;  3QCP A;  4HVN A;  4BL2 A;  4TR1 A;  5HFI A;  5HQP A;  1OAC A;  3U5R E;  3EN1 B;  4YKF A;  4PQ1 A;  1NSW A;  3GST A;  3QOU A;  2WGR A;  4IJ3 A;  3ROB A;  3ZFB A;  1Q42 A;  1UGI A;  5A4U A;  5M19 A;  4F82 A;  3ZIT A;  1RGL A;  3EN8 A;  2INX A;  1UN2 A;  3K7C A;  4G0I A;  3IV4 A;  4HM5 B;  4MDC A;  1TU7 A;  4XS4 B;  2LEG A;  3C1S A;  2VUP A;  3CTG A;  2KF5 A;  4IP1 A;  4L0W A;  2VLV A;  1T7P B;  3D4M A;  5IG4 A;  3GYK A;  2C0G A;  4KH7 A;  3LZA A;  1GWC A;  2H71 A;  2MMO A;  1TRW A;  2E2M A;  4KFE A;  1A90 A;  3WMD A;  2N5A A;  3ED3 A;  1XIY A;  4XDV A;  1BNI A;  5JBS A;  1PFO A;  4KGI A;  1RNB A;  4HOH A;  2XH9 A;  5CRH A;  1HYF A;  3OR5 A;  4K0G A;  3C8E A;  2IME A;  2AUV A;  16GS A;  3PGT A;  3QFB C;  1ZCP A;  3H93 A;  1FO5 A;  4OK0 A;  2V32 A;  1RK4 A;  5KP1 A;  3KGK A;  3I6A A;  5IEP A;  1UUW B;  4MJD A;  3TKR A;  4JF8 A;  2YCD A;  1KQS 2;  5GST A;  2OBI A;  2AV4 A;  1Z7P A;  4GXZ A;  5JPU A;  3A2W A;  3EX9 A;  2IN3 A;  4JRR A;  1U87 A;  2XSH B;  4J5K A;  1I2F A;  1I2E A;  1IVX A;  2HRA A;  3ZIJ A;  1BSC A;  1BUQ A;  1NM3 A;  1TI1 A;  2O85 A;  2G0F A;  1MWS A;  1ERV A;  2VCT A;  3WR2 A;  4OMV A;  2XSO B;  3DUK A;  3D4A A;  3GWR A;  1FYS A;  3EHC A;  2F5W A;  1N8R 4;  1HYU A;  4N6V 0;  5KN0 A;  3DEX A;  3NIV A;  2V6K A;  3DXB A;  5ECQ B;  4ZB8 A;  2R5G A;  1YJ9 3;  1BAY A;  4D73 B;  2ON7 A;  3BNE A;  3WGD A;  4D73 A;  2X8H A;  3ECF A;  4Q5N A;  1MGR A;  5AII A;  3GL5 A;  1B21 A;  2I81 A;  4PTS A;  3ZZX A;  2M46 A;  4PXO A;  1LBK A;  5CXO A;  3NOF A;  1F3B A;  1T00 A;  3HJM A;  3VPQ A;  2K0M A;  4R9K A;  3TKS E;  4RQR A;  1JZR A;  2H75 A;  2GT5 A;  4HQZ A;  4KSM A;  10GS A;  4FYU A;  2AAD A;  4MF6 A;  1XWK A;  2WRT A;  3TJG A;  3VPT A;  1RLS A;  4F9Z A;  4OO5 A;  7RNT A;  2GST A;  2ON5 A;  2K54 A;  3N9H A;  4TXV A;  4KVH A;  4R9L A;  3HCZ A;  1J0F A;  1A2P A;  2D1W A;  3CPW 2;  3FF2 A;  3X42 A;  1BSE A;  3EPT A;  1BUJ A;  2GSP A;  3GZB A;  3EQQ B;  2C3Q A;  2R0P A;  3BIR A;  3UBL A;  1W02 A;  2CAQ A;  4FQU A;  1I5G A;  4L8O A;  1QVG 2;  3IBH A;  1MWR A;  3VWV A;  1GTI A;  3B8L A;  3LW9 A;  1Q81 4;  2CFW A;  4ZL8 A;  1CQG A;  2LQQ A;  1LQM B;  3DWV A;  4HQS A;  2FNO A;  3KIJ A;  4BTX A;  3SOA A;  3EMX A;  2W2C A;  3X41 A;  1VZZ A;  4RNY A;  1B27 A;  1A2K A;  4HDE A;  5F0G A;  3DXO A;  1PGT A;  2OBK A;  1GSD A;  1BX9 A;  1YF0 A;  3G0K A;  5D82 A;  2XEP A;  5HGR A;  1ZO2 A;  1ML6 A;  2YN1 A;  3Q3F A;  3KCH A;  3ZVJ A;  1VF3 A;  1LVN A;  3D5J A;  1B2X A;  4MLY A;  3VLN A;  4NRE A;  1X5C A;  2VO4 A;  3VWX A;  3ZL5 A;  4EXR A;  1SKW B;  1QGV A;  4OCE A;  3G7J A;  2QGU A;  4MMZ B;  3MWH A;  2FCH A;  3HDC A;  2R3X A;  3ZIV A;  1WPI A;  5TGN A;  3S67 A;  4N6N B;  3B7C A;  4TN8 A;  1JNQ A;  1EEJ A;  3L78 A;  6GSY A;  3IR4 A;  2WB9 A;  3EF8 A;  1W2Z A;  3A2V A;  4F03 A;  1A23 A;  2EC4 A;  4HZ2 A;  2N5B A;  4IJI A;  2OA7 A;  1IV9 A;  2HMM B;  1LOY A;  1IVV A;  1GNW A;  2HSH A;  2BJX A;  2C1Y A;  2HRN A;  5ECO B;  2E2G A;  3PCS A;  4N6L A;  2HRK A;  3RGA A;  5CRD A;  2WCI A;  2W9P A;  2O89 A;  5EL8 A;  2GXF A;  3LTC A;  5HR3 A;  2VCV A;  4DKI A;  4YQM A;  4BIR A;  3A5W A;  2XFS A;  1TFO A;  2W56 A;  1FUS A;  2B7K A;  2X4A A;  3FHK A;  2VCW A;  1R4W A;  4IPB A;  3STD A;  4TVE A;  5C00 A;  4N6T A;  5JWQ B;  1MD3 A;  5DAL A;  3FEU A;  3HI7 A;  2CT6 A;  4BA7 A;  3ER7 A;  1W6C A;  2J23 A;  1NWW A;  1Z1S A;  1PMT A;  2AHE A;  1C54 A;  1FAA A;  5KP3 A;  2LQV A;  2IMF A;  2V1M A;  3F8U A;  3GZX B;  2P0M A;  5HR1 A;  4KZ1 A;  1K0N A;  4NAX A;  2Y74 A;  2I3Y A;  1G96 A;  3E3E A;  1IVW A;  1B8X A;  2KRT A;  2PVO C;  4YQU A;  2H76 A;  1TDI A;  3HVX A;  5IG5 A;  1K0B A;  2HI7 A;  4MJA A;  1USB A;  3DYR