1G0TA

Dsbc mutant c101s
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1g0tA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g0tA02
1AQVA 4ZXGA 4HZ2A 2H0HA 5F06A 5HR2A 1KBNA 2VLTA 3G7YA 1T4YA 2CT6A 3KMNA 3D4TA 1HYUA 4Q5NA 3TJGA 1HQOA 4ZILA 2B7JA 2OE3A 4ZBDA 1EP7A 4EUYA 5IMAA 1K0CA 2H73A 3CSJA 2YV7A 2YANA 1TKDB 2VIMA 1F3BA 2HXKA 3C73A 1Z7RA 3J7Yk 4YAPA 1NHYA 4F0BA 2A2SA 1SKRB 4KCEA 9GSSA 1OC9A 4WXTA 3GFKA 2LQQA 3KGKA 3TOUA 1JFUA 3TKSA 3HZ8A 2YJHA 4O7HA 1R26A 1A24A 5AN1A 3D22A 1NHOA 3GRXA 3QDNA 1X0RA 2MMNA 2DSAA 2WRTA 2H01A 3S9FA 2QSIA 2CV4A 4POLA 5GZZB 3U6VA 2DJ0A 3BD2A 5H5SA 2TIRA 4GSTA 5DQYA 2CZ3A 1O8XA 1YZXA 1T1VA 3VWVA 1PA3A 2CAQA 5IQYA 2R6KA 3H8QA 3VPTA 1HNBA 2KLXA 2H76A 2B1KA 1Q4JA 3ZMLA 3DYRA 4K8MA 2B1LA 3KZQA 3UARA 2YJ7A 3L9SA 3KTLA 2PERA 2V41A 4IW9A 2QKEA 3VWWA 5IOXA 2VCVA 3QAVA 2B5EA 2O8VB 2VLVA 1XW5A 2HE3A 2HSHA 4K2DA 4DSSB 1O8WA 1UC7A 2ON7A 3LXZA 2H70A 2R37A 2LNSA 1T00A 4XRDA 3GL5A 3F3RA 2YPMA 4BVXA 1KTEA 2F9SA 3U5RE 4TR1A 3M9JA 3Q74A 2EIOA 4MA9A 3HHVA 4O5RA 1YDKA 3QOUA 3TOTA 1ERUA 1GSDA 2CA8A 2LUSA 1S3DA 4YAVA 3V1WA 4BWSA 2DIYA 4E8HA 4K0GA 3HKRA 1H75A 5ENUA 3IHQA 4TXVA 2FA8A 2VAFA 3CSIA 1NM3A 4MJBA 5KEJA 3RDWA 1YF1A 1Z5YE 3RPNA 4TVEA 2G0FA 1FO5A 4HOJA 3EE2A 2WFCA 5IOWA 4LA1A 1VF2A 1Z6NA 4XTSA 4F2IA 2K6VA 3IAS2 1O7UA 2HSYA 2P5RA 4PQHA 3M3MA 1F3AA 2C4JA 5H5QA 4BVYA 1XXUA 2YOIA 1M0UA 3FRCA 4GTUA 2IJYA 1B4QA 3HJPA 1FB6A 1GRXA 5B8AA 2WCIA 2LQOA 1B9XC 1XFLA 4TR4A 4OCFA 5IMFA 3KH9A 1F9MA 1GUHA 4OO4A 1BEDA 1HNAA 1NSWA 5GSTA 5HFKA 1BJXA 5IM9A 5D9VA 3WD6A 5FT3A 1U3IA 4OMVA 4DEJA 2XBQA 3IDVA 1K3LA 1WRYA 2ES7A 2H6XA 4HZ4A 3ZREA 4KB3A 5D9XA 3GUSA 4KDUA 4GSSA 2LRNA 2L59A 5GSSA 3A3TA 2KOKA 4J2FA 1V58A 4JR6A 3HD5A 5C04A 4EC0A 3D5JA 2FD3A 1XVQA 4ZBBA 1G6WA 5INYA 4IGJA 4OCEA 5DBQA 1XVWA 4FH8A 5IMCA 4LMVA 7GSSA 4MJEA 3GX0A 5D93A 3W8JA 1O81A 3CTFA 2ALBA 1PX6A 2WZ9A 5EPFA 1XWGA 1V2AA 3ZITA 1XCCA 1A0FA 3DGQA 2C0DA 1T8EB 1YKCA 4HS1A 1A0RP 4MZCA 3KMOA 4XIHA 4G9HA 1BG5A 2YN1A 4ZL7A 3EMXA 5IO0A 1DBYA 3RHCA 2NDOA 4F03A 1S3AA 5E4WA 1WMJA 1OYJA 1XWBA 5ELAA 3F63A 4OD7A 2XHFA 2XBIA 1EZKA 5ECNB 1U88A 1U87A 2FCHA 3LORA 3F4RA 1AC1A 4QL7A 3P2AA 6GSVA 5G31A 2JZSA 2FWGA 3GIXA 3CRUA 4ML6A 4BWQA 3AY8A 1YY7A 1OC9B 3TKSE 4IN0A 3CSHA 2K18A 1X5DA 1EGRA 5ECQB 3LWAA 4ECJA 2H74A 3HY2A 1H4OA 1N8JA 4POKA 2WS2A 3TUEA 2CVKA 11GSA 2O7KA 3QPMA 3GN3A 4KAEA 4JBBA 6GSWA 1MD4A 2LKUA 10GSA 4KSMA 1YJ6A 1GLQA 4EKZA 4JE1A 4GQFA 1PQNA 2HNLA 4AJ6A 3UIWA 3MNGA 1G0TA 2C3NA 2YNXA 5CRHA 2GTUA 1WOUA 2KUCA 3GSTA 2B6MA 3TJJA 1ZOFA 3FW2A 2A2RA 3UEMA 2N5AA 4MF6A 2F3MA 3RAZA 4K7IA 4HI7A 3GKNA 2KP2A 1BYEA 3F0IA 2DIZA 2RLIA 5ELGA 1ZGNA 4MZBA 1X5EA 1EEMA 1V98A 1SYRA 1YQ1A 1ILOA 2HYXA 1USBA 2XPEA 4PURA 5D9WA 3KEBA 1X5CA 3FKFA 3FZAA 1OE7A 1FAAA 1EP8A 1ZMAA 3EWLA 1SL1B 4IP6A 2TRCP 5CRDA 3ZTLA 3F3QA 2DJ1A 1GLPA 5AIXA 5A4WA 4I2TA 1UN2A 1J08A 1O85A 2VL2A 4TR1B 4F82A 3FR6A 5FHIA 4ISDA 1THOA 4KGIA 4N11A 1IYIA 3DXBA 4NXIA 3RHBA 4YQMA 3PINA 4EVMA 3LFLA 4QQ7A 2L5LA 3M9KA 4ACSA 3LYKA 2XPDA 4MDCA 5GAPD 1GP1A 1WWJA 3FK8A 1IYHA 3M0FA 3A2WA 1XIYA 2GZZA 1EOGA 1EV9A 2DMLA 1GSQA 2YZUA 2MMOA 3L4NA 2CVDA 2F8AA 2RM5A 1SJ6A 1EGOA 4HDEA 3LGCA 4AGSA 2I3YA 3G7IA 4IS0A 3VWUA 5ECMB 2WJUA 4NHWA 2WB9A 1ERVA 1YEPA 3DVWA 1DE2A 4PNFA 5KN0A 1VF1A 5J5NA 1PL2A 1EOHA 1PGTA 2LJRA 3E3EA 3KP9A 3QR6A 2ZCTA 3EINA 2RUEA 3HVVA 4KCAA 2V2GA 1TI3A 2CX3A 1EEJA 2P0GA 5G2ZA 1PRXA 4IQ1A 4HQSA 1GH2A 5ABRA 1QGVA 4MJCA 1M2DA 4POBA 1QUWA 1WE0A 2E7PA 4N0ZA 3SBCA 3KCMA 1AUCA 2KHPA 3IXRA 2HI7A 4HQZA 1GUMA 4EDZA 2O89A 4RI7A 1OAZA 3IAM2 3IA1A 5IO2A 3MWHA 4IJIA 2OBKA 1TTZA 4ZL8A 1M2AA 1GTBA 2E2GA 2J9HA 2DC5A 3APSA 3VWXA 2AV4A 1VF3A 3FZ5A 5HR1A 2V1MA 4LLRA 3ERFA 2AAWA 3KXOA 1QXHA 4MK3A 1S3CA 1SK0A 3WT2A 4D73A 1TJDA 3G7JA 1PSQA 1WJKA 4TN8A 3K8NA 1MEKA 1R4WA 2N5FA 3HXSA 1R5PA 4TOPA 1JLVA 2DJJA 1LU4A 3CXGA 3QFAC 1GTUA 2AB6A 5JCGA 4K7OA 3HJOA 4FIWA 4WF5A 1ABAA 1BAYA 3UL3A 4ECIA 1SJIA 4JZQA 4KDYA 3CBUA 2CAIA 2L6CA 2GSQA 4FYBA 1X9WB 1JZOA 1VRSD 4GXZA 2OKAA 5B6MA 2L4CA 2GDRA 1PL1A 3TB2A 2C0GA 4TRXA 4ZIJA 1FW1A 3I6AA 2IPAA 3TRPA 1ZL9A 3GH6A 2ZNMA 3F6DA 5F07A 1XWKA 4WF4A 4X0XA 1B48A 2A4VA 3EU4A 1LBKA 3MDKA 1OC8A 2MMAA 4BPYA 5LCZA 1M9BA 4MZWA 4MF7A 4I6XA 3A5WA 2H1DA 2X64A 4K1FA 4NHZA 4KW6A 1K0BA 2HZEA 1XOAA 1FVJA 4I97A 2MMZA 5B7CA 2HRFA 1UA5A 5DCHA 4MPGA 2IMFA 1PX7A 5EY6A 4OO5A 2LJKA 1AQXA 4HJ2A 1AQWA 1R7HA 4JRRA 1A2LA 4GLTA 4FYUA 2IMDA 2DLXA 2MBSA 2VCWA 3APQA 3TJFA 2CX4A 2I81A 2FY6A 3FYGA 5CNWA 1TK8B 2Z9SA 3BBYA 2FUG2 1TU8A 3ZZXA 3O6TA 3D0ZA 2V6OA 2M80A 2OE1A 3J7Yb 1AIUA 4L8EA 1TK0B 2VOCA 3H79A 3ZRDA 1K0AA 4ZBAA 5KN2A 1QQ2A 3QD9A 1G7OA 5ECPB 3TKQA 2PN8A 3LG6A 2H71A 4WKWA 4P3YB 3IRAA 1GSFA 2VL9A 5DAKA 3TKRA 4IQAA 4O32A 2WULA 5DJLA 1GNWA 2PPTA 1A8YA 1ST9A 3DD3A 22GSA 2JSZA 2G2QA 1SD9A 3QAWA 2C80A 3NZNA 4XS4B 2YP6A 4YQUA 3LJRA 2VM2A 4FYCA 4XS1A 5CREA 18GSA 3QFBC 5ECLB 4MH3A 2B5XA 4KSOA 4E8EA 2H75A 1JZRA 2GT6A 2YWOA 4V1Ag 3C7MA 2GSSA 3PH9A 3C1SA 2N5BA 2VCZA 2H0IA 1I9DA 1V9WA 4AJ7A 1NW2A 3BJ5A 2EC4A 3W8SA 2RIIA 2R3XA 1WP0A 5JWOB 2GVPA 6GSSA 1FG4A 2NVLA 6GSXA 1FVKA 3VI7A 1X9SB 3DVXA 4IKHA 2PWJA 2AJQB 3P7XA 1O73A 5ECKB 4X1UA 1AW9A 3KD0A 3Q19A 3FZ9A 4IELA 5IPHA 3DMLA 4KA0A 4F9ZA 4KH7A 4MH2A 4XCSA 2NTOA 3DEXA 1XZOA 2C1YA 2L57A 5AGYA 1OE8A 2PBJA 3GMFA 3R2QA 3I9V2 3KH7A 3TKSC 3EYTA 5J3RA 2FA4A 1Y25A 5CRWA 4JU5A 1GULA 3GNJA 1SKSB 4X43A 4D73B 2EIQA 2YWNA 3VPQA 5F0GA 4PGTA 1AAZA 1TXXA 4OWYA 2YWMA 3IC4A 1A2MA 2C0EA 4OFMA 4IBPA 2PVQA 3EU3A 3FEUA 5IPGA 3APOA 2VUPA 3UMAA 2YWIA 1TRUA 2GGTA 1Z7PA 4ILFA 2IMKA 1RK4A 1DSBA 2EIRA 2P31A 3RBTA 2O87A 1VF4A 2VO4A 2H72A 2L4QA 4V1Ap 2DMMA 4K0NA 2QC7A 3EC3A 4ML1A 3TKPA 2K9FA 3ME8A 1MDJA 1K0DA 5J9CA 4AF2A 1MDIA 2OACA 1U3AA 5LNKe 3ZFBA 3VK9A 5CYYA 1CQGA 2HFDA 4ZB8A 1XW6A 5HQPA 2FHEA 2IL3A 3ED3A 2NPBA 4GRFA 3WYWA 5G5FA 3SWLA 1QFNA 4EXJA 3FY7A 4EO3A 1B4PA 2VD1A 1TDIA 3I43A 1WPIA 1A2JA 3P90A 5HFIA 2GQLA 2D2ZA 3M8NA 5FWGA 3HDCA 3GYKA 5D8IA 2X99A 4K7NA 2HZEB 3O76A 2IN3A 2VCXA 1RW1A 3LSZA 2CVBA 4NPBA 1E6BA 5CP1A 2H1AA 2ZUPA 2DJKA 16GSA 2DBCA 3ZVJD 2GQMA 4K6XA 4OFNA 2JACA 5C00A 1JHBA 1XBSA 2C0FA 2CZ2A 3ZMKA 2C3TA 2LS5A 3TGZA 3GKKA 1TOFA 2GZPA 2HZFA 3KTBA 3DIEA 5HR3A 2P5QA 2JZTA 5DJMA 3EURA 1SL2B 3GTUA 4J57E 3FHKA 3TCOA 3TRQA 4J56E 3F4TA 3TJKA 1J9BA 4NV5A 2LRCA 4ZB6A 1SU9A 5ECIB 1K0OA 2XC2A 4YH2A 3C1RA 3D6IA 2OA7A 2LRTA 2X8GA 3GX8A 2IFQA 3C8EA 1EV4A 4G10A 3DKSA 5DAKB 3L9UA 3I69A 2K8SA 2DJ2A 3IOSA 1GSSA 3UVHA 1PD21 1W89A 2H6YA 2H8LA 5ECOB 1GSUA 1HD2A 3ZIJA 2IYJA 3Q6OA 4K9ZA 4WEYA 1W4VA 3HJMA 1F2EA 3A2VA 1T3BA 1I5GA 4TKYA 1AXDA 3M1GA 2J23A 4L5LA 4KNDA 1SENA 4PQ1A 1QMVA 3RPPA 3BCKA 2V32A 4KX4A 1G7EA 4MCUA 2IWTA 4WR5A 5CAXA 2YCDA 5CRGA 4MP4A 2H6ZA 1FB0A 3F4SA 4N10A 3GKMA 3EMPA 5D9TA 2B7KA 2H19A 2TRXA 3GHAA 1SK1A 2FWHA 2I9HA 4JR4A 2WGRA 3H1NA 1Q98A 4WETA 1R5AA 4RQXA 2B5YA 4PUFC 2LV3A 1BQ7A 3UAPA 3QCPA 4KE3A 3WGXA 4L5OA 3LEFA 4WR4A 4GCIA 2B3SA 1TW9A 2IMEA 2E2MA 2X8HA 2VCQA 12GSA 2FWFA 2VL3A 3GV1A 4DSQA 5ECSA 19GSA 5DALA 2DJ3A 5H5RA 2PUKC 5ID2A 1ERWA 2V6KA 8GSSA 3QAGA 2CQ9A 3VFIA 4V2NA 4MLYA 4I8BA 2IMIA 3HZ4A 3BOAA 1FHEA 3US3A 3ERWA 2ON5A 3KM6A 4Q5QA 4V2MA 4Z7XA 4IP1A 3LQ7A 3ME7A 3TJBA 5G30A 4LMWA 4TR3A 3KP8A 5EL8A 1VGLA 1JZDA 1ML6A 2M72A 5EVOA 3W6GA 5JCWA 2AHEA 3JCML 1M2BA 3HA9A 4NV2A 4HU7A 1ACVA 6GSTA 2AUVA 1GSYA 3N5OA 4TW5A 3L78A 3ZLPA 3E0UA 4LL4B 4EL1A 1O6JA 2MZCA 5F05A 1PKZA 4TXOA 5JWQB 4ZB9A 1N2AA 4CDOA 1GTIA 2PGTA 1ON4A 4HEA2 3FR3A 1OC3A 4F0CA 1K0MA 2H1GA 2F51A 3FZ4A 2VL2C 4PNGA 4N30A 4YQVA 1OKDA 3GA4A 4CHSA 1OVNA 3H4KA 3ZL5A 1OKTA 2H0GA 1QK8A 1GWCA 4JEDA 2O85A 3L0HA 4KUNA 1G6YA 2MYGA 3WGEA 4MABA 4IHUA 4IJ3A 2FGXA 5B6NA 5ECRB 1SL0B 1GNEA 2OADA 20GSA 1PKWA 2X8CA 1MD3A 1Y6EA 5AIVA 2PMTA 1EWXA 1KNGA 4MJAA 1V40A 3WT1A 1SK2A 1GUKA 1K3OA 5HR0A 4H86A 1JZWA 5JCUA 2GZYA 1TU7A 2JADA 2H1BA 2IY2A 3P8WA 1MDKA 4I2UA 3CYNA 1TP9A 1T4ZA 5J9BA 3GKXA 4Q5RA 6GSUA 5IMDA 3GH9A 3IK7A 3UVTA 5E59A 5F8BA 2H66A 1HNCA 4XHMA 3GTUB 5G1LA 1M7TA 2VM1A 5LD0A 1JLWA 1DE1A 4DSRA 5ECHB 5A5KA 4ULXA 3NIVA 4LL1B 3KIJA 2MBTA 4GF0A 1WIKA 5KN3A 1TK5B 3LXTA 2KP1A 2YZHA 3NOFA 4O92A 2IFQB 1ZZYA 2BJXA 1BX9A 2JSYA 3EVIA 4PX1A 2NBSA 3QMXA 5AISA 3F6FA 4PUAA 2C3QA 2I4AA 5L71A 3TRXA 1SD8A 2VD0A 2LNTA 1THXA 3PGTA 1PN9A 1XOBA 4EF0A 4I5QA 2FWEA 1FOVA 1TI1A 1XPVA 3D21A 2M46A 2LTKA 3DWVA 3KJYA 4ZL9A 3E9JB 3CMIA 2RM6A 3VI5A 1M9AA 4XS6A 17GSA 3VLNA 4HU9A 4GSNA 4GQCA 3N9JA 1CQHA 1YF0A 2GT5A 2R4VA 1A23A 4ID0A 1Z6MA 1B9YC 3ZFLA 3IR4A 5CO3A 4BA7A 1YKAA 4PQIA 4ECCA 2RUFA 4NAXA 3PR8A 4TR0A 3HYPA 3GL3A 3HVSA 5G5EA 4ECBA 5JWRB 2OE0A 1XWAA 5GAND 5D73A 1T7PB 4DSSA 5DQSA 2VCTA 1YEXA 1TRWA 3L9VA 1TRSA 5A4VA 4DVCA 5D96A 3WGDA 4EE0A 1GSEA 5IMVA 4RI6A 2YV9A 5DDLA 2AYTA 1GL8A 4FO5A 4AJ8A 6GSYA 3GSSA 1ZYQB 2JU5A 2R5GA 4RUVA 2VLUA 3GURA 1ZYEA 1ERTA 3UJ1A 1XW9A 5DALB 1GTAA 5ID2B 2FNOA 1B8XA 4G2EA 3ZIVA 3BCIA 2OBIA 14GSA 3IK9A 5DVBA 1V57A 2REMA 2GLRA 3UOMA 2HLSA 3H93A 4NMUA 3F8UA 3ISOA 3F9UA 2PU9C 1ZCPA 1PMTA 3CTGA 3TDGA 1U6TA 3OR5A 1X9MB 2LJAA 4IVFA 4G19A 4MPFA 4PXOA 5B8BA 1SKWB 2IIYA 4WBJA 3MAKA 3VURA 2QGVA 4CW9A 4TXOB 2GQKA 1RQMA 1E2YA 2HRNA 2JZRA 4MF5A 2R2JA 4OFTA 2LEGA 3IV4A 3IBHA 3DRNA 3IPZA 2BMXA 4GWRA 1URMA 1Z9HA 5IMZA 5KN1A 4KDXA 1KEBA 2JL4A 1F6MC 1M99A 5IIZA 3HCZA 1MTCA 3O3TA 4NWYA 3LYPA 4XS4A 2GSRA 2L6DA 4POMA 1J0FA 3Q18A 1K0NA 3MSZA 1SYXA 5COHA 3G9BA 5J41A 3UBLA 2GSTA 3CRTA 1A8LA 4WBRD 4XRAA 2GS3A 3A2XA 1TRVA 1Z3EA 1LJRA 2WDUA 3D4MA 3UBKA 2C8UA 4EDYA 1K3YA 4QL9A 4BL7A 2HT9A 1UVZA 5A4UA 5G1KA 3ZYWA 1XWCA 4HUAA 1SJZA 3ZVJA 4L0WA 4L0UA 3HVXA 2I1UA 2E0QA 4N0VA 13GSA 5DCGA 5J4UA 2LSTA 2K8VA 2OJLA 4Q5FA 1DUGA 3FR9A 2BTOT 1F37A 3ERGA 2F8FA 2L5OA 4RQRA 4HJMA 2PVOC 3IE3A 1C72A 2FLSA 4V2LA 3C71A 2H30A 5HFGA 4MMMA
chains in the Genus database with same CATH superfamily
2MF7A 1AQVA 1W02A 4ZXGA 4HZ2A 2H0HA 5F06A 5HR2A 1RLSA 1KBNA 2VLTA 3G7YA 1T4YA 1QJGA 1N9EA 2YFLB 2CT6A 3KMNA 3D4TA 1X1XA 1HYUA 4Q5NA 3TJGA 3JUNA 4XBTA 1HQOA 2B7JA 2OE3A 1EP7A 4ZBDA 4ZILA 1K0CA 4EUYA 5IMAA 2H73A 3CSJA 2YV7A 2YANA 1TKDB 3F8HA 2VIMA 2CKFB 4O8SA 3WA3A 2CFDA 1HYFA 1HU9A 1F3BA 2L4VA 2HXKA 3C73A 1Z7RA 2BO9B 3J7Yk 1KQS2 3CPW2 4YAPA 1NHYA 4F0BA 2A2SA 1SKRB 2F99A 4KCEA 3Q90A 2D42A 1O7GB 4EW5A 1E3VA 9GSSA 1OC9A 4WXTA 3GFKA 2XEPA 2LQQA 3KGKA 3TOUA 4BU4A 4MNNA 3WOEB 1TUHA 1JFUA 3TKSA 3HZ8A 2YJHA 3CU3A 3F9SA 4O7HA 4K61A 1R26A 1A24A 3IJEB 4OUQA 8RNTA 5AN1A 1K28A 3D22A 4WHAA 1NHOA 3GRXA 5HOHA 3QDNA 1X0RA 9RNTA 2B24B 2MMNA 2UGIA 2P38A 2DSAA 1VQL3 2WRTA 1NO3A 2H01A 3S9FA 3BU4A 2QSIA 4N6NB 2CV4A 4POLA 5GZZB 3U6VA 1I2EA 1GMPA 5KP4A 2DJ0A 3BD2A 5H5SA 2TIRA 4GSTA 5DQYA 2CZ3A 1TP6A 2XGLA 1O8XA 1YZXA 1T1VA 3VWVA 2W0QA 3F40A 1PA3A 2CAQA 5IQYA 4I4KA 2R6KA 3H8QA 3VPTA 1HNBA 2KLXA 2H76A 4X4JA 2B1KA 1Q4JA 3ZMLA 3DYRA 5IEOA 4K8MA 1X1UA 2B1LA 1UGIA 3KZQA 1O7WB 3UARA 1BRSA 2YJ7A 1BSEA 3L9SA 3KTLA 2PERA 3ROBA 2V41A 1A67A 4IW9A 2AADA 2QKEA 3VWWA 3DM8A 5IOXA 1IDPA 2VCVA 3QAVA 2B5EA 2O8VB 1CEWI 2VLVA 1XW5A 2HE3A 2XFSA 2HSHA 3RGRA 5KP1A 4K2DA 1B2MA 4DSSB 1IT7A 2OCTA 1O8WA 3AMOA 3I563 1UC7A 1W4NA 2ON7A 2C4BA 3LXZA 2H70A 2R37A 2LNSA 1T00A 7GSPA 4XRDA 1VZZA 4L8PA 3GL5A 3F3RA 2YPMA 4BVXA 1KTEA 2F9SA 3U5RE 2BMOB 4TR1A 3M9JA 3FG1A 3Q74A 2EIOA 1YVBI 4K90B 4MA9A 1R4YA 3HHVA 4O5RA 1YDKA 4FMAA 3QOUA 3TOTA 3A76A 1ERUA 3EN8A 1RCLA 4KFDA 3FG4A 1GSDA 1ZX2A 3S28A 2CA8A 3IMAB 2LUSA 4WYKB 5CXOA 1S3DA 2CHCA 4YAVA 3V1WA 4BWSA 1ZO2A 2DIYA 4E8HA 1UUGB 4K0GA 1ZS7A 3HKRA 1H75A 5ENUA 4LEHA 2K3DA 3IHQA 3VF1A 4TXVA 3FKAA 3L0RA 2FA8A 2RFRA 3EC9A 2VAFA 2D1WA 3CSIA 1NM3A 4MJBA 5KEJA 2XSHB 3RDWA 3CCJ3 1YF1A 1Z5YE 3HX8A 3RPNA 4TVEA 4GHOA 1BRIA 1FGMA 2G0FA 1VQK3 1FO5A 3CNMA 1Q40B 5AIGA 4HOJA 1IK3A 4GSPA 2QIYA 3K5TA 3KFQC 1J2BA 2WFCA 1FUWA 3EE2A 5IOWA 3MG1A 4LA1A 1VF2A 5EQLA 1GS3A 2STDA 1LOXA 3AGOA 1Z6NA 4XTSA 3OWSA 4F2IA 1SQWA 1C54A 2K6VA 3IAS2 1O7UA 2HSYA 2P5RA 4PQHA 3M3MA 3D3LA 2F5WA 1F3AA 2C4JA 5H5QA 1GOYA 4BVYA 1XXUA 2CFLA 1RN4A 2YOIA 1JB5A 1M0UA 3FRCA 3LW9A 4GTUA 2IJYA 1BRGA 1B4QA 3HJPA 4K2XA 1FB6A 1GRXA 5ELUA 5B8AA 3D5IA 1QMAA 5LC7A 1RKYA 2WCIA 2LQOA 1B9XC 5LC6A 1XFLA 4KZ1A 3UNLA 4HM5B 4TR4A 4OCFA 1Q864 4RNTA 5IMFA 3NBRA 3KH9A 2OOVA 1MWUA 1F9MA 1GUHA 2BMRB 5BU4A 4OO4A 1BEDA 4LGQA 1HNAA 1NSWA 5GSTA 4CJNA 1MWRA 2W9QA 1QVF2 5HFKA 5IM9A 1BJXA 5D9VA 2PZVA 3WD6A 1I70A 5FT3A 1U3IA 4OMVA 4DEJA 1EUIC 2XBQA 3IDVA 1K3LA 2Z7AA 1WRYA 2ES7A 4N6LA 2H6XA 4OK0A 4BTWA 1YGEA 4HZ4A 3ZREA 4KB3A 1BGSA 5D9XA 3GUSA 4KDUA 3NBBA 4GSSA 2LRNA 2L59A 4HJLB 1QAKA 1FOHA 5GSSA 3A3TA 2KOKA 4J2FA 1V58A 4JR6A 1SIHA 1BUJA 1QAFA 3HD5A 5C04A 3PS8A 3SLUA 4EC0A 3D5JA 2FD3A 3JVCA 1XVQA 1NU3A 4ZBBA 1G6WA 4R9LA 5INYA 8CHOA 1NJI4 4IGJA 3ZG0A 4OCEA 1U5OA 5DBQA 1XVWA 4FH8A 5IMCA 4R4KA 4BL7B 3FF2A 4LMVA 7GSSA 4MJEA 3GX0A 5D93A 4FMCA 3W8JA 1O81A 3CTFA 1X1WA 2ALBA 1PX6A 2K54A 2WZ9A 5EPFA 1XWGA 1V2AA 3ZITA 1DETA 6RNTA 1XCCA 1A0FA 3DGQA 2C0DA 1T8EB 1K41A 1YKCA 4HYZA 4HM2B 4HS1A 1A0RP 4MZCA 5AEWB 3KMOA 3DH2A 4XIHA 3FSDA 4G9HA 2RSXA 1BG5A 1BNGA 2YN1A 2CX1A 2Y74A 4ZL7A 2RNTA 3EMXA 5IO0A 1DBYA 3RHCA 2NDOA 4F03A 1S3AA 4STDA 4FQUA 5E4WA 1WMJA 1OYJA 3CNXA 1XWBA 5ELAA 3F63A 1VQ53 4OD7A 1TTOA 3NM2A 1IVXA 2W56A 2XBIA 2XHFA 1EZKA 5ECNB 1U88A 5ELJA 2R0PA 1DMQA 1U87A 2FCHA 3LORA 2YFIB 3F4RA 1F8NA 1AC1A 4QL7A 2KF4A 3P2AA 6GSVA 2CK3H 5G31A 4JF8A 2JZSA 1PFPA 2FWGA 3GIXA 5GSPA 3CRUA 4EIQA 4ML6A 1YHQ3 2DKIA 4BWQA 3AY8A 1YY7A 1OC9B 3TKSE 1RMSA 1ULIB 4IN0A 1SPUA 2B1XB 2DKHA 3CSHA 2QGUA 2K18A 5RNTA 1X5DA 1EGRA 5ECQB 3LWAA 4ECJA 2KCDA 2H74A 4U13A 3HY2A 2FNQA 1H4OA 4HM1B 1N8JA 4POKA 1LVNA 3KSPA 2WS2A 3TUEA 2CVKA 11GSA 1G96A 5IEPA 2O7KA 3S27A 1RGGA 4EIPA 4Q53A 3QPMA 3GN3A 4KAEA 4JBBA 3BB9A 6GSWA 1JRQA 1MD4A 3DGLA 2LKUA 10GSA 1RGCA 1O7MB 4KSMA 2HMLB 1YJ6A 1GLQA 3CMA3 4EKZA 4JE1A 4GQFA 4Z2UA 1PQNA 2KF5A 2HNLA 4AJ6A 2ZL8A 3F14A 2GU1A 3UIWA 3MNGA 1G0TA 1JBTA 2C3NA 2YNXA 5CRHA 4EBGA 5IG4A 3CD63 3KE7A 4HVNA 1WOUA 2GTUA 2HMJB 2B6MA 2KUCA 3GSTA 3TJJA 1AQZA 1ZOFA 3OX9A 3FW2A 4XDVA 4LMIA 2A2RA 3UEMA 2N5AA 4MF6A 4EYCA 2F3MA 1WTHA 3RAZA 4K7IA 4XBYA 4HI7A 2XFTA 3GKNA 2KP2A 3CPOA 1BYEA 3F0IA 2DIZA 2RLIA 5ELGA 1ZGNA 4MZBA 1X5EA 1EEMA 1V98A 1SYRA 1YQ1A 1ILOA 2QA43 2E2UA 2HYXA 1M3IA 1USBA 2IUJA 1LXEA 1WMOA 3GZXB 2XPEA 4PURA 4BL3A 1WMPA 5D9WA 1OHOA 3KEBA 3AMOB 1X5CA 3FKFA 3A5IA 3FZAA 1OE7A 1FAAA 2HMNB 1EP8A 1ZMAA 1HZ1A 3EWLA 1SL1B 4IP6A 2TRCP 5CRDA 3KIIA 3F8XA 1K9M4 3ZTLA 2WOFA 3F3QA 1UI7A 2DJ1A 1GLPA 3D5GA 3RDEA 5AIXA 4BVXB 5A4WA 4I2TA 1UN2A 2HRKA 1J08A 1YI23 1O85A 2VL2A 4TR1B 5TGNA 4NHFA 4F82A 1T2HA 3FR6A 4ISDA 5FHIA 1BUQA 1THOA 4KGIA 4N11A 1IYIA 3DXBA 3FZWA 3I0YA 4NXIA 4RBNA 2GEYA 3OXAA 3RHBA 4YQMA 3PINA 3D4AA 1LNIA 3KN4A 4EVMA 1FGTA 4J9AA 1O7PB 3LFLA 4QQ7A 2L5LA 2OTJ3 3M9KA 4ACSA 1RDSA 2F56A 3EB8A 3LYKA 2XPDA 4MDCA 5GAPD 1GP1A 1WWJA 3FK8A 1IYHA 4Z2RA 3M0FA 1LRAA 3A2WA 1XIYA 2GZZA 4G0KA 1EOGA 1EV9A 2DMLA 5AIFA 1GSQA 2YZUA 2MMOA 3L4NA 3DXOA 1Q824 3MIXA 2CVDA 2F4YA 4G0LA 2F8AA 2RM5A 1SJ6A 1EGOA 4HDEA 3LGCA 4AGSA 2I3YA 2LYXA 1CYUA 3G7IA 1I0VA 4IS0A 1GMRA 3HI7A 2QA1A 3VWUA 4NHWA 2WJUA 5ECMB 2WB9A 1ERVA 2CWUA 1E97A 1YEPA 3DVWA 1JN5A 1DE2A 4PNFA 5KN0A 3AHSA 3G4S3 1VF1A 5J5NA 1PL2A 1EOHA 3NHXA 1PGTA 2LJRA 1B21A 1TFOA 3E3EA 3KP9A 2HMMB 3QR6A 2ZCTA 3EINA 2RUEA 2Z76A 3HVVA 1UCJA 4KCAA 2V2GA 1TI3A 2CX3A 1EEJA 3K63A 2P0GA 5G2ZA 1PRXA 4J5KA 4IQ1A 4Z2TA 4KFEA 4HQSA 1GH2A 2P0MA 3MG2A 4CPKA 1QGVA 4BVYB 5ABRA 1GD3A 2WGOA 3BNDA 4MJCA 1M2DA 4POBA 2XR8B 1QUWA 1WE0A 2PNCA 5CF1A 3LH4A 1NNVA 1KD14 4K1VA 2E7PA 4N0ZA 3SBCA 2BU4A 1OACA 2M7OA 3KCMA 1CH0A 1BSBA 1AUCA 2C10A 2KHPA 3IXRA 2HI7A 3PPUA 3EN1B 4HQZA 4CDLA 1TFKA 5M18A 1GUMA 4EDZA 2O89A 1W00A 4RI7A 1JNQA 1OAZA 3MYTA 3GAXA 3G713 3IAM2 3IA1A 1IV7A 5IO2A 5IENA 3S67A 2WOHA 2YFJB 3NV0A 1FUTA 3B7CA 3MWHA 4IJIA 1CQSA 2OBKA 4CCVA 1UCLA 4OVMA 1TTZA 3S5CA 1M2AA 4ZL8A 1GTBA 5BMUA 2E2GA 2J9HA 2DC5A 1N5HA 3APSA 2AV4A 3VWXA 4EXRA 1VF3A 3FZ5A 3CC73 5HR1A 2V1MA 4R80A 4LLRA 4GL6A 4IT7A 3ERFA 2AAWA 3BNEA 2FGTA 2IMJA 3KXOA 1QXHA 4MK3A 1S3CA 1SK0A 3WT2A 4D73A 1T5YA 1TJDA 3G7JA 1PSQA 1WJKA 4TN8A 1RGAA 3K8NA 1DVCA 1MEKA 1R4WA 2N5FA 3HXSA 1JKGA 1R5PA 4TOPA 1JLVA 2DJJA 1LU4A 3V99A 1EKMA 3CXGA 3QFAC 3X3XA 2RGQA 1GTUA 1AVKA 3AHWA 5M19A 2AB6A 5JCGA 4K7OA 3HJOA 4FIWA 4WF5A 1DMNA 5BVBA 1ABAA 1BAYA 1OGXA 2CG1A 3HVNA 3UL3A 4ECIA 1SJIA 4JZQA 4KDYA 3E99A 3PXMA 3CBUA 1VQ43 3GSPA 2CAIA 2L6CA 1MNLA 2GSQA 2P09A 4FYBA 1SJWA 1X9WB 1JZOA 2AAEA 1VRSD 4GXZA 1GY6A 2OKAA 5B6MA 2L4CA 1FGQA 2GDRA 1BNEA 4X2HA 1PL1A 3IC8A 2W56B 1O7HB 2GBXB 3MWZA 3TB2A 1UGHI 2C0GA 1K8A4 4TRXA 4ZIJA 3ZG5A 1FW1A 3CCV3 3SEDA 3I6AA 2IPAA 1IVVA 3TRPA 1ZL9A 3GH6A 1BNSA 2ZNMA 3F6DA 2OQEA 5F07A 3A5EA 1XWKA 1C7HA 5DRVA 4WF4A 4X0XA 1BSDA 5FGOA 1B48A 1PFOA 2A4VA 1GOUA 3DGOA 3EU4A 1U8CB 1IQXA 1LBKA 3MDKA 1OC8A 1W2ZA 2MMAA 4BPYA 5LCZA 3OW22 1M9BA 2SARA 4MZWA 1LNHA 4MF7A 4I6XA 3A5WA 4EV2A 3DMCA 2H1DA 2CWTA 3K9MC 2X64A 4K1FA 4NHZA 2XF3A 5JPUA 4KW6A 1RGFA 1K0BA 2HZEA 1XOAA 4FR9A 1FVJA 1ISKA 4I97A 2MMZA 5B7CA 1GOVA 2HRFA 5KOXA 1UA5A 5DCHA 4MPGA 2IMFA 1PX7A 3EHCA 5EY6A 4OO5A 2XRXB 1YGWA 7RNTA 2LJKA 1GSPA 2ML6A 1AQXA 2HRAA 4HJ2A 3EBYA 5IERA 4KF9A 1AQWA 1R7HA 4JRRA 1A2LA 4GLTA 4FYUA 2IMDA 4CY6A 2CG0A 3CCE3 2DLXA 2MBSA 4LSOA 2VCWA 3APQA 2IA7A 3TJFA 2CX4A 1BSCA 1K734 2I81A 2FY6A 7STDA 3HK4A 1A2PA 3FYGA 5CNWA 1I8VA 1TK8B 2Z9SA 1ASKA 3FMWA 3BBYA 2FUG2 1TU8A 2XGNA 1JV2B 1IT8A 2O9UX 1W6CA 3ZZXA 3O6TA 3D0ZA 2V6OA 1OH0A 3B8LA 4HM4B 5EEOA 2M80A 2OE1A 2F5MA 3J7Yb 1AIUA 4L8EA 4HSCX 1YNVX 1TK0B 2VOCA 3H79A 1N8QA 1LOVA 1AV4A 4K5RA 1B2UA 3ZRDA 2SBLA 3LZAA 1K0AA 4ZBAA 2CFKA 4G0IA 5KN2A 1QQ2A 3QD9A 1VQ63 5IG3A 1LQMB 4DKIA 1G7OA 5ECPB 3TKQA 2PN8A 2Z6BA 3LG6A 2H71A 3DY5A 4WKWA 4P3YB 3IRAA 1GSFA 2VL9A 5D82A 3IHGA 5DAKA 3TKRA 1UW1A 4IIAA 4IQAA 4O32A 1GMQA 2WULA 5DJLA 1GNWA 2PPTA 1A8YA 1TIJA 1Q7HA 1ST9A 4O3VA 3SXXA 3G6E3 3DD3A 22GSA 2QEX3 3FF0A 3KKGA 2G2QA 2JSZA 1SD9A 3QAWA 2C80A 3LTCA 3NZNA 4XS4B 2YP6A 3UL5A 3BNBA 4K1UA 4YQUA 1JB4A 1M1K4 1BNFA 3LJRA 2J8XB 2VM2A 