A;  2KLX A;  1KWI A;  3NBJ A;  2GSR A;  5ELG A;  5BRT A;  1FUT A;  1I8V A;  2KCD A;  3IMA B;  3NM7 A;  2CW9 A;  1HNC A;  1U88 A;  3PS8 A;  1WRY A;  3A5E A;  3VFI A;  3MG3 A;  3NQY A;  2O9U X;  4MK3 A;  3G8Z A;  1YY7 A;  3IHQ A;  4AKZ A;  2CG0 A;  2KF3 A;  5IG0 A;  1Q98 A;  4FO5 A;  1S3C A;  1FB0 A;  3Q90 A;  18GS A;  1SL0 B;  1GD3 A;  3FGY A;  2PN8 A;  4N0V A;  2J8X B;  2L6D A;  2C10 A;  4BU4 A;  3F8H A;  2XGL A;  3ZRD A;  4K90 B;  1WMO A;  4CY6 A;  1JN5 A;  3CC2 3;  2FD3 A;  1V2A A;  5DRV A;  3M8N A;  3W6G A;  2C8U A;  3E9J B;  2GBW B;  3U6V A;  5ECR B;  2GS3 A;  1TP6 A;  5AYR B;  4XS4 A;  3D3L A;  4MAB A;  2RUE A;  1MDI A;  1EA2 A;  2VL2 A;  2BMX A;  3QDN A;  4MCU A;  3CCU 3;  4MF5 A;  1VQN 3;  1UI7 A;  2WDU A;  3ZFL A;  4G0L A;  3NX0 A;  1YEX A;  4FIW A;  2H1G A;  1THO A;  1GS3 A;  1GRX A;  1EP8 A;  2GLR A;  4L5L A;  2CH9 A;  1H75 A;  3KD0 A;  1Q40 A;  4IS0 A;  3ERF A;  5HR0 A;  1RMS A;  1UCK A;  3UMA A;  3ZRE A;  1B9Y C;  2L5O A;  4ZIJ A;  2E0Q A;  3CXG A;  2HMK B;  3OWU A;  1EZK A;  1KTE A;  2OAD A;  3GKK A;  1AQZ A;  4CCV A;  2A4H A;  3LJR A;  3CCM 3;  3A5I A;  1NNV A;  1X9M B;  4HM7 B;  1K8A 4;  1SK2 A;  1BRI A;  2WJU A;  3TRX A;  1MGW A;  1YJN 3;  2TRC P;  4OFN A;  2GQK A;  1B20 A;  2H19 A;  3TJF A;  4HZ4 A;  1XWC A;  2MF7 A;  5A4W A;  1PY3 A;  1YIJ 3;  1PA3 A;  1QAK A;  2RM6 A;  3RGR A;  2GDR A;  5G1L A;  1IQX A;  1PL2 A;  4I8B A;  1S3A A;  3O8Y A;  2C3N A;  5IEN A;  3GHA A;  5F07 A;  4WF4 A;  1ZZY A;  3IPZ A;  4HEA 2;  4YQV A;  5IOX A;  4I5Q A;  2HXK A;  1BRS A;  3CC4 3;  2LUS A;  3MG1 A;  4Q5R A;  2CK3 H;  2E7P A;  4PQH A;  4TXO A;  1Q7H A;  3FR6 A;  1YVS A;  3X40 A;  1IDP A;  3SVA A;  3EUR A;  2YWN A;  2BTO T;  2BMQ B;  5IW9 A;  1IYI A;  1X1X A;  2CZ3 A;  2SBL A;  1JV2 B;  1K0A A;  4XTS A;  1YJW 3;  4K1V A;  3S27 A;  3I55 3;  4XRD A;  4F0C A;  3K63 A;  5ELJ A;  1NB5 I;  1TP9 A;  1EG9 B;  1IT7 A;  2H6X A;  3SBC A;  1F6M C;  3EE1 A;  1E2Y A;  2YV9 A;  4OCF A;  1WE0 A;  4YH2 A;  1PN0 A;  2IMJ A;  4TR3 A;  3TOU A;  4O32 A;  1O7H B;  4TRX A;  2CAI A;  2LYX A;  3F6F A;  1BRH A;  1GSQ A;  2FHE A;  3BOA A;  3QR6 A;  2BHM A;  1FOV A;  2RFR A;  1IQ8 A;  1O6J A;  2H72 A;  3JUM A;  1N8J A;  2GT6 A;  1D6U A;  5BMU A;  1JBS A;  3H4K A;  1AVL A;  4FMA A;  3LT8 A;  2QA2 A;  3BNB A;  3H79 A;  1AW9 A;  2AYT A;  5IQY A;  1MWU A;  1ZGX A;  3H51 A;  1WTH A;  1UC7 A;  2AJQ B;  1G7O A;  3ISO A;  4KFD A;  3HZ4 A;  2LTK A;  4OO4 A;  1BAO A;  1SIH A;  3CCV 3;  2YOI A;  3TCO A;  3J7Y d;  1GYB A;  1O81 A;  2H1B A;  2DJ1 A;  3EJV A;  4ZB9 A;  4L0U A;  1HKX A;  4MNN A;  3G4S 3;  2B7J A;  1BRK A;  3D9R A;  3HVS A;  2X8C A;  1TXX A;  2X99 A;  2A2R A;  3K9M C;  1GLQ A;  1W5Z A;  1Z7R A;  1ULI B;  4DSS B;  3I43 A;  4J5G A;  4EYC A;  1XWA A;  3LOY A;  3FZW A;  3AGN A;  1XPV A;  2OJL A;  3X3Y A;  3ZYW A;  5ECH B;  1R4Y A;  1GP1 A;  5DAK A;  2GU1 A;  3TKS C;  2M80 A;  3UJM A;  2W0Q A;  2JDI H;  5ENU A;  3GUS A;  14GS A;  5D83 A;  2KAA A;  1T2H A;  2I9W A;  1JHB A;  1FG4 A;  2AAW A;  3FW2 A;  1SPU A;  4MJC A;  1C72 A;  2GQL A;  3NV0 A;  4IBP A;  5G5E A;  1X1U A;  4E8E A;  2HOH A;  1SAR A;  1B2U A;  4BL7 B;  3IC8 A;  1RGG A;  3CU3 A;  2P09 A;  1KNG A;  3GRD A;  3DGQ A;  1BU4 A;  1GMQ A;  4CY8 A;  1ZYE A;  3UAR A;  2OE1 A;  2P0X A;  1VQO 3;  4MZW A;  4CHS A;  2V6O A;  5F06 A;  2PUK C;  3K5T A;  1O8W A;  1BNR A;  1XXU A;  2VL3 A;  4GB5 A;  3GSP A;  3S9F A;  1OVN A;  4DVC A;  4FR9 A;  1CYV A;  3WGE A;  3N54 B;  2STD A;  2LV3 A;  3CRU A;  5BXQ A;  3U97 A;  3FK8 A;  5A5K A;  2IMI A;  5ECP B;  1M9B A;  2QKE A;  5JCW A;  2ML5 A;  3EWL A;  2VCX A;  2WOH A;  5J3R A;  3UEM A;  3M9J A;  1RGK A;  1WMN A;  3A3T A;  4HU7 A;  5KOX A;  4Q5F A;  5JCU A;  3TOT A;  2GEY A;  4KDU A;  13GS A;  8CHO A;  1HNB A;  4ZBB A;  1ZL9 A;  1VQL 3;  4OFM A;  3MPH A;  1RTU A;  2P38 A;  1TJD A;  4CJN A;  1NDO B;  4TR1 B;  2C11 A;  1GSF A;  4K7I A;  2XBI A;  1RGH A;  1TRS A;  3KE7 A;  2L59 A;  2CFL A;  1TU5 A;  3D21 A;  1XWG A;  1TRP A;  4MPF A;  1RHL A;  3JVC A;  4IW9 A;  5D9X A;  3LXU X;  4RI7 A;  3NBB A;  4L8P A;  3AMO A;  2IPA A;  2TIR A;  1AC1 A;  3BBY A;  5ECM B;  1M9G A;  1QAF A;  2ALB A;  2IY2 A;  2Z7A A;  3F63 A;  4ICY A;  2PMT A;  5DQS A;  3T8U A;  3EBT A;  3UOM A;  1QJG A;  4BWQ A;  1QQ2 A;  2DC5 A;  1BVI A;  5CLK A;  11GS A;  2P05 A;  4HYZ A;  1TK8 B;  3DGO A;  3GIX A;  3Q19 A;  3UNL A;  1YKA A;  1PX7 A;  2WOF A;  1V9W A;  4J56 E;  2GSQ A;  3M8C A;  5IF6 A;  1XOB A;  1M2A A;  4ULX A;  4QL9 A;  2VAF A;  4LGQ A;  4XS6 A;  4LL4 B;  2FGX A;  2R4I A;  5D81 A;  2XPE A;  1K28 A;  1US1 A;  4EC0 A;  1ZMA A;  2WO0 A;  2Z9S A;  2J9H A;  5HR2 A;  1W89 A;  1AUC A;  3CD6 3;  3OW2 2;  3PIN A;  3FKF A;  3BU4 A;  2WFC A;  1DVC A;  1Q4J A;  3QRD A;  3E99 A;  5INY A;  4OVM A;  2XPD A;  4YKG A;  2C3T A;  1TW9 A;  5AGY A;  2X8G A;  3PPU A;  1LNH A;  5IMA A;  3BB9 A;  3LGC A;  2DML A;  1O7G B;  2LS5 A;  3UVT A;  1PD2 1;  1G7E A;  3WD6 A;  3SYU A;  1IT8 A;  1ZGN A;  2H1A A;  4K0N A;  1RDS A;  3CBU A;  4ZB6 A;  1BJX A;  2LKU A;  1BIR A;  4LEH A;  2N5F A;  3KXO A;  1ERU A;  2LST A;  2HMO B;  3APQ A;  3PZW A;  3QPM A;  2O3O A;  4X2H A;  2CX1 A;  4ECI A;  3CCE 3;  1PKZ A;  1A2J A;  5ECI B;  1RN1 A;  1GUH A;  3Q2P A;  2JAC A;  2AB6 A;  4E8H A;  1YKC A;  3R2Q A;  3VWU A;  7STD A;  2F99 A;  3FY7 A;  1W01 A;  1SK0 A;  1SL2 B;  3DGL A;  3CRT A;  2W56 B;  1EGO A;  2JL4 A;  3QK9 A;  4X0X A;  3JCM L;  1LOV A;  4K2X A;  3NXJ A;  1G6W A;  3LOR A;  3G6E 3;  1KD1 4;  4KSO A;  5DJL A;  1B2M A;  1AV4 A;  2WZ9 A;  1Z6N A;  5FGO A;  1A67 A;  1N8Q A;  2CG1 A;  4KT3 B;  1B9X C;  1SJ6 A;  5FWG A;  1OAZ A;  1GUL A;  5HFK A;  3UL3 A;  2ZNM A;  5H5S A;  1UCL A;  1JZD A;  3L0R A;  4IQA A;  2F56 A;  2F9S A;  1M9A A;  4P3Y B;  4RI6 A;  3MG2 A;  5DAK B;  4RNZ A;  1OCV A;  2E2V A;  2K8V A;  3HD5 A;  1D6Z A;  2Z6B A;  6GSW A;  8GSS A;  1RCL A;  2A2P A;  3O3T A;  3GH6 A;  4KE3 A;  1A0F A;  3TJJ A;  4TW5 A;  3US3 A;  2DJJ A;  2ZCT A;  3I0Y A;  3D22 A;  3KSE D;  3TB2 A;  2F5M A;  4J8T A;  2LRC A;  4H86 A;  4LMV A;  2NPB A;  3HJO A;  4XM4 A;  1A2M A;  5KN3 A;  1VQM 3;  1LRA A;  4NHW A;  4BVY A;  1FGR A;  3GFK A;  4KUN A;  1JKG A;  2QSI A;  3GRX A;  1BOX A;  1GUK A;  1N5P A;  4LMI A;  2BO9 B;  3BCI A;  3JUO A;  6GSU A;  3EU4 A;  2H73 A;  3IXR A;  1UA5 A;  5B6M A;  1YDK A;  1VQ4 3;  1CQS A;  2WGO A;  4HM8 B;  3DGY A;  1Z6M A;  9RNT A;  1EUI C;  3FF0 A;  1DBY A;  1STF I;  2L6C A;  3LEF A;  2L5L A;  3ME7 A;  2CHC A;  1LNI A;  5M1A A;  2H0I A;  3Q18 A;  3M9K A;  1O7N B;  2RCD A;  1EWX A;  1OF5 A;  4RNT A;  1DE1 A;  3IC4 A;  2KXG A;  1XFL A;  2IFQ B;  5G5F A;  2Z77 A;  1FUW A;  1JBT A;  5GAP D;  3ME8 A;  4HJM A;  2BMO B;  2C4B A;  3DY5 A;  5IIZ A;  1B4Q A;  4G9H A;  1LOW A;  3KTL A;  5KN2 A;  1MD4 A;  3GZY B;  3F14 A;  4KA0 A;  1S5A A;  2P31 A;  5EQL A;  1IYH A;  2H70 A;  3U1W A;  2CA8 A;  4XIH A;  3GKX A;  4G1M B;  4I6X A;  2CC3 A;  3DML A;  1AQX A;  4IN0 A;  4V2N A;  3ZG0 A;  3DM8 A;  3SOY A;  4AGS A;  4GTU A;  4BVY B;  2RM5 A;  5AEW B;  4HM2 B;  1U3I A;  5CRW A;  3F7S A;  5FT3 A;  3FCS B;  4OFT A;  2JSY A;  2HZF A;  1DET A;  2NDO A;  4JZQ A;  4KCA A;  3RPN A;  5EPF A;  4HS1 A;  4N3V A;  3WA2 X;  4HZB B;  2CVD A;  3V92 A;  3LYP A;  2HZE B;  4N0Z A;  2YJ7 A;  4FH8 A;  1O7W B;  4PGT A;  4K6X A;  4QQ7 A;  5DCG A;  5A0O B;  3KCM A;  2MZC A;  2DJ0 A;  4O5U A;  3D79 A;  