4FYCA 4XS1A 4WFOA 5CREA 18GSA 3QFBC 5ECLB 4MH3A 2B5XA 4KFFA 4O02B 4KSOA 2P05A 4E8EA 2X49A 2H75A 1JZRA 3T8UA 2GT6A 1IU7A 1JN5B 2YWOA 1O7NB 6GSPA 2LQVA 4V1Ag 1BVIA 3CCM3 3C7MA 5EVHA 5AIIA 1UCIA 2GSSA 2CWVA 2CFWA 3Q3FA 3GZRA 3PH9A 3C1SA 2N5BA 2VCZA 2H0IA 3H51A 4RNZA 3I553 1I9DA 1V9WA 4AJ7A 1NW2A 3BJ5A 2EC4A 4HBRA 1YVSA 3W8SA 2RIIA 4J8TA 2R3XA 1B20A 3VGNA 1WP0A 1T2IA 5JWOB 2GVPA 1YIJ3 3LT8A 6GSSA 1FG4A 1NB3I 3NQYA 1PN0A 2NVLA 6GSXA 1FVKA 3VI7A 1X9SB 2HSMA 3DVXA 1FGOA 4IKHA 3WR2A 2PWJA 2AJQB 3P7XA 3EJVA 1O73A 3LMLA 5ECKB 3BLZA 1PY3A 4X1UA 1AW9A 3KD0A 3N8BA 1RGEA 2OTL3 3FZ9A 3Q19A 4LZIA 4IELA 5IPHA 3WOFB 3DMLA 4KA0A 4F9ZA 4KH7A 4MH2A 4XCSA 3NV0B 2NTOA 3DEXA 2ML5A 1XZOA 5AI1A 4HM6B 4L7KA 2C1YA 2L57A 5AGYA 1OE8A 2PBJA 3MG3A 3GMFA 1Q814 4N6V0 3R2QA 3I9V2 3X41A 3KH7A 3TKSC 3EYTA 4BTYA 2KXGA 3FGYA 3FCSB 5J3RA 2FA4A 3X40A 3X3YA 1Y25A 5CRWA 3JUMA 4HAAA 3KCHA 4JU5A 1GULA 3GNJA 3VSYA 1SKSB 5AYSC 3O8YA 4X43A 4D73B 2EIQA 2YWNA 1ULJB 1BU4A 4HM3B 1S5AA 3VPQA 2CIUA 3G8ZA 5F0GA 3KSED 4PGTA 1AAZA 1TXXA 4OWYA 2YWMA 1JKGB 3IC4A 3UB1A 3GZBA 1A2MA 2C0EA 4OFMA 4IBPA 2PVQA 3EU3A 3FEUA 5IPGA 3Q2PA 1WNHA 5STDA 3APOA 4L8OA 2W6JH 2VUPA 3UMAA 2YWIA 1TRUA 3NX0A 1VQO3 2GGTA 1BNJA 1Z7PA 1FUSA 4ILFA 1RK4A 2IMKA 4RZMA 3SOYA 1B2XA 1B27A 1AY7A 5KP3A 1DSBA 2EIRA 4O5QA 1V74A 3X42A 3V98A 2P31A 3RBTA 2O87A 1VF4A 4HKVB 2VO4A 3RGAA 3MKIA 2H72A 2L4QA 4V1Ap 2DMMA 4K0NA 2QC7A 4WP5A 3EC3A 4ML1A 3FH1A 3TKPA 1VQQA 2GU3A 3LOYA 2KRTA 3UJMA 2K9FA 1MGWA 1MDJA 3ME8A 1K0DA 5J9CA 1IVWA 4AF2A 3EX9A 1MDIA 2OACA 4NREA 1U3AA 1IV9A 5LNKe 3ZFBA 3VK9A 5CYYA 1CQGA 2HFDA 3SOAA 4ZB8A 1XW6A 3K7CA 5HQPA 3NM7A 2FHEA 2IL3A 3ED3A 1D6UA 2NPBA 4GRFA 1N9JA 3OWYA 3WYWA 4WYKA 5G5FA 3GZYB 3NBJA 3SWLA 1JBSA 1QFNA 4EXJA 3FY7A 4EO3A 1RGKA 1B4PA 2VD1A 2RCDA 1TDIA 3I43A 1WPIA 2WO0A 1A2JA 3P90A 2E2TA 5HFIA 2GQLA 2CFGA 2D2ZA 3M8NA 5FWGA 3HDCA 3GYKA 5D8IA 2X99A 4K7NA 2HZEB 3O76A 3EE1A 2IN3A 3ECFA 2VCXA 1RW1A 4G1MB 3LSZA 2CVBA 4NPBA 1E6BA 3BNCA 5CP1A 1MWSA 2UUGC 2H1AA 2GBWB 4A5PA 2ZUPA 1PYLA 2DJKA 1YJW3 16GSA 5JBSA 2DBCA 3ZVJD 2GQMA 1I0XA 4K6XA 4OFNA 5A0OB 3NQZA 2JACA 5C00A 2V1LA 4BTXA 1JHBA 1XBSA 3LXUX 1BNRA 2BHMA 2C0FA 2W2CA 1RNTA 2CZ2A 3ZMKA 5IG5A 2C3TA 1RGLA 2LS5A 3TGZA 3GKKA 1TOFA 2GZPA 1STFI 2UZ8A 2HZFA 3JUOA 4MMZB 3KTBA 1Y4KA 3DIEA 5HR3A 3WODG 2P5QA 2JZTA 5DJMA 3EURA 2QA2A 1SL2B 3GTUA 4J57E 1QALA 4HZBB 3FHKA 3TCOA 3TRQA 4J56E 6STDA 2XH9A 3F4TA 3TJKA 4XB5A 1J9BA 1JB2A 4NV5A 2LRCA 1GYBA 4ZB6A 1I3FA 1SU9A 3LT9A 2A2PA 5ECIB 1K0OA 2XC2A 5FW5A 4YH2A 3C1RA 4ZM8A 3D6IA 2OA7A 2LRTA 2X8GA 2BNGA 3GX8A 2IFQA 1LQGC 1A2VA 2OOVC 3C8EA 1EV4A 4MMYB 5M1AA 4G10A 3DKSA 5DAKB 3STDA 3L9UA 1WQLB 3I69A 3ALAA 5KOWA 2K8SA 2DJ2A 3JUQA 3IOSA 1GSSA 3UVHA 1PD21 4KVHA 1W89A 2H6YA 1LOYA 2H8LA 5ECOB 2K0MA 1GSUA 1HD2A 3ZIJA 1S3RA 3GRDA 3R3EA 2IYJA 3Q6OA 1VQ83 4K9ZA 4WEYA 1W4VA 4YKFA 3HJMA 1F2EA 3A2VA 1T3BA 2GXFA 1I5GA 2X4AA 4TKYA 1AXDA 4EC6A 3M1GA 4N6MA 3G16A 2J23A 4L5LA 1ROAA 4KNDA 1IQYA 1SENA 4PQ1A 1QMVA 3S29A 3RPPA 4AEQA 3BCKA 2CX0A 2V32A 1GY7A 3WDGB 4N6TA 4KX4A 1G7EA 4MCUA 2IWTA 4WR5A 5CAXA 2YCDA 5CRGA 3FG3A 3PZWA 2F98A 4MP4A 4O2HA 2H6ZA 3EQQB 2R0CA 1FB0A 3F4SA 4N10A 3GKMA 4QWTA 3EMPA 2I9WA 5D9TA 2B7KA 2H19A 3J7Yd 3Q1CA 2TRXA 3GHAA 3ZFZA 1A2KA 1SK1A 2R0GA 1JJ22 4YKGA 1LOWA 2FWHA 2I9HA 2BT3A 4JR4A 1D6ZA 2WGRA 1JBRA 1BRKA 3H1NA 1Q98A 1NWWA 4WETA 1R5AA 4ORLA 1STDA 2BIRA 3CCQ3 3K0ZA 4RQXA 1RJOA 1IYYA 3CCL3 2FXTA 3JUPA 2B5YA 4PUFC 2LV3A 1BQ7A 1MOLA 3UAPA 3PYJA 1OCVA 1Q9EA 3QCPA 4KE3A 3WGXA 5HGRA 3LEFA 4L5OA 4WR4A 4GCIA 1BAOA 3MSOA 2B3SA 1YIT3 1TW9A 2IMEA 2HOHA 2E2MA 1XG8A 1AR0A 2X8HA 2VCQA 12GSA 4K5SA 2FWFA 2VL3A 3GV1A 4DSQA 5ECSA 1MWTA 19GSA 5DALA 2DJ3A 4FMBA 5H5RA 2PUKC 5ID2A 3PCSA 1ERWA 3CCS3 2V6KA 8GSSA 1BRJA 3QAGA 2CQ9A 3VFIA 1EA2A 4V2NA 4MLYA 3OWUA 4I8BA 2IMIA 3HZ4A 3BOAA 2JQ5A 1FHEA 3US3A 4RNYA 3ERWA 2ON5A 1I2GA 5IF6A 3KM6A 5CLKA 4Q5QA 2CW9A 4H3UA 2KF3A 4V2MA 4Z7XA 3SVAA 1BRNL 4IP1A 4O5UA 3LQ7A 3ME7A 1M904 3MYDA 5G30A 3TJBA 4LMWA 4TR3A 3KP8A 5EL8A 1VGLA 1JZDA 1ML6A 2M72A 5EVOA 5CF2A 4N6OB 3EBTA 3W6GA 5JCWA 2AHEA 3JCML 3DUKA 1M2BA 3D9RA 3HA9A 4HU7A 4NV2A 1ACVA 3HZPA 3LYGA 4HZ9B 3CME3 2AUVA 6GSTA 4JRFA 1GSYA 3N5OA 4TW5A 3L78A 3ZLPA 3E0UA 1Q42A 4LL4B 4FCZA 4EL1A 1O6JA 4XM4A 2MZCA 3GWRA 5F05A 1PKZA 4TXOA 5JWQB 1EG9B 1N5PA 4ZB9A 1N2AA 1OHSA 3NXJA 4CDOA 1GTIA 1BOXA 2PGTA 1ON4A 4HEA2 1GY5A 3FR3A 1OF5A 1OC3A 4F0CA 1ZYPA 1SARA 1K0MA 1BIRA 5I97A 2H1GA 2UX0A 4PTSA 2F51A 4MMXB 3FZ4A 3V92A 2VL2C 4PNGA 4N30A 4YQVA 2Q07A 2INXA 3X3ZA 3CC23 1OKDA 3CC43 3GA4A 4CHSA 1OVNA 3H4KA 3ZL5A 1OKTA 2H0GA 1QK8A 1GWCA 4JEDA 2O85A 4BL2A 4R1KA 3L0HA 4KUNA 1G6YA 4X2OA 1M9GA 1N8R4 2IUKA 1ZYNA 1B2ZA 2MYGA 2HMOB 3WGEA 4XDWA 1X1YA 3B4OA 1RN7A 4HM8B 4MABA 2ZA4A 4IHUA 3OV4A 4IJ3A 3LTAA 2FGXA 5B6NA 5ECRB 2CC3A 1FA3A 1SL0B 1GNEA 3UL6A 2OADA 3DGNA 20GSA 1NB5I 1PKWA 4N6UA 1FW7A 2X8CA 1MD3A 1Y6EA 5AIVA 2PMTA 4CY8A 1EWXA 1B3SA 1KNGA 4MJAA 1V40A 2W03A 3WT1A 1SK2A 1GUKA 1K3OA 1PU4A 3U1WA 5HR0A 5BXQA 4H86A 1DVDA 1JZWA 5JCUA 3H3HA 2GZYA 1TU7A 2W04A 4FMDA 2JADA 2H1BA 1OUNA 2IY2A 3P8WA 1MDKA 4I2UA 3CYNA 1IQ8A 1RRHA 1KC84 1TP9A 1T4ZA 5J9BA 1Z1SA 3GKXA 4Q5RA 6GSUA 5IMDA 3GH9A 3IK7A 3UVTA 5E59A 5F8BA 2H66A 1HNCA 4XHMA 1R4CA 3N9HA 4N3VA 3GTUB 1CYVA 3DGMA 2GEXA 5G1LA 1M7TA 4EV5A 1EQKA 2VM1A 5LD0A 3IPTA 1JLWA 5AEUB 1DE1A 3BIRA 4DSRA 5ECHB 2BMQB 5JPPA 4PEJA 5A5KA 4ULXA 3NIVA 4LL1B 1ROVA 3DGYA 2MBTA 3KIJA 4GF0A 1WIKA 3WMDA 5KN3A 1TK5B 3CCR3 3MHEA 4USSA 2A15A 3LXTA 2KP1A 2YZHA 3NOFA 2A4HA 4O92A 2IFQB 1VQ73 1ZZYA 2BJXA 5BRTA 2W9PA 1BX9A 3QK9A 2JSYA 1AVLA 1W6YA 3EVIA 4PX1A 2NBSA 3QMXA 1RCKA 5AISA 1VQP3 3F6FA 4PUAA 2P0XA 2C3QA 3WHOA 2I4AA 5L71A 3TRXA 2ZDJA 4AKZA 1SD8A 2VD0A 2LNTA 1FGRA 1THXA 1OGZA 3PGBA 3PGTA 4HM0B 1PN9A 1XOBA 4EF0A 4I5QA 1M1XB 1ZGXA 2FWEA 1FOVA 1TI1A 1XPVA 3HIIA 1MGRA 3D21A 2M46A 4J5GA 2LTKA 3DWVA 2KF6A 4WWUC 3KJYA 4ZL9A 3E9JB 3CMIA 2RM6A 1QVG2 3VI5A 1M9AA 4XS6A 5BIRA 17GSA 3HOHA 1TRQA 2Z77A 3VLNA 4HU9A 1SIIA 1WMNA 2WGQA 4GSNA 4GQCA 3N9JA 4LYLB 1CQHA 3ER7A 3LTBA 1YF0A 2GT5A 2R4VA 4HM7B 1A23A 4ID0A 3RNTA 1Z6MA 2R41A 2XSOB 4MEIA 1S723 3U97A 4IPBA 4H61A 1B9YC 1E3RA 3ZFLA 3IR4A 1BANA 5CO3A 4BA7A 1YKAA 4PQIA 1RNBA 4ECCA 1YJN3 2RUFA 3MPHA 4NAXA 3PR8A 4TR0A 1FZUA 1A90A 3HYPA 1UDII 1W7CA 3DZLA 1BNIA 3GL3A 3HVSA 2HMKB 5G5EA 3T0UA 1DYUA 1GD4A 2MC8A 4ECBA 5JWRB 1VQN3 2OE0A 1XWAA 5GAND 5D73A 1T7PB 4DSSA 1G02A 5DQSA 3KZTA 2VCTA 1YEXA 1DMMA 1TRWA 3L9VA 1L5GB 1FYSA 5D83A 3AGNA 1W5ZA 1TRSA 3CQFA 4DVCA 5A4VA 5D96A 1BSAA 3WGDA 4EE0A 1RN1A 1GSEA 2OQEC 3FLJA 5IMVA 4RI6A 2YV9A 5DDLA 3N54B 2AYTA 1GL8A 4FO5A 4AJ8A 6GSYA 3GSSA 1ZYQB 1B2SA 2JU5A 1US1A 2R5GA 4RUVA 3EF8A 2VLUA 3GURA 1ZYEA 1ERTA 3UJ1A 1XW9A 5DALB 1GTAA 3PCRA 1Q7Y4 5ID2B 1IVUA 2L1SA 2FNOA 1B8XA 4G2EA 3ZIVA 2RBIA 3BCIA 2OBIA 1OHPA 3IK9A 14GSA 1KSIA 5IW9A 1V57A 5DVBA 1NDOB 5AYRB 3G0KA 2REMA 2GLRA 5G2GA 3UOMA 3SX1A 2R4IA 2HLSA 3H93A 4NMUA 3F8UA 3ISOA 2E2VA 1YJ93 5D81A 3EPTA 5CK6A 2YX9A 3F9UA 2PU9C 1ZCPA 1I2FA 1PMTA 3CTGA 4HOHA 3TDGA 1U6TA 3OR5A 2F86B 1X9MB 1RSNA 1Q40A 2JDIH 2GSPA 2LJAA 4IVFA 4G19A 3WA2X 2KAAA 3F7XA 1TU5A 4MPFA 1D6YA 4PXOA 5B8BA 3URPA 1SKWB 4XBXA 2IIYA 4WBJA 3MAKA 3VURA 2QGVA 4CW9A 4TXOB 3CCU3 2GQKA 1RTUA 1RQMA 1E2YA 2HRNA 2JZRA 4BIKA 4MF5A 1KWIA 4GB5A 1W6GA 2R2JA 5DREA 4OFTA 1TRPA 1M3JA 2LEGA 4ICYA 3IV4A 3IBHA 3DRNA 3IPZA 1OF5B 3M8CA 2BMXA 4GWRA 1URMA 1Z9HA 5IMZA 5KN1A 1W01A 1UI8A 1UUWB 1W2B2 4KDXA 1KEBA 2JL4A 1F6MC 1OPYA 1M99A 1I3IA 5IIZA 3B4PA 1UCKA 3HCZA 1MTCA 3O3TA 4NWYA 3LYPA 4XS4A 3D79A 1VQ93 3LTDA 2GSRA 2L6DA 4POMA 1J0FA 3Q18A 4BIRA 1K0NA 1VQM3 2C11A 3MSZA 1SYXA 5COHA 3G9BA 3CXC2 5J41A 3UBLA 2GSTA 3CRTA 1A8LA 4WBRD 5IG0A 4XRAA 2GS3A 4TX4A 3A2XA 1TRVA 2OWPA 1Z3EA 1LJRA 3T8NA 3HIGA 3F7SA 2WDUA 3D4MA 3UBKA 1RHLA 2C8UA 4EDYA 3NUVA 1K3YA 2ZHXB 4QL9A 2O3OA 3SYUA 4BL7A 2HT9A 1UVZA 5A4UA 5G1KA 3ZYWA 1RGHA 1XWCA 4HUAA 1SJZA 2Y73A 4KT3B 3ZVJA 4L0WA 4L0UA 3HVXA 5AIHA 2I1UA 3QRDA 2CH9A 2E0QA 1HKXA 4FCMA 4N0VA 13GSA 4FCJA 5DCGA 5J4UA 2LSTA 2K8VA 2OJLA 4Q5FA 1DUGA 3FR9A 2BTOT 1F37A 3ERGA 2F8FA 2L5OA 1RRLA 4RQRA 1UUVB 4HJMA 4R9KA 2PVOC 3IE3A 1BRHA 1C72A 4MJDA 2FLSA 4V2LA 1DE3A 3C71A 2H30A 5HFGA 4AKYA 4MMMA
chains in the Genus database with same CATH topology