2IUK A;  3QAW A;  1X1W A;  3SED A;  1DMQ A;  1QK8 A;  3BD2 A;  3DVX A;  1FW7 A;  1ZYP A;  2CVB A;  2VOC A;  1W2B 2;  4Z7X A;  3KZQ A;  2QC7 A;  8RNT A;  4FYB A;  1NW2 A;  1ST9 A;  2IMD A;  1LQG C;  1GTA A;  4K7N A;  1GY7 A;  2IUJ A;  1T5Y A;  20GS A;  5A4V A;  17GS A;  5IPG A;  3EIN A;  1PN9 A;  1X5D A;  3WOD G;  2C0D A;  3IAM 2;  1MDK A;  1XZO A;  3DVW A;  3GZR A;  2V2G A;  3LFL A;  4ORL A;  1EV9 A;  4O92 A;  1G02 A;  5DDL A;  1NHY A;  1ZS7 A;  1M1X B;  2KF6 A;  5IMD A;  3ZFZ A;  1QXH A;  1GSS A;  1WIK A;  3WOE B;  3BCK A;  3RPP A;  4R80 A;  1EGR A;  2CVK A;  4O3V A;  3FG3 A;  1JB2 A;  2BMR B;  5IMF A;  1Q86 4;  3AMO B;  1QUW A;  4L8E A;  5ELU A;  3EVI A;  3RAZ A;  4HM1 B;  3R3E A;  3DD3 A;  4L5O A;  1F37 A;  3W8S A;  4OUQ A;  3VSY A;  4XHM A;  3MAK A;  1T1V A;  1VF4 A;  5AI1 A;  1M2D A;  4XBT A;  4MA9 A;  1ZYQ B;  1TIJ A;  1M99 A;  1Q7Y 4;  2NBS A;  1UCJ A;  1BRG A;  1XOA A;  3I69 A;  2RNT A;  3CCR 3;  4PUF C;  4LA1 A;  1GD4 A;  22GS A;  1TK0 B;  1GY5 A;  1T2I A;  1YVB I;  1YI2 3;  3SLU A;  5BIR A;  1EEM A;  2H74 A;  1CYU A;  4AEQ A;  1YIT 3;  1VQK 3;  1WQL B;  2B1K A;  2FY6 A;  2CFG A;  4V1A p;  3TRP A;  3UJ1 A;  3L9S A;  5LD0 A;  2W04 A;  5EVO A;  4HM0 B;  1SJI A;  5CO3 A;  1B48 A;  3KJY A;  4EO3 A;  5FW5 A;  4HM3 B;  1ERT A;  2P0G A;  3MIX A;  5E4W A;  4EW5 A;  2R0G A;  2I9H A;  4R1K A;  1RJO A;  5COH A;  5AYS C;  3A2X A;  3FZA A;  4FMD A;  1H4O A;  1V98 A;  1IV7 A;  1GSP A;  3JUN A;  3B4P A;  2KF4 A;  4IKH A;  4DSS A;  1YF1 A;  4V2M A;  4IEL A;  7GSP A;  1TRV A;  5AIS A;  1V74 A;  3F3Q A;  1X5E A;  2OKA A;  4HJ2 A;  5H5R A;  1VQP 3;  1M3J A;  3WYW A;  2MBT A;  3FYG A;  1K41 A;  3B4O A;  3GX0 A;  1PX6 A;  1XBS A;  4CDO A;  2K8S A;  3T8N A;  1ROV A;  3LH4 A;  2BIR A;  4GWR A;  2K6V A;  4ZIL A;  4HBR A;  5IER A;  3ZTL A;  4GSS A;  3LQ7 A;  3NV0 B;  1IK3 A;  1YGW A;  3HYP A;  2H01 A;  2R37 A;  4PX1 A;  4RBN A;  1IQY A;  5IPH A;  3IJE B;  4WBR D;  4NHZ A;  2NTO A;  1LOX A;  4L7K A;  4HKV B;  1DE3 A;  1HU9 A;  2XBQ A;  3IK9 A;  4MEI A;  2GZY A;  4RQX A;  2DJ2 A;  1SEN A;  1K0C A;  2L4C A;  3FMW A;  1SQW A;  4MZC A;  1JZW A;  4POM A;  4CW9 A;  3GN3 A;  3F8X A;  3FR3 A;  1DE2 A;  5ECK B;  3GTU B;  3TJK A;  4KDY A;  3CMA 3;  1T4Y A;  2XF3 A;  2BT3 A;  3IK7 A;  3EBY A;  1GSE A;  4WP5 A;  2RGQ A;  2DBC A;  1MOL A;  1WWJ A;  2W03 A;  2HT9 A;  3MDK A;  3URP A;  2F51 A;  1X1Y A;  2DKI A;  2R41 A;  1GY6 A;  3VF1 A;  1WOU A;  3CC7 3;  1TRU A;  2BNG A;  2FGT A;  1HNA A;  4KND A;  2K3D A;  5F05 A;  2CFD A;  4NWY A;  3OV4 A;  4TX4 A;  4IVF A;  4LL1 B;  4XDW A;  3FZ5 A;  4K2D A;  3HXS A;  2LJA A;  1V40 A;  1O85 A;  3OWY A;  1R7H A;  4WKW A;  3S5C A;  4NPB A;  2M7O A;  4AKY A;  1T4Z A;  4NV2 A;  4K5R A;  5CYY A;  1CEW I;  3N9J A;  3GL3 A;  2KP2 A;  1A8L A;  3F9U A;  4TR4 A;  1SJZ A;  3ZMK A;  3EB8 A;  1V57 A;  2C80 A;  1VF1 A;  3HIG A;  3ZVJ D;  1I0X A;  1V58 A;  2F8F A;  1BSD A;  3GMF A;  4MJE A;  4EVM A;  2PGT A;  2OQE C;  2LNS A;  1B2Z A;  5B8B A;  1VQ5 3;  2XR8 B;  4I4K A;  1SD9 A;  2H6Z A;  2YV7 A;  3CPO A;  1THX A;  1K3L A;  5AIF A;  3V98 A;  2YX9 A;  1GLP A;  1MDJ A;  1OF5 B;  4MP4 A;  1A0R P;  1E3R A;  1W6G A;  2HSY A;  2H0G A;  2YZH A;  2F98 A;  2JQ5 A;  4PQI A;  4WWU C;  4U13 A;  3EE2 A;  4HM4 B;  4K5S A;  1F8N A;  3DH2 A;  2UUG C;  3LTA A;  1HZ1 A;  4IIA A;  3DKS A;  4PUA A;  4JRF A;  1D6Y A;  1O8X A;  3UAP A;  1Q9E A;  5C04 A;  1AAZ A;  4DEJ A;  2QIY A;  1JKG B;  3QMX A;  3UL5 A;  1TK5 B;  3MWZ A;  5JWO B;  4X2O A;  1JBR A;  3X3Z A;  1JB5 A;  4KAE A;  1OHO A;  4HJL B;  3VWW A;  4ZBA A;  3TJB A;  1N5H A;  1M7T A; 
#chains in the Genus database with same CATH homology