1AQVA 4ZXGA 4HZ2A 2H0HA 5F06A 5HR2A 1KBNA 2VLTA 3G7YA 1T4YA 2CT6A 3KMNA 3D4TA 1HYUA 4Q5NA 3TJGA 1HQOA 4ZILA 2B7JA 2OE3A 4ZBDA 1EP7A 4EUYA 5IMAA 1K0CA 2H73A 3CSJA 2YV7A 2YANA 1TKDB 2VIMA 1F3BA 2HXKA 3C73A 1Z7RA 3J7Yk 4YAPA 1NHYA 4F0BA 2A2SA 1SKRB 4KCEA 9GSSA 1OC9A 4WXTA 3GFKA 2LQQA 3KGKA 3TOUA 4MNNA 1JFUA 3TKSA 3HZ8A 2YJHA 4O7HA 1R26A 1A24A 5AN1A 3D22A 1NHOA 3GRXA 3QDNA 1X0RA 2MMNA 2DSAA 2WRTA 2H01A 3S9FA 2QSIA 2CV4A 4POLA 5GZZB 3U6VA 2DJ0A 3BD2A 5H5SA 2TIRA 4GSTA 5DQYA 2CZ3A 1O8XA 1YZXA 1T1VA 3VWVA 1PA3A 2CAQA 5IQYA 2R6KA 3H8QA 3VPTA 1HNBA 2KLXA 2H76A 4X4JA 2B1KA 1Q4JA 3ZMLA 3DYRA 4K8MA 2B1LA 3KZQA 3UARA 2YJ7A 3L9SA 3KTLA 2PERA 2V41A 4IW9A 2QKEA 3VWWA 5IOXA 2VCVA 3QAVA 2B5EA 2O8VB 2VLVA 1XW5A 2HE3A 2HSHA 4K2DA 4DSSB 1O8WA 1UC7A 2ON7A 3LXZA 2H70A 2R37A 2LNSA 1T00A 4XRDA 3GL5A 3F3RA 2YPMA 4BVXA 1KTEA 2F9SA 3U5RE 4TR1A 3M9JA 3Q74A 2EIOA 4MA9A 3HHVA 4O5RA 1YDKA 3QOUA 3TOTA 1ERUA 1GSDA 2CA8A 2LUSA 1S3DA 4YAVA 3V1WA 4BWSA 2DIYA 4E8HA 4K0GA 3HKRA 1H75A 5ENUA 3IHQA 4TXVA 2FA8A 2VAFA 3CSIA 1NM3A 4MJBA 5KEJA 3RDWA 1YF1A 1Z5YE 3RPNA 4TVEA 2G0FA 1FO5A 4HOJA 3EE2A 2WFCA 5IOWA 4LA1A 1VF2A 1Z6NA 4XTSA 4F2IA 2K6VA 3IAS2 1O7UA 2HSYA 2P5RA 4PQHA 3M3MA 1F3AA 2C4JA 5H5QA 4BVYA 1XXUA 2YOIA 1M0UA 3FRCA 3LW9A 4GTUA 2IJYA 1B4QA 3HJPA 4K2XA 1FB6A 1GRXA 5B8AA 2WCIA 2LQOA 1B9XC 1XFLA 4TR4A 4OCFA 5IMFA 3KH9A 1F9MA 1GUHA 4OO4A 1BEDA 1HNAA 1NSWA 5GSTA 5HFKA 1BJXA 5IM9A 5D9VA 3WD6A 5FT3A 1U3IA 4OMVA 4DEJA 2XBQA 3IDVA 1K3LA 1WRYA 2ES7A 2H6XA 4HZ4A 3ZREA 4KB3A 5D9XA 3GUSA 4KDUA 4GSSA 2LRNA 2L59A 1FOHA 5GSSA 3A3TA 2KOKA 4J2FA 1V58A 4JR6A 3HD5A 5C04A 4EC0A 3D5JA 2FD3A 1XVQA 4ZBBA 1G6WA 5INYA 4IGJA 4OCEA 5DBQA 1XVWA 4FH8A 5IMCA 4BL7B 4LMVA 7GSSA 4MJEA 3GX0A 5D93A 3W8JA 1O81A 3CTFA 2ALBA 1PX6A 2WZ9A 5EPFA 1XWGA 1V2AA 3ZITA 1XCCA 1A0FA 3DGQA 2C0DA 1T8EB 1YKCA 4HS1A 1A0RP 4MZCA 3KMOA 4XIHA 4G9HA 1BG5A 2YN1A 4ZL7A 3EMXA 5IO0A 1DBYA 3RHCA 2NDOA 4F03A 1S3AA 4FQUA 5E4WA 1WMJA 1OYJA 1XWBA 5ELAA 3F63A 4OD7A 2XHFA 2XBIA 1EZKA 5ECNB 1U88A 2R0PA 1U87A 2FCHA 3LORA 3F4RA 1AC1A 4QL7A 3P2AA 6GSVA 5G31A 2JZSA 2FWGA 3GIXA 3CRUA 4EIQA 4ML6A 2DKIA 4BWQA 3AY8A 1YY7A 1OC9B 3TKSE 4IN0A 2DKHA 3CSHA 2K18A 1X5DA 1EGRA 5ECQB 3LWAA 4ECJA 2H74A 3HY2A 1H4OA 1N8JA 4POKA 2WS2A 3TUEA 2CVKA 11GSA 2O7KA 4EIPA 3QPMA 3GN3A 4KAEA 4JBBA 6GSWA 1MD4A 2LKUA 10GSA 4KSMA 1YJ6A 1GLQA 4EKZA 4JE1A 4GQFA 4Z2UA 1PQNA 2HNLA 4AJ6A 3UIWA 3MNGA 1G0TA 2C3NA 2YNXA 5CRHA 2GTUA 1WOUA 2KUCA 3GSTA 2B6MA 3TJJA 1ZOFA 3FW2A 2A2RA 3UEMA 2N5AA 4MF6A 2F3MA 3RAZA 4K7IA 4HI7A 3GKNA 2KP2A 1BYEA 3F0IA 2DIZA 2RLIA 5ELGA 1ZGNA 4MZBA 1X5EA 1EEMA 1V98A 1SYRA 1YQ1A 1ILOA 2HYXA 1USBA 2XPEA 4PURA 5D9WA 3KEBA 1X5CA 3FKFA 3A5IA 3FZAA 1OE7A 1FAAA 1EP8A 1ZMAA 3EWLA 1SL1B 4IP6A 2TRCP 5CRDA 3ZTLA 3F3QA 2DJ1A 1GLPA 5AIXA 4BVXB 5A4WA 4I2TA 1UN2A 2HRKA 1J08A 1O85A 2VL2A 4TR1B 4F82A 3FR6A 5FHIA 4ISDA 1THOA 4KGIA 4N11A 1IYIA 3DXBA 4NXIA 3RHBA 4YQMA 3PINA 4EVMA 3LFLA 4QQ7A 2L5LA 3M9KA 4ACSA 3LYKA 2XPDA 4MDCA 5GAPD 1GP1A 1WWJA 3FK8A 1IYHA 4Z2RA 3M0FA 3A2WA 1XIYA 2GZZA 4G0KA 1EOGA 1EV9A 2DMLA 1GSQA 2YZUA 2MMOA 3L4NA 3MIXA 2CVDA 4G0LA 2F8AA 2RM5A 1SJ6A 1EGOA 4HDEA 3LGCA 4AGSA 2I3YA 3G7IA 4IS0A 2QA1A 3VWUA 4NHWA 2WJUA 5ECMB 2WB9A 1ERVA 1YEPA 3DVWA 1DE2A 4PNFA 5KN0A 1VF1A 5J5NA 1PL2A 1EOHA 1PGTA 2LJRA 3E3EA 3KP9A 3QR6A 2ZCTA 3EINA 2RUEA 3HVVA 4KCAA 2V2GA 1TI3A 2CX3A 1EEJA 2P0GA 5G2ZA 1PRXA 4IQ1A 4Z2TA 4HQSA 1GH2A 4BVYB 1QGVA 5ABRA 4MJCA 1M2DA 4POBA 1QUWA 1WE0A 2E7PA 4N0ZA 3SBCA 3KCMA 1AUCA 2KHPA 3IXRA 2HI7A 3PPUA 4HQZA 1GUMA 4EDZA 2O89A 4RI7A 1OAZA 3IAM2 3IA1A 5IO2A 3MWHA 4IJIA 2OBKA 1TTZA 4ZL8A 1M2AA 1GTBA 5BMUA 2E2GA 2J9HA 2DC5A 3APSA 3VWXA 2AV4A 1VF3A 3FZ5A 5HR1A 2V1MA 4LLRA 3ERFA 2AAWA 3KXOA 1QXHA 4MK3A 1S3CA 1SK0A 3WT2A 4D73A 1TJDA 3G7JA 1PSQA 1WJKA 4TN8A 3K8NA 1MEKA 1R4WA 2N5FA 3HXSA 1R5PA 4TOPA 1JLVA 2DJJA 1LU4A 3CXGA 3QFAC 1GTUA 2AB6A 5JCGA 4K7OA 3HJOA 4FIWA 4WF5A 1ABAA 1BAYA 3UL3A 4ECIA 1SJIA 4JZQA 4KDYA 3CBUA 2CAIA 2L6CA 2GSQA 4FYBA 1X9WB 1JZOA 1VRSD 4GXZA 2OKAA 5B6MA 2L4CA 2GDRA 1PL1A 3IC8A 3TB2A 2C0GA 4TRXA 4ZIJA 1FW1A 3I6AA 2IPAA 3TRPA 1ZL9A 3GH6A 2ZNMA 3F6DA 5F07A 1XWKA 4WF4A 4X0XA 1B48A 2A4VA 3EU4A 1LBKA 3MDKA 1OC8A 2MMAA 4BPYA 5LCZA 1M9BA 4MZWA 4MF7A 4I6XA 3A5WA 2H1DA 2X64A 4K1FA 4NHZA 4KW6A 1K0BA 2HZEA 1XOAA 1FVJA 4I97A 2MMZA 5B7CA 2HRFA 5KOXA 1UA5A 5DCHA 4MPGA 2IMFA 1PX7A 5EY6A 4OO5A 2LJKA 1AQXA 2HRAA 4HJ2A 4KF9A 1AQWA 1R7HA 4JRRA 1A2LA 4GLTA 4FYUA 2IMDA 4CY6A 2DLXA 2MBSA 2VCWA 3APQA 3TJFA 2CX4A 2I81A 2FY6A 3FYGA 5CNWA 1TK8B 2Z9SA 3FMWA 3BBYA 2FUG2 1TU8A 3ZZXA 3O6TA 3D0ZA 2V6OA 2M80A 2OE1A 3J7Yb 1AIUA 4L8EA 1TK0B 2VOCA 3H79A 4K5RA 3ZRDA 1K0AA 4ZBAA 4G0IA 5KN2A 1QQ2A 3QD9A 1G7OA 5ECPB 3TKQA 2PN8A 3LG6A 2H71A 4WKWA 4P3YB 3IRAA 1GSFA 2VL9A 5DAKA 3IHGA 3TKRA 4IQAA 4O32A 2WULA 5DJLA 1GNWA 2PPTA 1A8YA 1ST9A 3DD3A 22GSA 2JSZA 2G2QA 1SD9A 3QAWA 2C80A 3NZNA 4XS4B 2YP6A 4YQUA 3LJRA 2VM2A 4FYCA 4XS1A 5CREA 18GSA 3QFBC 5ECLB 4MH3A 2B5XA 4KSOA 4E8EA 2X49A 2H75A 1JZRA 2GT6A 2YWOA 4V1Ag 3C7MA 2GSSA 3PH9A 3C1SA 2N5BA 2VCZA 2H0IA 1I9DA 1V9WA 4AJ7A 1NW2A 3BJ5A 2EC4A 3W8SA 2RIIA 2R3XA 1WP0A 5JWOB 2GVPA 6GSSA 1FG4A 1PN0A 2NVLA 6GSXA 1FVKA 3VI7A 1X9SB 2HSMA 3DVXA 4IKHA 2PWJA 2AJQB 3P7XA 1O73A 5ECKB 4X1UA 1AW9A 3KD0A 3Q19A 3FZ9A 4IELA 5IPHA 3DMLA 4KA0A 4F9ZA 4KH7A 4MH2A 4XCSA 2NTOA 3DEXA 1XZOA 2C1YA 2L57A 5AGYA 1OE8A 2PBJA 3GMFA 3R2QA 3I9V2 3KH7A 3TKSC 3EYTA 5J3RA 2FA4A 1Y25A 5CRWA 4JU5A 1GULA 3GNJA 1SKSB 4X43A 4D73B 2EIQA 2YWNA 3VPQA 5F0GA 4PGTA 1AAZA 1TXXA 4OWYA 2YWMA 3IC4A 1A2MA 2C0EA 4OFMA 4IBPA 2PVQA 3EU3A 3FEUA 5IPGA 3APOA 2VUPA 3UMAA 2YWIA 1TRUA 2GGTA 1Z7PA 4ILFA 2IMKA 1RK4A 1DSBA 2EIRA 4O5QA 2P31A 3RBTA 2O87A 1VF4A 2VO4A 2H72A 2L4QA 4V1Ap 2DMMA 4K0NA 2QC7A 3EC3A 4ML1A 3TKPA 2K9FA 3ME8A 1MDJA 1K0DA 5J9CA 4AF2A 1MDIA 2OACA 1U3AA 5LNKe 3ZFBA 3VK9A 5CYYA 1CQGA 2HFDA 4ZB8A 1XW6A 5HQPA 2FHEA 2IL3A 3ED3A 2NPBA 4GRFA 3WYWA 5G5FA 3SWLA 1QFNA 4EXJA 3FY7A 4EO3A 1B4PA 2VD1A 1TDIA 3I43A 1WPIA 1A2JA 3P90A 5HFIA 2GQLA 2D2ZA 3M8NA 5FWGA 3HDCA 3GYKA 5D8IA 2X99A 4K7NA 2HZEB 3O76A 2IN3A 2VCXA 1RW1A 3LSZA 2CVBA 4NPBA 1E6BA 5CP1A 2H1AA 4A5PA 2ZUPA 2DJKA 16GSA 2DBCA 3ZVJD 2GQMA 4K6XA 4OFNA 2JACA 5C00A 1JHBA 1XBSA 2C0FA 2CZ2A 3ZMKA 2C3TA 2LS5A 3TGZA 3GKKA 1TOFA 2GZPA 2UZ8A 2HZFA 3KTBA 3DIEA 5HR3A 2P5QA 2JZTA 5DJMA 3EURA 2QA2A 1SL2B 3GTUA 4J57E 3FHKA 3TCOA 3TRQA 4J56E 3F4TA 3TJKA 1J9BA 4NV5A 2LRCA 4ZB6A 1SU9A 2A2PA 5ECIB 1K0OA 2XC2A 4YH2A 3C1RA 3D6IA 2OA7A 2LRTA 2X8GA 3GX8A 2IFQA 3C8EA 1EV4A 4G10A 3DKSA 5DAKB 3L9UA 3I69A 5KOWA 2K8SA 2DJ2A 3IOSA 1GSSA 3UVHA 1PD21 1W89A 2H6YA 2H8LA 5ECOB 1GSUA 1HD2A 3ZIJA 3R3EA 2IYJA 3Q6OA 4K9ZA 4WEYA 1W4VA 4YKFA 3HJMA 1F2EA 3A2VA 1T3BA 1I5GA 2X4AA 4TKYA 1AXDA 3M1GA 2J23A 4L5LA 4KNDA 1SENA 4PQ1A 1QMVA 3RPPA 3BCKA 2V32A 4KX4A 1G7EA 4MCUA 2IWTA 4WR5A 5CAXA 2YCDA 5CRGA 4MP4A 2H6ZA 2R0CA 1FB0A 3F4SA 4N10A 3GKMA 3EMPA 5D9TA 2B7KA 2H19A 2TRXA 3GHAA 1SK1A 2R0GA 4YKGA 2FWHA 2I9HA 4JR4A 2WGRA 3H1NA 1Q98A 4WETA 1R5AA 4RQXA 2B5YA 4PUFC 2LV3A 1BQ7A 3UAPA 3QCPA 4KE3A 3WGXA 4L5OA 3LEFA 4WR4A 4GCIA 2B3SA 1TW9A 2IMEA 2E2MA 2X8HA 2VCQA 12GSA 4K5SA 2FWFA 2VL3A 3GV1A 4DSQA 5ECSA 19GSA 5DALA 2DJ3A 5H5RA 2PUKC 5ID2A 1ERWA 2V6KA 8GSSA 3QAGA 2CQ9A 3VFIA 4V2NA 4MLYA 4I8BA 2IMIA 3HZ4A 3BOAA 1FHEA 3US3A 3ERWA 2ON5A 3KM6A 4Q5QA 4V2MA 4Z7XA 4IP1A 4O5UA 3LQ7A 3ME7A 3MYDA 3TJBA 5G30A 4LMWA 4TR3A 3KP8A 5EL8A 1VGLA 1JZDA 1ML6A 2M72A 5EVOA 3W6GA 5JCWA 2AHEA 3JCML 1M2BA 3HA9A 4NV2A 4HU7A 1ACVA 6GSTA 2AUVA 1GSYA 3N5OA 4TW5A 3L78A 3ZLPA 3E0UA 4LL4B 4EL1A 1O6JA 2MZCA 5F05A 1PKZA 4TXOA 5JWQB 4ZB9A 1N2AA 4CDOA 1GTIA 2PGTA 1ON4A 4HEA2 3FR3A 1OC3A 4F0CA 1ZYPA 1K0MA 2H1GA 4PTSA 2F51A 3FZ4A 2VL2C 4PNGA 4N30A 4YQVA 1OKDA 3GA4A 4CHSA 1OVNA 3H4KA 3ZL5A 1OKTA 2H0GA 1QK8A 1GWCA 4JEDA 2O85A 3L0HA 4KUNA 1G6YA 1ZYNA 2MYGA 3WGEA 4MABA 4IHUA 4IJ3A 2FGXA 5B6NA 5ECRB 1SL0B 1GNEA 2OADA 20GSA 1PKWA 2X8CA 1MD3A 1Y6EA 5AIVA 2PMTA 4CY8A 1EWXA 1KNGA 4MJAA 1V40A 3WT1A 1SK2A 1GUKA 1K3OA 5HR0A 4H86A 1JZWA 5JCUA 2GZYA 1TU7A 2JADA 2H1BA 2IY2A 3P8WA 1MDKA 4I2UA 3CYNA 1TP9A 1T4ZA 5J9BA 3GKXA 4Q5RA 6GSUA 5IMDA 3GH9A 3IK7A 3UVTA 5E59A 5F8BA 2H66A 1HNCA 4XHMA 3GTUB 5G1LA 1M7TA 2VM1A 5LD0A 1JLWA 1DE1A 4DSRA 5ECHB 5A5KA 4ULXA 3NIVA 4LL1B 3KIJA 2MBTA 4GF0A 1WIKA 5KN3A 1TK5B 4USSA 3LXTA 2KP1A 2YZHA 3NOFA 2A4HA 4O92A 2IFQB 1ZZYA 2BJXA 5BRTA 1BX9A 2JSYA 3EVIA 4PX1A 2NBSA 3QMXA 5AISA 3F6FA 4PUAA 2C3QA 2I4AA 5L71A 3TRXA 1SD8A 2VD0A 2LNTA 1THXA 3PGTA 1PN9A 1XOBA 4EF0A 4I5QA 2FWEA 1FOVA 1TI1A 1XPVA 3D21A 2M46A 2LTKA 3DWVA 3KJYA 4ZL9A 3E9JB 3CMIA 2RM6A 3VI5A 1M9AA 4XS6A 17GSA 3VLNA 4HU9A 4GSNA 4GQCA 3N9JA 1CQHA 1YF0A 2GT5A 2R4VA 1A23A 4ID0A 1Z6MA 1B9YC 3ZFLA 3IR4A 5CO3A 4BA7A 1YKAA 4PQIA 4ECCA 2RUFA 4NAXA 3PR8A 4TR0A 3HYPA 3GL3A 3HVSA 5G5EA 4ECBA 5JWRB 2OE0A 1XWAA 5GAND 5D73A 1T7PB 4DSSA 5DQSA 2VCTA 1YEXA 1TRWA 3L9VA 1TRSA 5A4VA 4DVCA 5D96A 3WGDA 4EE0A 1GSEA 5IMVA 4RI6A 2YV9A 5DDLA 2AYTA 1GL8A 4FO5A 4AJ8A 6GSYA 3GSSA 1ZYQB 2JU5A 2R5GA 4RUVA 2VLUA 3GURA 1ZYEA 1ERTA 3UJ1A 1XW9A 5DALB 1GTAA 5ID2B 2FNOA 1B8XA 4G2EA 3ZIVA 3BCIA 2OBIA 14GSA 3IK9A 5DVBA 1V57A 2REMA 2GLRA 3UOMA 2HLSA 3H93A 4NMUA 3F8UA 3ISOA 3EPTA 3F9UA 2PU9C 1ZCPA 1PMTA 3CTGA 3TDGA 1U6TA 3OR5A 1X9MB 2LJAA 4IVFA 4G19A 4MPFA 4PXOA 5B8BA 1SKWB 2IIYA 4WBJA 3MAKA 3VURA 2QGVA 4CW9A 4TXOB 2GQKA 1RQMA 1E2YA 2HRNA 2JZRA 4MF5A 2R2JA 4OFTA 2LEGA 4ICYA 3IV4A 3IBHA 3DRNA 3IPZA 2BMXA 4GWRA 1URMA 1Z9HA 5IMZA 5KN1A 4KDXA 1KEBA 2JL4A 1F6MC 1M99A 5IIZA 3HCZA 1MTCA 3O3TA 4NWYA 3LYPA 4XS4A 2GSRA 2L6DA 4POMA 1J0FA 3Q18A 1K0NA 3MSZA 1SYXA 5COHA 3G9BA 5J41A 3UBLA 2GSTA 3CRTA 1A8LA 4WBRD 4XRAA 2GS3A 3A2XA 1TRVA 1Z3EA 1LJRA 2WDUA 3D4MA 3UBKA 2C8UA 4EDYA 1K3YA 4QL9A 4BL7A 2HT9A 1UVZA 5A4UA 5G1KA 3ZYWA 1XWCA 4HUAA 1SJZA 3ZVJA 4L0WA 4L0UA 3HVXA 2I1UA 2E0QA 4N0VA 13GSA 5DCGA 5J4UA 2LSTA 2K8VA 2OJLA 4Q5FA 1DUGA 3FR9A 2BTOT 1F37A 3ERGA 2F8FA 2L5OA 4RQRA 4HJMA 2PVOC 3IE3A 1C72A 2FLSA 4V2LA 3C71A 2H30A 5HFGA 4MMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQV A;  4ZXG A;  4HZ2 A;  2H0H A;  5F06 A;  5HR2 A;  1KBN A;  2VLT A;  3G7Y A;  1T4Y A;  2CT6 A;  3KMN A;  3D4T A;  1HYU A;  4Q5N A;  3TJG A;  1HQO A;  4ZIL A;  2B7J A;  2OE3 A;  4ZBD A;  1EP7 A;  4EUY A;  5IMA A;  1K0C A;  2H73 A;  3CSJ A;  2YV7 A;  2YAN A;  1TKD B;  2VIM A;  1F3B A;  2HXK A;  3C73 A;  1Z7R A;  3J7Y k;  4YAP A;  1NHY A;  4F0B A;  2A2S A;  1SKR B;  4KCE A;  9GSS A;  1OC9 A;  4WXT A;  3GFK A;  2LQQ A;  3KGK A;  3TOU A;  1JFU A;  3TKS A;  3HZ8 A;  2YJH A;  4O7H A;  1R26 A;  1A24 A;  5AN1 A;  3D22 A;  1NHO A;  3GRX A;  3QDN A;  1X0R A;  2MMN A;  2DSA A;  2WRT A;  2H01 A;  3S9F A;  2QSI A;  2CV4 A;  4POL A;  5GZZ B;  3U6V A;  2DJ0 A;  3BD2 A;  5H5S A;  2TIR A;  4GST A;  5DQY A;  2CZ3 A;  1O8X A;  1YZX A;  1T1V A;  3VWV A;  1PA3 A;  2CAQ A;  5IQY A;  2R6K A;  3H8Q A;  3VPT A;  1HNB A;  2KLX A;  2H76 A;  2B1K A;  1Q4J A;  3ZML A;  3DYR A;  4K8M A;  2B1L A;  3KZQ A;  3UAR A;  2YJ7 A;  3L9S A;  3KTL A;  2PER A;  2V41 A;  4IW9 A;  2QKE A;  3VWW A;  5IOX A;  2VCV A;  3QAV A;  2B5E A;  2O8V B;  2VLV A;  1XW5 A;  2HE3 A;  2HSH A;  4K2D A;  4DSS B;  1O8W A;  1UC7 A;  2ON7 A;  3LXZ A;  2H70 A;  2R37 A;  2LNS A;  1T00 A;  4XRD A;  3GL5 A;  3F3R A;  2YPM A;  4BVX A;  1KTE A;  2F9S A;  3U5R E;  4TR1 A;  3M9J A;  3Q74 A;  2EIO A;  4MA9 A;  3HHV A;  4O5R A;  1YDK A;  3QOU A;  3TOT A;  1ERU A;  1GSD A;  2CA8 A;  2LUS A;  1S3D A;  4YAV A;  3V1W A;  4BWS A;  2DIY A;  4E8H A;  4K0G A;  3HKR A;  1H75 A;  5ENU A;  3IHQ A;  4TXV A;  2FA8 A;  2VAF A;  3CSI A;  1NM3 A;  4MJB A;  5KEJ A;  3RDW A;  1YF1 A;  1Z5Y E;  3RPN A;  4TVE A;  2G0F A;  1FO5 A;  4HOJ A;  3EE2 A;  2WFC A;  5IOW A;  4LA1 A;  1VF2 A;  1Z6N A;  4XTS A;  4F2I A;  2K6V A;  3IAS 2;  1O7U A;  2HSY A;  2P5R A;  4PQH A;  3M3M A;  1F3A A;  2C4J A;  5H5Q A;  4BVY A;  1XXU A;  2YOI A;  1M0U A;  3FRC A;  4GTU A;  2IJY A;  1B4Q A;  3HJP A;  1FB6 A;  1GRX A;  5B8A A;  2WCI A;  2LQO A;  1B9X C;  1XFL A;  4TR4 A;  4OCF A;  5IMF A;  3KH9 A;  1F9M A;  1GUH A;  4OO4 A;  1BED A;  1HNA A;  1NSW A;  5GST A;  5HFK A;  1BJX A;  5IM9 A;  5D9V A;  3WD6 A;  5FT3 A;  1U3I A;  4OMV A;  4DEJ A;  2XBQ A;  3IDV A;  1K3L A;  1WRY A;  2ES7 A;  2H6X A;  4HZ4 A;  3ZRE A;  4KB3 A;  5D9X A;  3GUS A;  4KDU A;  4GSS A;  2LRN A;  2L59 A;  5GSS A;  3A3T A;  2KOK A;  4J2F A;  1V58 A;  4JR6 A;  3HD5 A;  5C04 A;  4EC0 A;  3D5J A;  2FD3 A;  1XVQ A;  4ZBB A;  1G6W A;  5INY A;  4IGJ A;  4OCE A;  5DBQ A;  1XVW A;  4FH8 A;  5IMC A;  4LMV A;  7GSS A;  4MJE A;  3GX0 A;  5D93 A;  3W8J A;  1O81 A;  3CTF A;  2ALB A;  1PX6 A;  2WZ9 A;  5EPF A;  1XWG A;  1V2A A;  3ZIT A;  1XCC A;  1A0F A;  3DGQ A;  2C0D A;  1T8E B;  1YKC A;  4HS1 A;  1A0R P;  4MZC A;  3KMO A;  4XIH A;  4G9H A;  1BG5 A;  2YN1 A;  4ZL7 A;  3EMX A;  5IO0 A;  1DBY A;  3RHC A;  2NDO A;  4F03 A;  1S3A A;  5E4W A;  1WMJ A;  1OYJ A;  1XWB A;  5ELA A;  3F63 A;  4OD7 A;  2XHF A;  2XBI A;  1EZK A;  5ECN B;  1U88 A;  1U87 A;  2FCH A;  3LOR A;  3F4R A;  1AC1 A;  4QL7 A;  3P2A A;  6GSV A;  5G31 A;  2JZS A;  2FWG A;  3GIX A;  3CRU A;  4ML6 A;  4BWQ A;  3AY8 A;  1YY7 A;  1OC9 B;  3TKS E;  4IN0 A;  3CSH A;  2K18 A;  1X5D A;  1EGR A;  5ECQ B;  3LWA A;  4ECJ A;  2H74 A;  3HY2 A;  1H4O A;  1N8J A;  4POK A;  2WS2 A;  3TUE A;  2CVK A;  11GS A;  2O7K A;  3QPM A;  3GN3 A;  4KAE A;  4JBB A;  6GSW A;  1MD4 A;  2LKU A;  10GS A;  4KSM A;  1YJ6 A;  1GLQ A;  4EKZ A;  4JE1 A;  4GQF A;  1PQN A;  2HNL A;  4AJ6 A;  3UIW A;  3MNG A;  1G0T A;  2C3N A;  2YNX A;  5CRH A;  2GTU A;  1WOU A;  2KUC A;  3GST A;  2B6M A;  3TJJ A;  1ZOF A;  3FW2 A;  2A2R A;  3UEM A;  2N5A A;  4MF6 A;  2F3M A;  3RAZ A;  4K7I A;  4HI7 A;  3GKN A;  2KP2 A;  1BYE A;  3F0I A;  2DIZ A;  2RLI A;  5ELG A;  1ZGN A;  4MZB A;  1X5E A;  1EEM A;  1V98 A;  1SYR A;  1YQ1 A;  1ILO A;  2HYX A;  1USB A;  2XPE A;  4PUR A;  5D9W A;  3KEB A;  1X5C A;  3FKF A;  3FZA A;  1OE7 A;  1FAA A;  1EP8 A;  1ZMA A;  3EWL A;  1SL1 B;  4IP6 A;  2TRC P;  5CRD A;  3ZTL A;  3F3Q A;  2DJ1 A;  1GLP A;  5AIX A;  5A4W A;  4I2T A;  1UN2 A;  1J08 A;  1O85 A;  2VL2 A;  4TR1 B;  4F82 A;  3FR6 A;  5FHI A;  4ISD A;  1THO A;  4KGI A;  4N11 A;  1IYI A;  3DXB A;  4NXI A;  3RHB A;  4YQM A;  3PIN A;  4EVM A;  3LFL A;  4QQ7 A;  2L5L A;  3M9K A;  4ACS A;  3LYK A;  2XPD A;  4MDC A;  5GAP D;  1GP1 A;  1WWJ A;  3FK8 A;  1IYH A;  3M0F A;  3A2W A;  1XIY A;  2GZZ A;  1EOG A;  1EV9 A;  2DML A;  1GSQ A;  2YZU A;  2MMO A;  3L4N A;  2CVD A;  2F8A A;  2RM5 A;  1SJ6 A;  1EGO A;  4HDE A;  3LGC A;  4AGS A;  2I3Y A;  3G7I A;  4IS0 A;  3VWU A;  5ECM B;  2WJU A;  4NHW A;  2WB9 A;  1ERV A;  1YEP A;  3DVW A;  1DE2 A;  4PNF A;  5KN0 A;  1VF1 A;  5J5N A;  1PL2 A;  1EOH A;  1PGT A;  2LJR A;  3E3E A;  3KP9 A;  3QR6 A;  2ZCT A;  3EIN A;  2RUE A;  3HVV A;  4KCA A;  2V2G A;  1TI3 A;  2CX3 A;  1EEJ A;  2P0G A;  5G2Z A;  1PRX A;  4IQ1 A;  4HQS A;  1GH2 A;  5ABR A;  1QGV A;  4MJC A;  1M2D A;  4POB A;  1QUW A;  1WE0 A;  2E7P A;  4N0Z A;  3SBC A;  3KCM A;  1AUC A;  2KHP A;  3IXR A;  2HI7 A;  4HQZ A;  1GUM A;  4EDZ A;  2O89 A;  4RI7 A;  1OAZ A;  3IAM 2;  3IA1 A;  5IO2 A;  3MWH A;  4IJI A;  2OBK A;  1TTZ A;  4ZL8 A;  1M2A A;  1GTB A;  2E2G A;  2J9H A;  2DC5 A;  3APS A;  3VWX A;  2AV4 A;  1VF3 A;  3FZ5 A;  5HR1 A;  2V1M A;  4LLR A;  3ERF A;  2AAW A;  3KXO A;  1QXH A;  4MK3 A;  1S3C A;  1SK0 A;  3WT2 A;  4D73 A;  1TJD A;  3G7J A;  1PSQ A;  1WJK A;  4TN8 A;  3K8N A;  1MEK A;  1R4W A;  2N5F A;  3HXS A;  1R5P A;  4TOP A;  1JLV A;  2DJJ A;  1LU4 A;  3CXG A;  3QFA C;  1GTU A;  2AB6 A;  5JCG A;  4K7O A;  3HJO A;  4FIW A;  4WF5 A;  1ABA A;  1BAY A;  3UL3 A;  4ECI A;  1SJI A;  4JZQ A;  4KDY A;  3CBU A;  2CAI A;  2L6C A;  2GSQ A;  4FYB A;  1X9W B;  1JZO A;  1VRS D;  4GXZ A;  2OKA A;  5B6M A;  2L4C A;  2GDR A;  1PL1 A;  3TB2 A;  2C0G A;  4TRX A;  4ZIJ A;  1FW1 A;  3I6A A;  2IPA A;  3TRP A;  1ZL9 A;  3GH6 A;  2ZNM A;  3F6D A;  5F07 A;  1XWK A;  4WF4 A;  4X0X A;  1B48 A;  2A4V A;  3EU4 A;  1LBK A;  3MDK A;  1OC8 A;  2MMA A;  4BPY A;  5LCZ A;  1M9B A;  4MZW A;  4MF7 A;  4I6X A;  3A5W A;  2H1D A;  2X64 A;  4K1F A;  4NHZ A;  4KW6 A;  1K0B A;  2HZE A;  1XOA A;  1FVJ A;  4I97 A;  2MMZ A;  5B7C A;  2HRF A;  1UA5 A;  5DCH A;  4MPG A;  2IMF A;  1PX7 A;  5EY6 A;  4OO5 A;  2LJK A;  1AQX A;  4HJ2 A;  1AQW A;  1R7H A;  4JRR A;  1A2L A;  4GLT A;  4FYU A;  2IMD A;  2DLX A;  2MBS A;  2VCW A;  3APQ A;  3TJF A;  2CX4 A;  2I81 A;  2FY6 A;  3FYG A;  5CNW A;  1TK8 B;  2Z9S A;  3BBY A;  2FUG 2;  1TU8 A;  3ZZX A;  3O6T A;  3D0Z A;  2V6O A;  2M80 A;  2OE1 A;  3J7Y b;  1AIU A;  4L8E A;  1TK0 B;  2VOC A;  3H79 A;  3ZRD A;  1K0A A;  4ZBA A;  5KN2 A;  1QQ2 A;  3QD9 A;  1G7O A;  5ECP B;  3TKQ A;  2PN8 A;  3LG6 A;  2H71 A;  4WKW A;  4P3Y B;  3IRA A;  1GSF A;  2VL9 A;  5DAK A;  3TKR A;  4IQA A;  4O32 A;  2WUL A;  5DJL A;  1GNW A;  2PPT A;  1A8Y A;  1ST9 A;  3DD3 A;  22GS A;  2JSZ A;  2G2Q A;  1SD9 A;  3QAW A;  2C80 A;  3NZN A;  4XS4 B;  2YP6 A;  4YQU A;  3LJR A;  2VM2 A;  4FYC A;  4XS1 A;  5CRE A;  18GS A;  3QFB C;  5ECL B;  4MH3 A;  2B5X A;  4KSO A;  4E8E A;  2H75 A;  1JZR A;  2GT6 A;  2YWO A;  4V1A g;  3C7M A;  2GSS A;  3PH9 A;  3C1S A;  2N5B A;  2VCZ A;  2H0I A;  1I9D A;  1V9W A;  4AJ7 A;  1NW2 A;  3BJ5 A;  2EC4 A;  3W8S A;  2RII A;  2R3X A;  1WP0 A;  5JWO B;  2GVP A;  6GSS A;  1FG4 A;  2NVL A;  6GSX A;  1FVK A;  3VI7 A;  1X9S B;  3DVX A;  4IKH A;  2PWJ A;  2AJQ B;  3P7X A;  1O73 A;  5ECK B;  4X1U A;  1AW9 A;  3KD0 A;  3Q19 A;  3FZ9 A;  4IEL A;  5IPH A;  3DML A;  4KA0 A;  4F9Z A;  4KH7 A;  4MH2 A;  4XCS A;  2NTO A;  3DEX A;  1XZO A;  2C1Y A;  2L57 A;  5AGY A;  1OE8 A;  2PBJ A;  3GMF A;  3R2Q A;  3I9V 2;  3KH7 A;  3TKS C;  3EYT A;  5J3R A;  2FA4 A;  1Y25 A;  5CRW A;  4JU5 A;  1GUL A;  3GNJ A;  1SKS B;  4X43 A;  4D73 B;  2EIQ A;  2YWN A;  3VPQ A;  5F0G A;  4PGT A;  1AAZ A;  1TXX A;  4OWY A;  2YWM A;  3IC4 A;  1A2M A;  2C0E A;  4OFM A;  4IBP A;  2PVQ A;  3EU3 A;  3FEU A;  5IPG A;  3APO A;  2VUP A;  3UMA A;  2YWI A;  1TRU A;  2GGT A;  1Z7P A;  4ILF A;  2IMK A;  1RK4 A;  1DSB A;  2EIR A;  2P31 A;  3RBT A;  2O87 A;  1VF4 A;  2VO4 A;  2H72 A;  2L4Q A;  4V1A p;  2DMM A;  4K0N A;  2QC7 A;  3EC3 A;  4ML1 A;  3TKP A;  2K9F A;  3ME8 A;  1MDJ A;  1K0D A;  5J9C A;  4AF2 A;  1MDI A;  2OAC A;  1U3A A;  5LNK e;  3ZFB A;  3VK9 A;  5CYY A;  1CQG A;  2HFD A;  4ZB8 A;  1XW6 A;  5HQP A;  2FHE A;  2IL3 A;  3ED3 A;  2NPB A;  4GRF A;  3WYW A;  5G5F A;  3SWL A;  1QFN A;  4EXJ A;  3FY7 A;  4EO3 A;  1B4P A;  2VD1 A;  1TDI A;  3I43 A;  1WPI A;  