 4DSR A;  4ZXG A;  2A2S A;  2YWO A;  2R6K A;  1YZX A;  4DSQ A;  1XW9 A;  2C0E A;  1XCC A;  3CMI A;  2H1D A;  2KHP A;  3IOS A;  3KH9 A;  3KM6 A;  3C73 A;  5IO2 A;  1XW6 A;  1VRS D;  2LJK A;  3KMN A;  3FZ4 A;  4NMU A;  3M3M A;  4TKY A;  1GL8 A;  2YZU A;  2B5E A;  1ERW A;  4ISD A;  4ACS A;  3I9V 2;  3IHG A;  2EIQ A;  3KEB A;  3RHC A;  2ZUP A;  2YPM A;  5ECL B;  3HHV A;  3FRC A;  1PKW A;  2B5Y A;  3C7M A;  1OC9 B;  4X4J A;  1B4P A;  4AJ6 A;  5J9B A;  3GNJ A;  1SU9 A;  4XCS A;  4KB3 A;  2O8V B;  3P8W A;  1N2A A;  4JED A;  4ML6 A;  1XVQ A;  3MSZ A;  4QL7 A;  2MMZ A;  3IRA A;  3Q6O A;  4POL A;  1EOG A;  3GV1 A;  2VM2 A;  4BL7 A;  4AJ7 A;  3EMP A;  4Q5Q A;  3VUR A;  5CAX A;  5GZZ B;  1MEK A;  4BVX A;  4K9Z A;  1BYE A;  2LJR A;  4Z2T A;  3L9U A;  2X64 A;  5D9W A;  2IJY A;  2QA1 A;  1BQ7 A;  3C71 A;  2PWJ A;  5LNK e;  4HU9 A;  2F3M A;  2JZS A;  2CX3 A;  3W8J A;  3LWA A;  2DIY A;  3GUR A;  2ES7 A;  2VM1 A;  2B3S A;  4K7O A;  4O5R A;  2VCZ A;  2OE0 A;  1OE7 A;  1FVK A;  4BPY A;  1M2B A;  3V1W A;  3TRQ A;  1MTC A;  4EDZ A;  2GQM A;  3MYD A;  3VK9 A;  2MMN A;  3HY2 A;  5AIX A;  5B8A A;  2DKH A;  1HD2 A;  3APO A;  1U3A A;  4PNG A;  3F4R A;  4AF2 A;  3MNG A;  3QD9 A;  4ID0 A;  3CSJ A;  1BED A;  3GH9 A;  1TOF A;  3O6T A;  4MJB A;  4X43 A;  3GA4 A;  2FLS A;  1RQM A;  5IOW A;  1SKS B;  4G19 A;  3LXT A;  4BVX B;  2FWH A;  4POB A;  2LRT A;  4TOP A;  1SD8 A;  1R26 A;  3D4T A;  3KP9 A;  1ACV A;  3KP8 A;  4EKZ A;  4IQ1 A;  1PL1 A;  3APS A;  2LQO A;  2VD1 A;  1URM A;  1K3Y A;  1E6B A;  2V41 A;  2GTU A;  1ZYN A;  3RDW A;  2MMA A;  4WR4 A;  4OWY A;  1FOH A;  4EUY A;  1TTZ A;  4IP6 A;  2IIY A;  5D9V A;  4GST A;  4BWS A;  3E0U A;  1R5A A;  4A5P A;  3QAV A;  1WP0 A;  1T8E B;  4IGJ A;  4N11 A;  6GSS A;  2GGT A;  1KBN A;  1ON4 A;  1K0O A;  2GZZ A;  1K0D A;  3HKR A;  4ZL9 A;  2LRN A;  2CV4 A;  2DSA A;  2O87 A;  3D6I A;  4G0K A;  2I4A A;  5IMV A;  3GX8 A;  3CYN A;  2WS2 A;  5G1K A;  5JCG A;  3HJP A;  1X0R A;  4TR0 A;  2PBJ A;  4F0B A;  1TKD B;  3FR9 A;  3F3R A;  1XWB A;  2FWG A;  4YAV A;  2JSZ A;  4PUR A;  3M1G A;  3O76 A;  1SKR B;  4EDY A;  1HQO A;  4AJ8 A;  4LLR A;  3J7Y b;  1I9D A;  5HFG A;  4TXO B;  4K1F A;  4WEY A;  1DSB A;  2EIR A;  3VI5 A;  5G30 A;  4ECC A;  2VL9 A;  3F4S A;  4JBB A;  2RUF A;  3CTF A;  2XHF A;  4HOJ A;  6GSV A;  1WJK A;  2HRF A;  1OYJ A;  2VLT A;  3EC3 A;  1ABA A;  5J41 A;  3G7I A;  5L71 A;  2VLU A;  4GLT A;  1T3B A;  2IFQ A;  2FWF A;  2R4V A;  1O73 A;  2JZR A;  3AY8 A;  1Z9H A;  5DQY A;  4ILF A;  2C4J A;  3LG6 A;  4MH2 A;  2TRX A;  5J4U A;  1AQV A;  4NV5 A;  1VGL A;  3KH7 A;  2VCQ A;  5KEJ A;  3LYK A;  2DLX A;  4J57 E;  3EYT A;  2IL3 A;  1LJR A;  1GUM A;  1PRX A;  4ML1 A;  3UIW A;  4O5Q A;  2IYJ A;  1O7U A;  5ELA A;  1XVW A;  3K8N A;  2YP6 A;  5DAL B;  1JLW A;  1A2L A;  5AIV A;  2IMK A;  5ABR A;  3IDV A;  4JU5 A;  5IO0 A;  1W4V A;  5J9C A;  4EL1 A;  2L4Q A;  4WR5 A;  3WGX A;  4I2U A;  1QMV A;  3L9V A;  4EXJ A;  3HA9 A;  4GSN A;  3LXZ A;  1FB6 A;  1FW1 A;  3H1N A;  3Q74 A;  1YJ6 A;  2RLI A;  3VI7 A;  4WXT A;  2X49 A;  9GSS A;  1A8Y A;  1PQN A;  1GSU A;  2D2Z A;  2HLS A;  2VIM A;  3DIE A;  3F6D A;  4ZL7 A;  1WMJ A;  1OC8 A;  5ECS A;  4JR4 A;  3ZML A;  4I2T A;  5DJM A;  2MBS A;  2H8L A;  1Y25 A;  1XW5 A;  4RUV A;  1OKD A;  1EOH A;  2WUL A;  1FHE A;  3G9B A;  3ERW A;  1RW1 A;  4OD7 A;  3WT2 A;  2A4V A;  1YQ1 A;  1X9W B;  3DRN A;  1GH2 A;  5ECN B;  2HE3 A;  4EF0 A;  3NZN A;  2P5R A;  5D93 A;  6GST A;  4XS1 A;  4YAP A;  2DMM A;  3G7Y A;  5CP1 A;  2HSM A;  1BG5 A;  1DUG A;  2R0C A;  3GTU A;  1JLV A;  2PU9 C;  3QAG A;  7GSS A;  3TDG A;  1LU4 A;  1GTU A;  3M0F A;  4GQF A;  1TI3 A;  19GS A;  3F4T A;  3N5O A;  5B7C