1A2J A;  3P90 A;  5HFI A;  2GQL A;  2D2Z A;  3M8N A;  5FWG A;  3HDC A;  3GYK A;  5D8I A;  2X99 A;  4K7N A;  2HZE B;  3O76 A;  2IN3 A;  2VCX A;  1RW1 A;  3LSZ A;  2CVB A;  4NPB A;  1E6B A;  5CP1 A;  2H1A A;  2ZUP A;  2DJK A;  16GS A;  2DBC A;  3ZVJ D;  2GQM A;  4K6X A;  4OFN A;  2JAC A;  5C00 A;  1JHB A;  1XBS A;  2C0F A;  2CZ2 A;  3ZMK A;  2C3T A;  2LS5 A;  3TGZ A;  3GKK A;  1TOF A;  2GZP A;  2HZF A;  3KTB A;  3DIE A;  5HR3 A;  2P5Q A;  2JZT A;  5DJM A;  3EUR A;  1SL2 B;  3GTU A;  4J57 E;  3FHK A;  3TCO A;  3TRQ A;  4J56 E;  3F4T A;  3TJK A;  1J9B A;  4NV5 A;  2LRC A;  4ZB6 A;  1SU9 A;  5ECI B;  1K0O A;  2XC2 A;  4YH2 A;  3C1R A;  3D6I A;  2OA7 A;  2LRT A;  2X8G A;  3GX8 A;  2IFQ A;  3C8E A;  1EV4 A;  4G10 A;  3DKS A;  5DAK B;  3L9U A;  3I69 A;  2K8S A;  2DJ2 A;  3IOS A;  1GSS A;  3UVH A;  1PD2 1;  1W89 A;  2H6Y A;  2H8L A;  5ECO B;  1GSU A;  1HD2 A;  3ZIJ A;  2IYJ A;  3Q6O A;  4K9Z A;  4WEY A;  1W4V A;  3HJM A;  1F2E A;  3A2V A;  1T3B A;  1I5G A;  4TKY A;  1AXD A;  3M1G A;  2J23 A;  4L5L A;  4KND A;  1SEN A;  4PQ1 A;  1QMV A;  3RPP A;  3BCK A;  2V32 A;  4KX4 A;  1G7E A;  4MCU A;  2IWT A;  4WR5 A;  5CAX A;  2YCD A;  5CRG A;  4MP4 A;  2H6Z A;  1FB0 A;  3F4S A;  4N10 A;  3GKM A;  3EMP A;  5D9T A;  2B7K A;  2H19 A;  2TRX A;  3GHA A;  1SK1 A;  2FWH A;  2I9H A;  4JR4 A;  2WGR A;  3H1N A;  1Q98 A;  4WET A;  1R5A A;  4RQX A;  2B5Y A;  4PUF C;  2LV3 A;  1BQ7 A;  3UAP A;  3QCP A;  4KE3 A;  3WGX A;  4L5O A;  3LEF A;  4WR4 A;  4GCI A;  2B3S A;  1TW9 A;  2IME A;  2E2M A;  2X8H A;  2VCQ A;  12GS A;  2FWF A;  2VL3 A;  3GV1 A;  4DSQ A;  5ECS A;  19GS A;  5DAL A;  2DJ3 A;  5H5R A;  2PUK C;  5ID2 A;  1ERW A;  2V6K A;  8GSS A;  3QAG A;  2CQ9 A;  3VFI A;  4V2N A;  4MLY A;  4I8B A;  2IMI A;  3HZ4 A;  3BOA A;  1FHE A;  3US3 A;  3ERW A;  2ON5 A;  3KM6 A;  4Q5Q A;  4V2M A;  4Z7X A;  4IP1 A;  3LQ7 A;  3ME7 A;  3TJB A;  5G30 A;  4LMW A;  4TR3 A;  3KP8 A;  5EL8 A;  1VGL A;  1JZD A;  1ML6 A;  2M72 A;  5EVO A;  3W6G A;  5JCW A;  2AHE A;  3JCM L;  1M2B A;  3HA9 A;  4NV2 A;  4HU7 A;  1ACV A;  6GST A;  2AUV A;  1GSY A;  3N5O A;  4TW5 A;  3L78 A;  3ZLP A;  3E0U A;  4LL4 B;  4EL1 A;  1O6J A;  2MZC A;  5F05 A;  1PKZ A;  4TXO A;  5JWQ B;  4ZB9 A;  1N2A A;  4CDO A;  1GTI A;  2PGT A;  1ON4 A;  4HEA 2;  3FR3 A;  1OC3 A;  4F0C A;  1K0M A;  2H1G A;  2F51 A;  3FZ4 A;  2VL2 C;  4PNG A;  4N30 A;  4YQV A;  1OKD A;  3GA4 A;  4CHS A;  1OVN A;  3H4K A;  3ZL5 A;  1OKT A;  2H0G A;  1QK8 A;  1GWC A;  4JED A;  2O85 A;  3L0H A;  4KUN A;  1G6Y A;  2MYG A;  3WGE A;  4MAB A;  4IHU A;  4IJ3 A;  2FGX A;  5B6N A;  5ECR B;  1SL0 B;  1GNE A;  2OAD A;  20GS A;  1PKW A;  2X8C A;  1MD3 A;  1Y6E A;  5AIV A;  2PMT A;  1EWX A;  1KNG A;  4MJA A;  1V40 A;  3WT1 A;  1SK2 A;  1GUK A;  1K3O A;  5HR0 A;  4H86 A;  1JZW A;  5JCU A;  2GZY A;  1TU7 A;  2JAD A;  2H1B A;  2IY2 A;  3P8W A;  1MDK A;  4I2U A;  3CYN A;  1TP9 A;  1T4Z A;  5J9B A;  3GKX A;  4Q5R A;  6GSU A;  5IMD A;  3GH9 A;  3IK7 A;  3UVT A;  5E59 A;  5F8B A;  2H66 A;  1HNC A;  4XHM A;  3GTU B;  5G1L A;  1M7T A;  2VM1 A;  5LD0 A;  1JLW A;  1DE1 A;  4DSR A;  5ECH B;  5A5K A;  4ULX A;  3NIV A;  4LL1 B;  3KIJ A;  2MBT A;  4GF0 A;  1WIK A;  5KN3 A;  1TK5 B;  3LXT A;  2KP1 A;  2YZH A;  3NOF A;  4O92 A;  2IFQ B;  1ZZY A;  2BJX A;  1BX9 A;  2JSY A;  3EVI A;  4PX1 A;  2NBS A;  3QMX A;  5AIS A;  3F6F A;  4PUA A;  2C3Q A;  2I4A A;  5L71 A;  3TRX A;  1SD8 A;  2VD0 A;  2LNT A;  1THX A;  3PGT A;  1PN9 A;  1XOB A;  4EF0 A;  4I5Q A;  2FWE A;  1FOV A;  1TI1 A;  1XPV A;  3D21 A;  2M46 A;  2LTK A;  3DWV A;  3KJY A;  4ZL9 A;  3E9J B;  3CMI A;  2RM6 A;  3VI5 A;  1M9A A;  4XS6 A;  17GS A;  3VLN A;  4HU9 A;  4GSN A;  4GQC A;  3N9J A;  1CQH A;  1YF0 A;  2GT5 A;  2R4V A;  1A23 A;  4ID0 A;  1Z6M A;  1B9Y C;  3ZFL A;  3IR4 A;  5CO3 A;  4BA7 A;  1YKA A;  4PQI A;  4ECC A;  2RUF A;  4NAX A;  3PR8 A;  4TR0 A;  3HYP A;  3GL3 A;  3HVS A;  5G5E A;  4ECB A;  5JWR B;  2OE0 A;  1XWA A;  5GAN D;  5D73 A;  1T7P B;  4DSS A;  5DQS A;  2VCT A;  1YEX A;  1TRW A;  3L9V A;  1TRS A;  5A4V A;  4DVC A;  5D96 A;  3WGD A;  4EE0 A;  1GSE A;  5IMV A;  4RI6 A;  2YV9 A;  5DDL A;  2AYT A;  1GL8 A;  4FO5 A;  4AJ8 A;  6GSY A;  3GSS A;  1ZYQ B;  2JU5 A;  2R5G A;  4RUV A;  2VLU A;  3GUR A;  1ZYE A;  1ERT A;  3UJ1 A;  1XW9 A;  5DAL B;  1GTA A;  5ID2 B;  2FNO A;  1B8X A;  4G2E A;  3ZIV A;  3BCI A;  2OBI A;  14GS A;  3IK9 A;  5DVB A;  1V57 A;  2REM A;  2GLR A;  3UOM A;  2HLS A;  3H93 A;  4NMU A;  3F8U A;  3ISO A;  3F9U A;  2PU9 C;  1ZCP A;  1PMT A;  3CTG A;  3TDG A;  1U6T A;  3OR5 A;  1X9M B;  2LJA A;  4IVF A;  4G19 A;  4MPF A;  4PXO A;  5B8B A;  1SKW B;  2IIY A;  4WBJ A;  3MAK A;  3VUR A;  2QGV A;  4CW9 A;  4TXO B;  2GQK A;  1RQM A;  1E2Y A;  2HRN A;  2JZR A;  4MF5 A;  2R2J A;  4OFT A;  2LEG A;  3IV4 A;  3IBH A;  3DRN A;  3IPZ A;  2BMX A;  4GWR A;  1URM A;  1Z9H A;  5IMZ A;  5KN1 A;  4KDX A;  1KEB A;  2JL4 A;  1F6M C;  1M99 A;  5IIZ A;  3HCZ A;  1MTC A;  3O3T A;  4NWY A;  3LYP A;  4XS4 A;  2GSR A;  2L6D A;  4POM A;  1J0F A;  3Q18 A;  1K0N A;  3MSZ A;  1SYX A;  5COH A;  3G9B A;  5J41 A;  3UBL A;  2GST A;  3CRT A;  1A8L A;  4WBR D;  4XRA A;  2GS3 A;  3A2X A;  1TRV A;  1Z3E A;  1LJR A;  2WDU A;  3D4M A;  3UBK A;  2C8U A;  4EDY A;  1K3Y A;  4QL9 A;  4BL7 A;  2HT9 A;  1UVZ A;  5A4U A;  5G1K A;  3ZYW A;  1XWC A;  4HUA A;  1SJZ A;  3ZVJ A;  4L0W A;  4L0U A;  3HVX A;  2I1U A;  2E0Q A;  4N0V A;  13GS A;  5DCG A;  5J4U A;  2LST A;  2K8V A;  2OJL A;  4Q5F A;  1DUG A;  3FR9 A;  2BTO T;  1F37 A;  3ERG A;  2F8F A;  2L5O A;  4RQR A;  4HJM A;  2PVO C;  3IE3 A;  1C72 A;  2FLS A;  4V2L A;  3C71 A;  2H30 A;  5HFG A;  4MMM A; 
#chains in the Genus database with same CATH topology
 2MF7 A;  1AQV A;  1W02 A;  4ZXG A;  4HZ2 A;  2H0H A;  5F06 A;  5HR2 A;  1RLS A;  1KBN A;  2VLT A;  3G7Y A;  1T4Y A;  1QJG A;  1N9E A;  2YFL B;  2CT6 A;  3KMN A;  3D4T A;  1X1X A;  1HYU A;  4Q5N A;  3TJG A;  3JUN A;  4XBT A;  1HQO A;  2B7J A;  2OE3 A;  1EP7 A;  4ZBD A;  4ZIL A;  1K0C A;  4EUY A;  5IMA A;  2H73 A;  3CSJ A;  2YV7 A;  2YAN A;  1TKD B;  3F8H A;  2VIM A;  2CKF B;  4O8S A;  3WA3 A;  2CFD A;  1HYF A;  1HU9 A;  1F3B A;  2L4V A;  2HXK A;  3C73 A;  1Z7R A;  2BO9 B;  3J7Y k;  1KQS 2;  3CPW 2;  4YAP A;  1NHY A;  4F0B A;  2A2S A;  1SKR B;  2F99 A;  4KCE A;  3Q90 A;  2D42 A;  1O7G B;  4EW5 A;  1E3V A;  9GSS A;  1OC9 A;  4WXT A;  3GFK A;  2XEP A;  2LQQ A;  3KGK A;  3TOU A;  4BU4 A;  4MNN A;  3WOE B;  1TUH A;  1JFU A;  3TKS A;  3HZ8 A;  2YJH A;  3CU3 A;  3F9S A;  4O7H A;  4K61 A;  1R26 A;  1A24 A;  3IJE B;  4OUQ A;  8RNT A;  5AN1 A;  1K28 A;  3D22 A;  4WHA A;  1NHO A;  3GRX A;  5HOH A;  3QDN A;  1X0R A;  9RNT A;  2B24 B;  2MMN A;  2UGI A;  2P38 A;  2DSA A;  1VQL 3;  2WRT A;  1NO3 A;  2H01 A;  3S9F A;  3BU4 A;  2QSI A;  4N6N B;  2CV4 A;  4POL A;  5GZZ B;  3U6V A;  1I2E A;  1GMP A;  5KP4 A;  2DJ0 A;  3BD2 A;  5H5S A;  2TIR A;  4GST A;  5DQY A;  2CZ3 A;  1TP6 A;  2XGL A;  1O8X A;  1YZX A;  1T1V A;  3VWV A;  2W0Q A;  3F40 A;  1PA3 A;  2CAQ A;  5IQY A;  4I4K A;  2R6K A;  3H8Q A;  3VPT A;  1HNB A;  2KLX A;  2H76 A;  4X4J A;  2B1K A;  1Q4J A;  3ZML A;  3DYR A;  5IEO A;  4K8M A;  1X1U A;  2B1L A;  1UGI A;  3KZQ A;  1O7W B;  3UAR A;  1BRS A;  2YJ7 A;  1BSE A;  3L9S A;  3KTL A;  2PER A;  3ROB A;  2V41 A;  1A67 A;  4IW9 A;  2AAD A;  2QKE A;  3VWW A;  3DM8 A;  5IOX A;  1IDP A;  2VCV A;  3QAV A;  2B5E A;  2O8V B;  1CEW I;  2VLV A;  1XW5 A;  2HE3 A;  2XFS A;  2HSH A;  3RGR A;  5KP1 A;  4K2D A;  1B2M A;  4DSS B;  1IT7 A;  2OCT A;  1O8W A;  3AMO A;  3I56 3;  1UC7 A;  1W4N A;  2ON7 A;  2C4B A;  3LXZ A;  2H70 A;  2R37 A;  2LNS A;  1T00 A;  7GSP A;  4XRD A;  1VZZ A;  4L8P A;  3GL5 A;  3F3R A;  2YPM A;  4BVX A;  1KTE A;  2F9S A;  3U5R E;  2BMO B;  4TR1 A;  3M9J A;  3FG1 A;  3Q74 A;  2EIO A;  1YVB I;  4K90 B;  4MA9 A;  1R4Y A;  3HHV A;  4O5R A;  1YDK A;  4FMA A;  3QOU A;  3TOT A;  3A76 A;  1ERU A;  3EN8 A;  1RCL A;  4KFD A;  3FG4 A;  1GSD A;  1ZX2 A;  3S28 A;  2CA8 A;  3IMA B;  2LUS A;  4WYK B;  5CXO A;  1S3D A;  2CHC A;  4YAV A;  3V1W A;  4BWS A;  1ZO2 A;  2DIY A;  4E8H A;  1UUG B;  4K0G A;  1ZS7 A;  3HKR A;  1H75 A;  5ENU A;  4LEH A;  2K3D A;  3IHQ A;  3VF1 A;  4TXV A;  3FKA A;  3L0R A;  2FA8 A;  2RFR A;  3EC9 A;  2VAF A;  2D1W A;  3CSI A;  1NM3 A;  4MJB A;  5KEJ A;  2XSH B;  3RDW A;  3CCJ 3;  1YF1 A;  1Z5Y E;  3HX8 A;  3RPN A;  4TVE A;  4GHO A;  1BRI A;  1FGM A;  2G0F A;  1VQK 3;  1FO5 A;  3CNM A;  1Q40 B;  5AIG A;  4HOJ A;  1IK3 A;  4GSP A;  2QIY A;  3K5T A;  3KFQ C;  1J2B A;  2WFC A;  1FUW A;  3EE2 A;  5IOW A;  3MG1 A;  4LA1 A;  1VF2 A;  5EQL A;  1GS3 A;  2STD A;  1LOX A;  3AGO A;  1Z6N A;  4XTS A;  3OWS A;  4F2I A;  1SQW A;  1C54 A;  2K6V A;  3IAS 2;  1O7U A;  2HSY A;  2P5R A;  4PQH A;  3M3M A;  3D3L A;  2F5W A;  1F3A A;  2C4J A;  5H5Q A;  1GOY A;  4BVY A;  1XXU A;  2CFL A;  1RN4 A;  2YOI A;  1JB5 A;  1M0U A;  3FRC A;  3LW9 A;  4GTU A;  2IJY A;  1BRG A;  1B4Q A;  3HJP A;  4K2X A;  1FB6 A;  1GRX A;  5ELU A;  5B8A A;  3D5I A;  1QMA A;  5LC7 A;  1RKY A;  2WCI A;  2LQO A;  1B9X C;  5LC6 A;  1XFL A;  4KZ1 A;  3UNL A;  4HM5 B;  4TR4 A;  4OCF A;  1Q86 4;  4RNT A;  5IMF A;  3NBR A;  3KH9 A;  2OOV A;  1MWU A;  1F9M A;  1GUH A;  2BMR B;  5BU4 A;  4OO4 A;  1BED A;  4LGQ A;  1HNA A;  1NSW A;  5GST A;  4CJN A;  1MWR A;  2W9Q A;  1QVF 2;  5HFK A;  5IM9 A;  1BJX A;  5D9V A;  2PZV A;  3WD6 A;  1I70 A;  5FT3 A;  1U3I A;  4OMV A;  4DEJ A;  1EUI C;  2XBQ A;  3IDV A;  1K3L A;  2Z7A A;  1WRY A;  2ES7 A;  4N6L A;  2H6X A;  4OK0 A;  4BTW A;  1YGE A;  4HZ4 A;  3ZRE A;  4KB3 A;  1BGS A;  5D9X A;  3GUS A;  4KDU A;  3NBB A;  4GSS A;  2LRN A;  2L59 A;  4HJL B;  1QAK A;  1FOH A;  5GSS A;  3A3T A;  2KOK A;  4J2F A;  1V58 A;  4JR6 A;  1SIH A;  1BUJ A;  1QAF A;  3HD5 A;  5C04 A;  3PS8 A;  3SLU A;  4EC0 A;  3D5J A;  2FD3 A;  3JVC A;  1XVQ A;  1NU3 A;  4ZBB A;  1G6W A;  4R9L A;  5INY A;  8CHO A;  1NJI 4;  4IGJ A;  3ZG0 A;  4OCE A;  1U5O A;  5DBQ A;  1XVW A;  4FH8 A;  5IMC A;  4R4K A;  4BL7 B;  3FF2 A;  4LMV A;  7GSS A;  4MJE A;  3GX0 A;  5D93 A;  4FMC A;  3W8J A;  1O81 A;  3CTF A;  1X1W A;  2ALB A;  1PX6 A;  2K54 A;  2WZ9 A;  5EPF A;  1XWG A;  1V2A A;  3ZIT A;  1DET A;  6RNT A;  1XCC A;  1A0F A;  3DGQ A;  2C0D A;  1T8E B;  1K41 A;  1YKC A;  4HYZ A;  4HM2 B;  4HS1 A;  1A0R P;  4MZC A;  5AEW B;  3KMO A;  3DH2 A;  4XIH A;  3FSD A;  4G9H A;  2RSX A;  1BG5 A;  1BNG A;  2YN1 A;  2CX1 A;  2Y74 A;  4ZL7 A;  2RNT A;  3EMX A;  5IO0 A;  1DBY A;  3RHC A;  2NDO A;  4F03 A;  1S3A A;  4STD A;  4FQU A;  5E4W A;  1WMJ A;  1OYJ A;  3CNX A;  1XWB A;  5ELA A;  3F63 A;  1VQ5 3;  4OD7 A;  1TTO A;  3NM2 A;  1IVX A;  2W56 A;  2XBI A;  2XHF A;  1EZK A;  5ECN B;  1U88 A;  5ELJ A;  2R0P A;  1DMQ A;  1U87 A;  2FCH A;  3LOR A;  2YFI B;  3F4R A;  1F8N A;  1AC1 A;  4QL7 A;  2KF4 A;  3P2A A;  6GSV A;  2CK3 H;  5G31 A;  4JF8 A;  2JZS A;  1PFP A;  2FWG A;  3GIX A;  5GSP A;  3CRU A;  4EIQ A;  4ML6 A;  1YHQ 3;  2DKI A;  4BWQ A;  3AY8 A;  1YY7 A;  1OC9 B;  3TKS E;  1RMS A;  1ULI B;  4IN0 A;  1SPU A;  2B1X B;  2DKH A;  3CSH A;  2QGU A;  2K18 A;  5RNT A;  1X5D A;  1EGR A;  5ECQ B;  3LWA A;  4ECJ A;  2KCD A;  2H74 A;  4U13 A;  3HY2 A;  2FNQ A;  1H4O A;  4HM1 B;  1N8J A;  4POK A;  1LVN A;  3KSP A;  2WS2 A;  3TUE A;  2CVK A;  11GS A;  1G96 A;  5IEP A;  2O7K A;  3S27 A;  1RGG A;  4EIP A;  4Q53 A;  3QPM A;  3GN3 A;  4KAE A;  4JBB A;  3BB9 A;  6GSW A;  1JRQ A;  1MD4 A;  3DGL A;  2LKU A;  10GS A;  1RGC A;  1O7M B;  4KSM A;  2HML B;  1YJ6 A;  1GLQ A;  3CMA 3;  4EKZ A;  4JE1 A;  4GQF A;  4Z2U A;  1PQN A;  2KF5 A;  2HNL A;  4AJ6 A;  2ZL8 A;  3F14 A;  2GU1 A;  3UIW A;  3MNG A;  1G0T A;  1JBT A;  2C3N A;  2YNX A;  5CRH A;  4EBG A;  5IG4 A;  3CD6 3;  3KE7 A;  4HVN A;  1WOU A;  2GTU A;  2HMJ B;  2B6M A;  2KUC A;  3GST A;  3TJJ A;  1AQZ A;  1ZOF A;  3OX9 A;  3FW2 A;  4XDV A;  4LMI A;  2A2R A;  3UEM A;  2N5A A;  4MF6 A;  4EYC A;  2F3M A;  1WTH A;  3RAZ A;  4K7I A;  4XBY A;  4HI7 A;  2XFT A;  3GKN A;  2KP2 A;  3CPO A;  1BYE A;  3F0I A;  2DIZ A;  2RLI A;  5ELG A;  1ZGN A;  4MZB A;  1X5E A;  1EEM A;  1V98 A;  1SYR A;  1YQ1 A;  1ILO A;  2QA4 3;  2E2U A;  2HYX A;  1M3I A;  1USB A;  2IUJ A;  1LXE A;  1WMO A;  3GZX B;  2XPE A;  4PUR A;  4BL3 A;  1WMP A;  5D9W A;  1OHO A;  3KEB A;  3AMO B;  1X5C A;  3FKF A;  3A5I A;  3FZA A;  1OE7 A;  1FAA A;  2HMN B;  1EP8 A;  1ZMA A;  1HZ1 A;  3EWL A;  1SL1 B;  4IP6 A;  2TRC P;  5CRD A;  3KII A;  3F8X A;  1K9M 4;  3ZTL A;  2WOF A;  3F3Q A;  1UI7 A;  2DJ1 A;  1GLP A;  3D5G A;  3RDE A;  5AIX A;  4BVX B;  5A4W A;  4I2T A;  1UN2 A;  2HRK A;  1J08 A;  1YI2 3;  1O85 A;  2VL2 A;  4TR1 B;  5TGN A;  4NHF A;  4F82 A;  1T2H A;  3FR6 A;  4ISD A;  5FHI A;  1BUQ A;  1THO A;  4KGI A;  4N11 A;  1IYI A;  3DXB A;  3FZW A;  3I0Y A;  4NXI A;  4RBN A;  2GEY A;  3OXA A;  3RHB A;  4YQM A;  3PIN A;  3D4A A;  1LNI A;  3KN4 A;  4EVM A;  1FGT A;  4J9A A;  1O7P B;  3LFL A;  4QQ7 A;  2L5L A;  2OTJ 3;  3M9K A;  4ACS A;  1RDS A;  2F56 A;  3EB8 A;  3LYK A;  2XPD A;  4MDC A;  5GAP D;  1GP1 A;  1WWJ A;  3FK8 A;  1IYH A;  4Z2R A;  3M0F A;  1LRA A;  3A2W A;  1XIY A;  2GZZ A;  4G0K A;  1EOG A;  1EV9 A;  2DML A;  5AIF A;  1GSQ A;  2YZU A;  2MMO A;  3L4N A;  3DXO A;  1Q82 4;  3MIX A;  2CVD A;  2F4Y A;  4G0L A;  2F8A A;  2RM5 A;  1SJ6 A;  1EGO A;  4HDE A;  3LGC A;  4AGS A;  2I3Y A;  2LYX A;  1CYU A;  3G7I A;  1I0V A;  4IS0 A;  1GMR A;  3HI7 A;  2QA1 A;  3VWU A;  4NHW A;  2WJU A;  5ECM B;  2WB9 A;  1ERV A;  2CWU A;  1E97 A;  1YEP A;  3DVW A;  1JN5 A;  1DE2 A;  4PNF A;  5KN0 A;  3AHS A;  3G4S 3;  1VF1 A;  5J5N A;  1PL2 A;  1EOH A;  3NHX A;  1PGT A;  2LJR A;  1B21 A;  1TFO A;  3E3E A;  3KP9 A;  2HMM B;  3QR6 A;  2ZCT A;  3EIN A;  2RUE A;  2Z76 A;  3HVV A;  1UCJ A;  4KCA A;  2V2G A;  1TI3 A;  2CX3 A;  1EEJ A;  3K63 A;  2P0G A;  5G2Z A;  1PRX A;  4J5K A;  4IQ1 A;  4Z2T A;  4KFE A;  4HQS A;  1GH2 A;  2P0M A;  3MG2 A;  4CPK A;  1QGV A;  4BVY B;  5ABR A;  1GD3 A;  2WGO A;  3BND A;  4MJC A;  1M2D A;  4POB A;  2XR8 B;  1QUW A;  1WE0 A;  2PNC A;  5CF1 A;  3LH4 A;  1NNV A;  1KD1 4;  4K1V A;  2E7P A;  4N0Z A;  3SBC A;  2BU4 A;  1OAC A;  2M7O A;  3KCM A;  1CH0 A;  1BSB A;  1AUC A;  2C10 A;  2KHP A;  3IXR A;  2HI7 A;  3PPU A;  3EN1 B;  4HQZ A;  4CDL A;  1TFK A;  5M18 A;  1GUM A;  4EDZ A;  2O89 A;  1W00 A;  4RI7 A;  1JNQ A;  1OAZ A;  3MYT A;  3GAX A;  3G71 3;  3IAM 2;  3IA1 A;  1IV7 A;  5IO2 A;  5IEN A;  3S67 A;  2WOH A;  2YFJ B;  3NV0 A;  1FUT A;  3B7C A;  3MWH A;  4IJI A;  1CQS A;  2OBK A;  4CCV A;  1UCL A;  4OVM A;  1TTZ A;  3S5C A;  1M2A A;  4ZL8 A;  1GTB A;  5BMU A;  2E2G A;  2J9H A;  2DC5 A;  1N5H A;  3APS A;  2AV4 A;  3VWX A;  4EXR A;  1VF3 A;  3FZ5 A;  3CC7 3;  5HR1 A;  2V1M A;  4R80 A;  4LLR A;  4GL6 A;  4IT7 A;  3ERF A;  2AAW A;  3BNE A;  2FGT A;  2IMJ A;  3KXO A;  1QXH A;  4MK3 A;  1S3C A;  1SK0 A;  3WT2 A;  4D73 A;  1T5Y A;  1TJD A;  3G7J A;  1PSQ A;  1WJK A;  4TN8 A;  1RGA A;  3K8N A;  1DVC A;  1MEK A;  1R4W A;  2N5F A;  3HXS A;  1JKG A;  1R5P A;  4TOP A;  1JLV A;  2DJJ A;  1LU4 A;  3V99 A;  1EKM A;  3CXG A;  3QFA C;  3X3X A;  2RGQ A;  1GTU A;  1AVK A;  3AHW A;  5M19 A;  2AB6 A;  5JCG A;  4K7O A;  3HJO A;  4FIW A;  4WF5 A;  1DMN A;  5BVB A;  1ABA A;  1BAY A;  1OGX A;  2CG1 A;  3HVN A;  3UL3 A;  4ECI A;  1SJI A;  4JZQ A;  4KDY A;  3E99 A;  3PXM A;  3CBU A;  1VQ4 3;  3GSP A;  2CAI A;  2L6C A;  1MNL A;  2GSQ A;  2P09 A;  4FYB A;  1SJW A;  1X9W B;  1JZO A;  2AAE A;  1VRS D;  4GXZ A;  1GY6 A;  2OKA A;  5B6M A;  2L4C A;  1FGQ A;  2GDR A;  1BNE A;  4X2H A;  1PL1 A;  3IC8 A;  2W56 B;  1O7H B;  2GBX B;  3MWZ A;  3TB2 A;  1UGH I;  2C0G A;  1K8A 4;  4TRX A;  4ZIJ A;  3ZG5 A;  1FW1 A;  3CCV 3;  3SED A;  3I6A A;  2IPA A;  1IVV A;  3TRP A;  1ZL9 A;  3GH6 A;  1BNS A;  2ZNM A;  3F6D A;  2OQE A;  5F07 A;  3A5E A;  1XWK A;  1C7H A;  5DRV A;  4WF4 A;  4X0X A;  1BSD A;  5FGO A;  1B48 A;  1PFO A;  2A4V A;  1GOU A;  3DGO A;  3EU4 A;  1U8C B;  1IQX A;  1LBK A;  3MDK A;  1OC8 A;  1W2Z A;  2MMA A;  4BPY A;  5LCZ A;  3OW2 2;  1M9B A;  2SAR A;  4MZW A;  1LNH A;  4MF7 A;  4I6X A;  3A5W A;  4EV2 A;  3DMC A;  2H1D A;  2CWT A;  3K9M C;  2X64 A;  4K1F A;  4NHZ A;  2XF3 A;  5JPU A;  4KW6 A;  1RGF A;  1K0B A;  2HZE A;  1XOA A;  4FR9 A;  1FVJ A;  1ISK A;  4I97 A;  2MMZ A;  5B7C A;  1GOV A;  2HRF A;  5KOX A;  1UA5 A;  5DCH A;  4MPG A;  2IMF A;  1PX7 A;  3EHC A;  5EY6 A;  4OO5 A;  2XRX B;  1YGW A;  7RNT A;  2LJK A;  1GSP A;  2ML6 A;  1AQX A;  2HRA A;  4HJ2 A;  3EBY A;  5IER A;  4KF9 A;  1AQW A;  1R7H A;  4JRR A;  1A2L A;  4GLT A;  4FYU A;  2IMD A;  4CY6 A;  2CG0 A;  3CCE 3;  2DLX A;  2MBS A;  4LSO A;  2VCW A;  3APQ A;  2IA7 A;  3TJF A;  2CX4 A;  1BSC A;  1K73 4;  2I81 A;  2FY6 A;  7STD A;  3HK4 A;  1A2P A;  3FYG A;  5CNW A;  1I8V A;  1TK8 B;  2Z9S A;  1ASK A;  3FMW A;  3BBY A;  2FUG 2;  1TU8 A;  2XGN A;  1JV2 B;  1IT8 A;  2O9U X;  1W6C A;  3ZZX A;  3O6T A;  3D0Z A;  2V6O A;  1OH0 A;  3B8L A;  4HM4 B;  5EEO A;  2M80 A;  2OE1 A;  2F5M A;  3J7Y b;  1AIU A;  4L8E A;  4HSC X;  1YNV X;  1TK0 B;  2VOC A;  3H79 A;  1N8Q A;  1LOV A;  1AV4 A;  4K5R A;  1B2U A;  3ZRD A;  2SBL A;  3LZA A;  1K0A A;  4ZBA A;  2CFK A;  4G0I A;  5KN2 A;  1QQ2 A;  3QD9 A;  1VQ6 3;  5IG3 A;  1LQM B;  4DKI A;  1G7O A;  5ECP B;  3TKQ A;  2PN8 A;  2Z6B A;  3LG6 A;  2H71 A;  3DY5 A;  4WKW A;  4P3Y B;  3IRA A;  1GSF A;  2VL9 A;  5D82 A;  3IHG A;  5DAK A;  3TKR A;  1UW1 A;  4IIA A;  4IQA A;  4O32 A;  1GMQ A;  2WUL A;  5DJL A;  1GNW A;  2PPT A;  1A8Y A;  1TIJ A;  1Q7H A;  1ST9 A;  4O3V A;  3SXX A;  3G6E 3;  3DD3 A;  22GS A;  2QEX 3;  3FF0 A;  3KKG A;  2G2Q A;  2JSZ A;  1SD9 A;  3QAW A;  2C80 A;  3LTC A;  3NZN A;  4XS4 B;  2YP6 A;  3UL5 A;  