A;  3CSI A;  2R2J A;  4EE0 A;  1K0M A;  4EIQ A;  2JZT A;  3TUE A;  1GNE A;  1JZO A;  1AIU A;  4LMW A;  3IA1 A;  1U6T A;  2OAC A;  3RBT A;  1M0U A;  2L57 A;  2REM A;  4GRF A;  3GSS A;  1J9B A;  2GVP A;  1YEP A;  1ILO A;  1G6Y A;  2B1L A;  2RII A;  5KOW A;  3TKP A;  2PER A;  4F2I A;  2M72 A;  2CX4 A;  2MYG A;  3F0I A;  2C0F A;  3RHB A;  4PNF A;  1F3A A;  3TKQ A;  1G0T A;  2JU5 A;  2VD0 A;  4G2E A;  1CQH A;  3H8Q A;  3D0Z A;  4V1A g;  4MMM A;  3PR8 A;  1SK1 A;  1F9M A;  5H5Q A;  1OC3 A;  4I97 A;  5CNW A;  2B6M A;  2K18 A;  2CZ2 A;  2GSS A;  4WBJ A;  5J5N A;  3L0H A;  4V2L A;  4ECJ A;  1Z5Y E;  4JE1 A;  2FWE A;  4MH3 A;  3KMO A;  5IMC A;  3LSZ A;  1Y6E A;  5B6N A;  4XRA A;  4KX4 A;  2PPT A;  4GF0 A;  4WET A;  2PVQ A;  4IHU A;  3WT1 A;  2H66 A;  5G31 A;  3P90 A;  3HZ8 A;  4WF5 A;  1SYR A;  3SWL A;  2DIZ A;  5IM9 A;  5D9T A;  5GAN D;  1J08 A;  3FZ9 A;  5CRE A;  1SYX A;  3TGZ A;  2KOK A;  4HI7 A;  1X9S B;  4NXI A;  4ZBD A;  1A24 A;  4POK A;  1GTB A;  1AQW A;  5LCZ A;  1KEB A;  3QFA C;  2FUG 2;  1OC9 A;  2YAN A;  2DJK A;  2OE3 A;  5F8B A;  4GCI A;  2O7K A;  2KP1 A;  3IE3 A;  2NVL A;  1AXD A;  3C1R A;  3J7Y k;  4GQC A;  3UVH A;  4KF9 A;  2B5X A;  2HZE A;  3UBK A;  1OKT A;  2HYX A;  1F2E A;  1OE8 A;  2JAD A;  4MPG A;  4J2F A;  1K3O A;  2K9F A;  2QGV A;  2UZ8 A;  2FA8 A;  4FYC A;  3ZLP A;  5DCH A;  3BJ5 A;  1NHO A;  1JFU A;  1TU8 A;  5DBQ A;  4N30 A;  2XC2 A;  2DJ3 A;  3IAS 2;  4USS A;  5IMZ A;  2EIO A;  2KUC A;  3GKM A;  5G2Z A;  2HFD A;  5FHI A;  2GZP A;  4ECB A;  2I1U A;  2H0H A;  4Z2R A;  5DVB A;  1SL1 B;  3P2A A;  4Z2U A;  3P7X A;  3TKS A;  5E59 A;  5ID2 A;  5CRG A;  2P5Q A;  3L4N A;  5GSS A;  4JR6 A;  5ID2 B;  1EP7 A;  4KW6 A;  1EV4 A;  3CSH A;  3KTB A;  2VL2 C;  3GKN A;  3HVV A;  2YWI A;  12GS A;  2IWT A;  4O7H A;  1QFN A;  4KDX A;  2HNL A;  2FA4 A;  4N10 A;  1ZOF A;  5JWR B;  1PSQ A;  5D8I A;  6GSX A;  4X1U A;  1VF2 A;  4HUA A;  4G10 A;  4KCE A;  2H30 A;  2LNT A;  4EIP A;  2YNX A;  2YJH A;  4MZB A;  1R5P A;  5D96 A;  1FVJ A;  2G2Q A;  5D73 A;  3ERG A;  1Z3E A;  3EU3 A;  5EY6 A;  3PH9 A;  2H6Y A;  4K8M A;  4MF7 A;  2CQ9 A;  5AN1 A;  1UVZ A;  2YWM A;  5KN1 A;  1S3D A;  1GSY A;  2F8A A;  3QCP A;  4TR1 A;  5HFI A;  5HQP A;  3U5R E;  4YKF A;  4PQ1 A;  1NSW A;  3GST A;  3QOU A;  2WGR A;  4IJ3 A;  3ZFB A;  5A4U A;  4F82 A;  3ZIT A;  1UN2 A;  4G0I A;  3IV4 A;  4MDC A;  1TU7 A;  4XS4 B;  2LEG A;  3C1S A;  2VUP A;  3CTG A;  4IP1 A;  4L0W A;  2VLV A;  1T7P B;  3D4M A;  3GYK A;  2C0G A;  4KH7 A;  1GWC A;  2H71 A;  2MMO A;  1TRW A;  2E2M A;  2N5A A;  3ED3 A;  1XIY A;  4KGI A;  5CRH A;  3OR5 A;  4K0G A;  3C8E A;  2IME A;  2AUV A;  16GS A;  3PGT A;  3QFB C;  1ZCP A;  3H93 A;  1FO5 A;  2V32 A;  1RK4 A;  3KGK A;  3I6A A;  3TKR A;  2YCD A;  5GST A;  2OBI A;  2AV4 A;  1Z7P A;  4GXZ A;  3A2W A;  2IN3 A;  4JRR A;  1U87 A;  2HRA A;  3ZIJ A;  1NM3 A;  1TI1 A;  2O85 A;  2G0F A;  1ERV A;  2VCT A;  4OMV A;  1HYU A;  5KN0 A;  3DEX A;  3NIV A;  2V6K A;  3DXB A;  5ECQ B;  4ZB8 A;  2R5G A;  1BAY A;  4D73 B;  2ON7 A;  3WGD A;  4D73 A;  2X8H A;  4Q5N A;  3GL5 A;  4PTS A;  2I81 A;  3ZZX A;  2M46 A;  4PXO A;  1LBK A;  3NOF A;  1F3B A;  1T00 A;  3HJM A;  3VPQ A;  3TKS E;  4RQR A;  1JZR A;  2H75 A;  2GT5 A;  4HQZ A;  4KSM A;  10GS A;  4FYU A;  4MF6 A;  1XWK A;  2WRT A;  3TJG A;  3VPT A;  4F9Z A;  4OO5 A;  2GST A;  2ON5 A;  4TXV A;  3HCZ A;  1J0F A;  3EPT A;  2C3Q A;  2R0P A;  3UBL A;  2CAQ A;  4FQU A;  1I5G A;  3IBH A;  3VWV A;  1GTI A;  3LW9 A;  4ZL8 A;  1CQG A;  2LQQ A;  3DWV A;  4HQS A;  2FNO A;  3KIJ A;  3EMX A;  4HDE A;  5F0G A;  1PGT A;  2OBK A;  1GSD A;  1BX9 A;  1YF0 A;  1ML6 A;  2YN1 A;  3ZVJ A;  1VF3 A;  3D5J A;  4MLY A;  3VLN A;  1X5C A;  2VO4 A;  3VWX A;  3ZL5 A;  1SKW B;  1QGV A;  4OCE A;  3G7J A;  3MWH A;  2FCH A;  3HDC A;  2R3X A;  3ZIV A;  1WPI A;  4TN8 A;  1EEJ A;  3L78 A;  6GSY A;  3IR4 A;  2WB9 A;  3A2V A;  4F03 A;  1A23 A;  2EC4 A;  4HZ2 A;  2N5B A;  4IJI A;  2OA7 A;  1GNW A;  2HSH A;  2BJX A;  2C1Y A;  2HRN A;  5ECO B;  2E2G A;  2HRK A;  5CRD A;  2WCI A;  5EL8 A;  2O89 A;  5HR3 A;  2VCV A;  4YQM A;  3A5W A;  2X4A A;  2B7K A;  3FHK A;  2VCW A;  1R4W A;  4TVE A;  5C00 A;  5JWQ B;  1MD3 A;  5DAL A;  3FEU A;  2CT6 A;  4BA7 A;  2J23 A;  1PMT A;  2AHE A;  1FAA A;  2IMF A;  2V1M A;  3F8U A;  5HR1 A;  1K0N A;  4NAX A;  2I3Y A;  3E3E A;  1B8X A;  2PVO C;  4YQU A;  2H76 A;  1TDI A;  3HVX A;  1K0B A;  2HI7 A;  4MJA A;  1USB A;  3DYR A;  2KLX A;  2GSR A;  5ELG A;  5BRT A;  1HNC A;  1U88 A;  1WRY A;  3VFI A;  4MK3 A;  1YY7 A;  3IHQ A;  4FO5 A;  1Q98 A;  1S3C A;  1FB0 A;  18GS A;  1SL0 B;  2PN8 A;  4N0V A;  2L6D A;  3ZRD A;  4CY6 A;  2FD3 A;  1V2A A;  3M8N A;  3W6G A;  2C8U A;  3E9J B;  3U6V A;  5ECR B;  2GS3 A;  4XS4 A;  4MAB A;  2RUE A;  1MDI A;  2VL2 A;  2BMX A;  3QDN A;  4MCU A;  4MF5 A;  2WDU A;  3ZFL A;  4G0L A;  1YEX A;  4FIW A;  2H1G A;  1THO A;  1GRX A;  1EP8 A;  2GLR A;  4L5L A;  1H75 A;  3KD0 A;  4IS0 A;  3ERF A;  5HR0 A;  3UMA A;  3ZRE A;  1B9Y C;  2L5O A;  4ZIJ A;  2E0Q A;  3CXG A;  1EZK A;  2OAD A;  1KTE A;  3GKK A;  2A4H A;  3LJR A;  3A5I A;  1X9M B;  1SK2 A;  2WJU A;  3TRX A;  2TRC P;  4OFN A;  2GQK A;  2H19 A;  3TJF A;  4HZ4 A;  1XWC A;  5A4W A;  1PA3 A;  2RM6 A;  2GDR A;  5G1L A;  1PL2 A;  4I8B A;  1S3A A;  2C3N A;  3GHA A;  5F07 A;  4WF4 A;  1ZZY A;  3IPZ A;  4HEA 2;  4YQV A;  5IOX A;  4I5Q A;  2HXK A;  2LUS A;  4Q5R A;  2E7P A;  4PQH A;  4TXO A;  3FR6 A;  3EUR A;  2YWN A;  2BTO T;  1IYI A;  2CZ3 A;  1K0A A;  4XTS A;  4XRD A;  4F0C A;  1TP9 A;  2H6X A;  3SBC A;  1F6M C;  1E2Y A;  2YV9 A;  4OCF A;  1WE0 A;  4YH2 A;  1PN0 A;  4TR3 A;  3TOU A;  4O32 A;  4TRX A;  2CAI A;  3F6F A;  1GSQ A;  2FHE A;  3BOA A;  3QR6 A;  1FOV A;  1O6J A;  2H72 A;  1N8J A;  2GT6 A;  5BMU A;  3H4K A;  2QA2 A;  3H79 A;  1AW9 A;  2AYT A;  5IQY A;  2AJQ B;  1G7O A;  1UC7 A;  3ISO A;  3HZ4 A;  2LTK A;  4OO4 A;  2YOI A;  3TCO A;  1O81 A;  2H1B A;  2DJ1 A;  4ZB9 A;  4L0U A;  4MNN A;  2B7J A;  3HVS A;  2X8C A;  1TXX A;  2X99 A;  2A2R A;  1GLQ A;  1Z7R A;  4DSS B;  3I43 A;  1XWA A;  1XPV A;  2OJL A;  3ZYW A;  5ECH B;  1GP1 A;  5DAK A;  3TKS C;  2M80 A;  5ENU A;  3GUS A;  14GS A;  1JHB A;  1FG4 A;  2AAW A;  3FW2 A;  4MJC A;  1C72 A;  2GQL A;  4IBP A;  5G5E A;  4E8E A;  4BL7 B;  3IC8 A;  1KNG A;  3DGQ A;  4CY8 A;  1ZYE A;  3UAR A;  2OE1 A;  4MZW A;  4CHS A;  2V6O A;  5F06 A;  2PUK C;  1O8W A;  1XXU A;  2VL3 A;  3S9F A;  1OVN A;  4DVC A;  3WGE A;  2LV3 A;  3CRU A;  3FK8 A;  5A5K A;  2IMI A;  5ECP B;  1M9B A;  2QKE A;  5JCW A;  3EWL A;  2VCX A;  5J3R A;  3UEM A;  3M9J A;  3A3T A;  4HU7 A;  5KOX A;  4Q5F A;  5JCU A;  3TOT A;  4KDU A;  13GS A;  1HNB A;  4ZBB A;  1ZL9 A;  4OFM A;  1TJD A;  4TR1 B;  1GSF A;  4K7I A;  2XBI A;  1TRS A;  2L59 A;  3D21 A;  1XWG A;  4MPF A;  4IW9 A;  5D9X A;  4RI7 A;  2IPA A;  2TIR A;  1AC1 A;  3BBY A;  5ECM B;  2ALB A;  2IY2 A;  3F63 A;  4ICY A;  2PMT A;  5DQS A;  3UOM A;  4BWQ A;  1QQ2 A;  2DC5 A;  11GS A;  1TK8 B;  3GIX A;  3Q19 A;  1YKA A;  1PX7 A;  1V9W A;  4J56 E;  2GSQ A;  1XOB A;  1M2A A;  4ULX A;  4QL9 A;  2VAF A;  4XS6 A;  4LL4 B;  2FGX A;  2XPE A;  4EC0 A;  1ZMA A;  2Z9S A;  2J9H A;  5HR2 A;  1AUC A;  1W89 A;  3PIN A;  3FKF A;  2WFC A;  1Q4J A;  5INY A;  2XPD A;  4YKG A;  2C3T A;  1TW9 A;  5AGY A;  2X8G A;  3PPU A;  5IMA A;  3LGC A;  2DML A;  2LS5 A;  3UVT A;  1PD2 1;  1G7E A;  3WD6 A;  2H1A A;  1ZGN A;  4K0N A;  3CBU A;  4ZB6 A;  1BJX A;  2LKU A;  2N5F A;  3KXO A;  1ERU A;  2LST A;  3APQ A;  3QPM A;  4ECI A;  1PKZ A;  1A2J A;  5ECI B;  1GUH A;  2JAC A;  2AB6 A;  4E8H A;  1YKC A;  3R2Q A;  3VWU A;  3FY7 A;  1SL2 B;  1SK0 A;  3CRT A;  1EGO A;  2JL4 A;  4X0X A;  3JCM L;  4K2X A;  1G6W A;  3LOR A;  5DJL A;  4KSO A;  2WZ9 A;  1Z6N A;  1B9X C;  1SJ6 A;  5FWG A;  1OAZ A;  1GUL A;  5HFK A;  3UL3 A;  2ZNM A;  5H5S A;  1JZD A;  4IQA A;  2F9S A;  1M9A A;  4P3Y B;  4RI6 A;  5DAK B;  2K8V A;  3HD5 A;  6GSW A;  8GSS A;  2A2P A;  3O3T A;  3GH6 A;  4KE3 A;  1A0F A;  3TJJ A;  4TW5 A;  3US3 A;  2DJJ A;  2ZCT A;  3D22 A;  3TB2 A;  2LRC A;  4H86 A;  4LMV A;  2NPB A;  3HJO A;  1A2M A;  5KN3 A;  4NHW A;  4BVY A;  3GFK A;  4KUN A;  2QSI A;  3GRX A;  1GUK A;  3BCI A;  6GSU A;  3EU4 A;  2H73 A;  3IXR A;  1UA5 A;  5B6M A;  1YDK A;  1Z6M A;  1DBY A;  2L6C A;  3LEF A;  2L5L A;  3ME7 A;  2H0I A;  3Q18 A;  3M9K A;  1EWX A;  1DE1 A;  3IC4 A;  1XFL A;  2IFQ B;  5G5F A;  5GAP D;  3ME8 A;  4HJM A;  5IIZ A;  1B4Q A;  4G9H A;  3KTL A;  5KN2 A;  1MD4 A;  4KA0 A;  2P31 A;  1IYH A;  2H70 A;  2CA8 A;  4XIH A;  3GKX A;  4I6X A;  3DML A;  1AQX A;  4IN0 A;  4V2N A;  4AGS A;  4GTU A;  4BVY B;  2RM5 A;  1U3I A;  5CRW A;  5FT3 A;  4OFT A;  2JSY A;  2HZF A;  2NDO A;  4JZQ A;  4KCA A;  3RPN A;  5EPF A;  4HS1 A;  2CVD A;  3LYP A;  2HZE B;  4N0Z A;  2YJ7 A;  4FH8 A;  4PGT A;  4K6X A;  4QQ7 A;  5DCG A;  3KCM A;  2MZC A;  2DJ0 A;  4O5U A;  3QAW A;  1QK8 A;  3BD2 A;  3DVX A;  2CVB A;  1ZYP A;  2VOC A;  4Z7X A;  3KZQ A;  2QC7 A;  4FYB A;  1NW2 A;  1ST9 A;  2IMD A;  1GTA A;  4K7N A;  20GS A;  5A4V A;  17GS A;  5IPG A;  3EIN A;  1PN9 A;  1X5D A;  2C0D A;  3IAM 2;  1MDK A;  1XZO A;  3DVW A;  2V2G A;  3LFL A;  1EV9 A;  4O92 A;  5DDL A;  1NHY A;  5IMD A;  1GSS A;  1QXH A;  1WIK A;  3BCK A;  3RPP A;  1EGR A;  2CVK A;  5IMF A;  1QUW A;  4L8E A;  3EVI A;  3RAZ A;  3R3E A;  3DD3 A;  4L5O A;  1F37 A;  3W8S A;  4XHM A;  3MAK A;  1T1V A;  1VF4 A;  1M2D A;  4MA9 A;  1ZYQ B;  1M99 A;  2NBS A;  1XOA A;  3I69 A;  4PUF C;  4LA1 A;  22GS A;  1TK0 B;  2H74 A;  1EEM A;  2FY6 A;  2B1K A;  4V1A p;  3TRP A;  3UJ1 A;  3L9S A;  5LD0 A;  5EVO A;  1SJI A;  5CO3 A;  1B48 A;  3KJY A;  4EO3 A;  1ERT A;  2P0G A;  3MIX A;  5E4W A;  2R0G A;  2I9H A;  5COH A;  3A2X A;  3FZA A;  1H4O A;  1V98 A;  4IKH A;  4DSS A;  1YF1 A;  4V2M A;  4IEL A;  1TRV A;  5AIS A;  3F3Q A;  1X5E A;  2OKA A;  4HJ2 A;  5H5R A;  3WYW A;  2MBT A;  3FYG A;  3GX0 A;  1PX6 A;  1XBS A;  4CDO A;  2K8S A;  4GWR A;  4ZIL A;  2K6V A;  3ZTL A;  4GSS A;  3LQ7 A;  3HYP A;  2H01 A;  2R37 A;  4PX1 A;  5IPH A;  4WBR D;  4NHZ A;  2NTO A;  2XBQ A;  3IK9 A;  2GZY A;  4RQX A;  2DJ2 A;  1SEN A;  1K0C A;  2L4C A;  3FMW A;  4CW9 A;  4MZC A;  4POM A;  1JZW A;  3GN3 A;  3FR3 A;  1DE2 A;  5ECK B;  3GTU B;  3TJK A;  4KDY A;  1T4Y A;  3IK7 A;  1GSE A;  2DBC A;  1WWJ A;  2HT9 A;  3MDK A;  2F51 A;  2DKI A;  1WOU A;  1TRU A;  1HNA A;  4KND A;  5F05 A;  4NWY A;  4IVF A;  4LL1 B;  3FZ5 A;  4K2D A;  3HXS A;  2LJA A;  1V40 A;  1O85 A;  1R7H A;  4WKW A;  4NPB A;  4NV2 A;  1T4Z A;  4K5R A;  5CYY A;  3N9J A;  3GL3 A;  2KP2 A;  1A8L A;  3F9U A;  4TR4 A;  1SJZ A;  3ZMK A;  1V57 A;  2C80 A;  1VF1 A;  3ZVJ D;  1V58 A;  2F8F A;  3GMF A;  4MJE A;  4EVM A;  2PGT A;  2LNS A;  5B8B A;  1SD9 A;  2H6Z A;  2YV7 A;  1THX A;  1K3L A;  1GLP A;  1MDJ A;  4MP4 A;  1A0R P;  2HSY A;  2H0G A;  2YZH A;  4PQI A;  3EE2 A;  4K5S A;  3DKS A;  4PUA A;  1O8X A;  3UAP A;  5C04 A;  1AAZ A;  4DEJ A;  3QMX A;  1TK5 B;  5JWO B;  4KAE A;  3VWW A;  4ZBA A;  3TJB A;  1M7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...