3BNB A;  4K1U A;  4YQU A;  1JB4 A;  1M1K 4;  1BNF A;  3LJR A;  2J8X B;  2VM2 A;  4FYC A;  4XS1 A;  4WFO A;  5CRE A;  18GS A;  3QFB C;  5ECL B;  4MH3 A;  2B5X A;  4KFF A;  4O02 B;  4KSO A;  2P05 A;  4E8E A;  2X49 A;  2H75 A;  1JZR A;  3T8U A;  2GT6 A;  1IU7 A;  1JN5 B;  2YWO A;  1O7N B;  6GSP A;  2LQV A;  4V1A g;  1BVI A;  3CCM 3;  3C7M A;  5EVH A;  5AII A;  1UCI A;  2GSS A;  2CWV A;  2CFW A;  3Q3F A;  3GZR A;  3PH9 A;  3C1S A;  2N5B A;  2VCZ A;  2H0I A;  3H51 A;  4RNZ A;  3I55 3;  1I9D A;  1V9W A;  4AJ7 A;  1NW2 A;  3BJ5 A;  2EC4 A;  4HBR A;  1YVS A;  3W8S A;  2RII A;  4J8T A;  2R3X A;  1B20 A;  3VGN A;  1WP0 A;  1T2I A;  5JWO B;  2GVP A;  1YIJ 3;  3LT8 A;  6GSS A;  1FG4 A;  1NB3 I;  3NQY A;  1PN0 A;  2NVL A;  6GSX A;  1FVK A;  3VI7 A;  1X9S B;  2HSM A;  3DVX A;  1FGO A;  4IKH A;  3WR2 A;  2PWJ A;  2AJQ B;  3P7X A;  3EJV A;  1O73 A;  3LML A;  5ECK B;  3BLZ A;  1PY3 A;  4X1U A;  1AW9 A;  3KD0 A;  3N8B A;  1RGE A;  2OTL 3;  3FZ9 A;  3Q19 A;  4LZI A;  4IEL A;  5IPH A;  3WOF B;  3DML A;  4KA0 A;  4F9Z A;  4KH7 A;  4MH2 A;  4XCS A;  3NV0 B;  2NTO A;  3DEX A;  2ML5 A;  1XZO A;  5AI1 A;  4HM6 B;  4L7K A;  2C1Y A;  2L57 A;  5AGY A;  1OE8 A;  2PBJ A;  3MG3 A;  3GMF A;  1Q81 4;  4N6V 0;  3R2Q A;  3I9V 2;  3X41 A;  3KH7 A;  3TKS C;  3EYT A;  4BTY A;  2KXG A;  3FGY A;  3FCS B;  5J3R A;  2FA4 A;  3X40 A;  3X3Y A;  1Y25 A;  5CRW A;  3JUM A;  4HAA A;  3KCH A;  4JU5 A;  1GUL A;  3GNJ A;  3VSY A;  1SKS B;  5AYS C;  3O8Y A;  4X43 A;  4D73 B;  2EIQ A;  2YWN A;  1ULJ B;  1BU4 A;  4HM3 B;  1S5A A;  3VPQ A;  2CIU A;  3G8Z A;  5F0G A;  3KSE D;  4PGT A;  1AAZ A;  1TXX A;  4OWY A;  2YWM A;  1JKG B;  3IC4 A;  3UB1 A;  3GZB A;  1A2M A;  2C0E A;  4OFM A;  4IBP A;  2PVQ A;  3EU3 A;  3FEU A;  5IPG A;  3Q2P A;  1WNH A;  5STD A;  3APO A;  4L8O A;  2W6J H;  2VUP A;  3UMA A;  2YWI A;  1TRU A;  3NX0 A;  1VQO 3;  2GGT A;  1BNJ A;  1Z7P A;  1FUS A;  4ILF A;  1RK4 A;  2IMK A;  4RZM A;  3SOY A;  1B2X A;  1B27 A;  1AY7 A;  5KP3 A;  1DSB A;  2EIR A;  4O5Q A;  1V74 A;  3X42 A;  3V98 A;  2P31 A;  3RBT A;  2O87 A;  1VF4 A;  4HKV B;  2VO4 A;  3RGA A;  3MKI A;  2H72 A;  2L4Q A;  4V1A p;  2DMM A;  4K0N A;  2QC7 A;  4WP5 A;  3EC3 A;  4ML1 A;  3FH1 A;  3TKP A;  1VQQ A;  2GU3 A;  3LOY A;  2KRT A;  3UJM A;  2K9F A;  1MGW A;  1MDJ A;  3ME8 A;  1K0D A;  5J9C A;  1IVW A;  4AF2 A;  3EX9 A;  1MDI A;  2OAC A;  4NRE A;  1U3A A;  1IV9 A;  5LNK e;  3ZFB A;  3VK9 A;  5CYY A;  1CQG A;  2HFD A;  3SOA A;  4ZB8 A;  1XW6 A;  3K7C A;  5HQP A;  3NM7 A;  2FHE A;  2IL3 A;  3ED3 A;  1D6U A;  2NPB A;  4GRF A;  1N9J A;  3OWY A;  3WYW A;  4WYK A;  5G5F A;  3GZY B;  3NBJ A;  3SWL A;  1JBS A;  1QFN A;  4EXJ A;  3FY7 A;  4EO3 A;  1RGK A;  1B4P A;  2VD1 A;  2RCD A;  1TDI A;  3I43 A;  1WPI A;  2WO0 A;  1A2J A;  3P90 A;  2E2T A;  5HFI A;  2GQL A;  2CFG A;  2D2Z A;  3M8N A;  5FWG A;  3HDC A;  3GYK A;  5D8I A;  2X99 A;  4K7N A;  2HZE B;  3O76 A;  3EE1 A;  2IN3 A;  3ECF A;  2VCX A;  1RW1 A;  4G1M B;  3LSZ A;  2CVB A;  4NPB A;  1E6B A;  3BNC A;  5CP1 A;  1MWS A;  2UUG C;  2H1A A;  2GBW B;  4A5P A;  2ZUP A;  1PYL A;  2DJK A;  1YJW 3;  16GS A;  5JBS A;  2DBC A;  3ZVJ D;  2GQM A;  1I0X A;  4K6X A;  4OFN A;  5A0O B;  3NQZ A;  2JAC A;  5C00 A;  2V1L A;  4BTX A;  1JHB A;  1XBS A;  3LXU X;  1BNR A;  2BHM A;  2C0F A;  2W2C A;  1RNT A;  2CZ2 A;  3ZMK A;  5IG5 A;  2C3T A;  1RGL A;  2LS5 A;  3TGZ A;  3GKK A;  1TOF A;  2GZP A;  1STF I;  2UZ8 A;  2HZF A;  3JUO A;  4MMZ B;  3KTB A;  1Y4K A;  3DIE A;  5HR3 A;  3WOD G;  2P5Q A;  2JZT A;  5DJM A;  3EUR A;  2QA2 A;  1SL2 B;  3GTU A;  4J57 E;  1QAL A;  4HZB B;  3FHK A;  3TCO A;  3TRQ A;  4J56 E;  6STD A;  2XH9 A;  3F4T A;  3TJK A;  4XB5 A;  1J9B A;  1JB2 A;  4NV5 A;  2LRC A;  1GYB A;  4ZB6 A;  1I3F A;  1SU9 A;  3LT9 A;  2A2P A;  5ECI B;  1K0O A;  2XC2 A;  5FW5 A;  4YH2 A;  3C1R A;  4ZM8 A;  3D6I A;  2OA7 A;  2LRT A;  2X8G A;  2BNG A;  3GX8 A;  2IFQ A;  1LQG C;  1A2V A;  2OOV C;  3C8E A;  1EV4 A;  4MMY B;  5M1A A;  4G10 A;  3DKS A;  5DAK B;  3STD A;  3L9U A;  1WQL B;  3I69 A;  3ALA A;  5KOW A;  2K8S A;  2DJ2 A;  3JUQ A;  3IOS A;  1GSS A;  3UVH A;  1PD2 1;  4KVH A;  1W89 A;  2H6Y A;  1LOY A;  2H8L A;  5ECO B;  2K0M A;  1GSU A;  1HD2 A;  3ZIJ A;  1S3R A;  3GRD A;  3R3E A;  2IYJ A;  3Q6O A;  1VQ8 3;  4K9Z A;  4WEY A;  1W4V A;  4YKF A;  3HJM A;  1F2E A;  3A2V A;  1T3B A;  2GXF A;  1I5G A;  2X4A A;  4TKY A;  1AXD A;  4EC6 A;  3M1G A;  4N6M A;  3G16 A;  2J23 A;  4L5L A;  1ROA A;  4KND A;  1IQY A;  1SEN A;  4PQ1 A;  1QMV A;  3S29 A;  3RPP A;  4AEQ A;  3BCK A;  2CX0 A;  2V32 A;  1GY7 A;  3WDG B;  4N6T A;  4KX4 A;  1G7E A;  4MCU A;  2IWT A;  4WR5 A;  5CAX A;  2YCD A;  5CRG A;  3FG3 A;  3PZW A;  2F98 A;  4MP4 A;  4O2H A;  2H6Z A;  3EQQ B;  2R0C A;  1FB0 A;  3F4S A;  4N10 A;  3GKM A;  4QWT A;  3EMP A;  2I9W A;  5D9T A;  2B7K A;  2H19 A;  3J7Y d;  3Q1C A;  2TRX A;  3GHA A;  3ZFZ A;  1A2K A;  1SK1 A;  2R0G A;  1JJ2 2;  4YKG A;  1LOW A;  2FWH A;  2I9H A;  2BT3 A;  4JR4 A;  1D6Z A;  2WGR A;  1JBR A;  1BRK A;  3H1N A;  1Q98 A;  1NWW A;  4WET A;  1R5A A;  4ORL A;  1STD A;  2BIR A;  3CCQ 3;  3K0Z A;  4RQX A;  1RJO A;  1IYY A;  3CCL 3;  2FXT A;  3JUP A;  2B5Y A;  4PUF C;  2LV3 A;  1BQ7 A;  1MOL A;  3UAP A;  3PYJ A;  1OCV A;  1Q9E A;  3QCP A;  4KE3 A;  3WGX A;  5HGR A;  3LEF A;  4L5O A;  4WR4 A;  4GCI A;  1BAO A;  3MSO A;  2B3S A;  1YIT 3;  1TW9 A;  2IME A;  2HOH A;  2E2M A;  1XG8 A;  1AR0 A;  2X8H A;  2VCQ A;  12GS A;  4K5S A;  2FWF A;  2VL3 A;  3GV1 A;  4DSQ A;  5ECS A;  1MWT A;  19GS A;  5DAL A;  2DJ3 A;  4FMB A;  5H5R A;  2PUK C;  5ID2 A;  3PCS A;  1ERW A;  3CCS 3;  2V6K A;  8GSS A;  1BRJ A;  3QAG A;  2CQ9 A;  3VFI A;  1EA2 A;  4V2N A;  4MLY A;  3OWU A;  4I8B A;  2IMI A;  3HZ4 A;  3BOA A;  2JQ5 A;  1FHE A;  3US3 A;  4RNY A;  3ERW A;  2ON5 A;  1I2G A;  5IF6 A;  3KM6 A;  5CLK A;  4Q5Q A;  2CW9 A;  4H3U A;  2KF3 A;  4V2M A;  4Z7X A;  3SVA A;  1BRN L;  4IP1 A;  4O5U A;  3LQ7 A;  3ME7 A;  1M90 4;  3MYD A;  5G30 A;  3TJB A;  4LMW A;  4TR3 A;  3KP8 A;  5EL8 A;  1VGL A;  1JZD A;  1ML6 A;  2M72 A;  5EVO A;  5CF2 A;  4N6O B;  3EBT A;  3W6G A;  5JCW A;  2AHE A;  3JCM L;  3DUK A;  1M2B A;  3D9R A;  3HA9 A;  4HU7 A;  4NV2 A;  1ACV A;  3HZP A;  3LYG A;  4HZ9 B;  3CME 3;  2AUV A;  6GST A;  4JRF A;  1GSY A;  3N5O A;  4TW5 A;  3L78 A;  3ZLP A;  3E0U A;  1Q42 A;  4LL4 B;  4FCZ A;  4EL1 A;  1O6J A;  4XM4 A;  2MZC A;  3GWR A;  5F05 A;  1PKZ A;  4TXO A;  5JWQ B;  1EG9 B;  1N5P A;  4ZB9 A;  1N2A A;  1OHS A;  3NXJ A;  4CDO A;  1GTI A;  1BOX A;  2PGT A;  1ON4 A;  4HEA 2;  1GY5 A;  3FR3 A;  1OF5 A;  1OC3 A;  4F0C A;  1ZYP A;  1SAR A;  1K0M A;  1BIR A;  5I97 A;  2H1G A;  2UX0 A;  4PTS A;  2F51 A;  4MMX B;  3FZ4 A;  3V92 A;  2VL2 C;  4PNG A;  4N30 A;  4YQV A;  2Q07 A;  2INX A;  3X3Z A;  3CC2 3;  1OKD A;  3CC4 3;  3GA4 A;  4CHS A;  1OVN A;  3H4K A;  3ZL5 A;  1OKT A;  2H0G A;  1QK8 A;  1GWC A;  4JED A;  2O85 A;  4BL2 A;  4R1K A;  3L0H A;  4KUN A;  1G6Y A;  4X2O A;  1M9G A;  1N8R 4;  2IUK A;  1ZYN A;  1B2Z A;  2MYG A;  2HMO B;  3WGE A;  4XDW A;  1X1Y A;  3B4O A;  1RN7 A;  4HM8 B;  4MAB A;  2ZA4 A;  4IHU A;  3OV4 A;  4IJ3 A;  3LTA A;  2FGX A;  5B6N A;  5ECR B;  2CC3 A;  1FA3 A;  1SL0 B;  1GNE A;  3UL6 A;  2OAD A;  3DGN A;  20GS A;  1NB5 I;  1PKW A;  4N6U A;  1FW7 A;  2X8C A;  1MD3 A;  1Y6E A;  5AIV A;  2PMT A;  4CY8 A;  1EWX A;  1B3S A;  1KNG A;  4MJA A;  1V40 A;  2W03 A;  3WT1 A;  1SK2 A;  1GUK A;  1K3O A;  1PU4 A;  3U1W A;  5HR0 A;  5BXQ A;  4H86 A;  1DVD A;  1JZW A;  5JCU A;  3H3H A;  2GZY A;  1TU7 A;  2W04 A;  4FMD A;  2JAD A;  2H1B A;  1OUN A;  2IY2 A;  3P8W A;  1MDK A;  4I2U A;  3CYN A;  1IQ8 A;  1RRH A;  1KC8 4;  1TP9 A;  1T4Z A;  5J9B A;  1Z1S A;  3GKX A;  4Q5R A;  6GSU A;  5IMD A;  3GH9 A;  3IK7 A;  3UVT A;  5E59 A;  5F8B A;  2H66 A;  1HNC A;  4XHM A;  1R4C A;  3N9H A;  4N3V A;  3GTU B;  1CYV A;  3DGM A;  2GEX A;  5G1L A;  1M7T A;  4EV5 A;  1EQK A;  2VM1 A;  5LD0 A;  3IPT A;  1JLW A;  5AEU B;  1DE1 A;  3BIR A;  4DSR A;  5ECH B;  2BMQ B;  5JPP A;  4PEJ A;  5A5K A;  4ULX A;  3NIV A;  4LL1 B;  1ROV A;  3DGY A;  2MBT A;  3KIJ A;  4GF0 A;  1WIK A;  3WMD A;  5KN3 A;  1TK5 B;  3CCR 3;  3MHE A;  4USS A;  2A15 A;  3LXT A;  2KP1 A;  2YZH A;  3NOF A;  2A4H A;  4O92 A;  2IFQ B;  1VQ7 3;  1ZZY A;  2BJX A;  5BRT A;  2W9P A;  1BX9 A;  3QK9 A;  2JSY A;  1AVL A;  1W6Y A;  3EVI A;  4PX1 A;  2NBS A;  3QMX A;  1RCK A;  5AIS A;  1VQP 3;  3F6F A;  4PUA A;  2P0X A;  2C3Q A;  3WHO A;  2I4A A;  5L71 A;  3TRX A;  2ZDJ A;  4AKZ A;  1SD8 A;  2VD0 A;  2LNT A;  1FGR A;  1THX A;  1OGZ A;  3PGB A;  3PGT A;  4HM0 B;  1PN9 A;  1XOB A;  4EF0 A;  4I5Q A;  1M1X B;  1ZGX A;  2FWE A;  1FOV A;  1TI1 A;  1XPV A;  3HII A;  1MGR A;  3D21 A;  2M46 A;  4J5G A;  2LTK A;  3DWV A;  2KF6 A;  4WWU C;  3KJY A;  4ZL9 A;  3E9J B;  3CMI A;  2RM6 A;  1QVG 2;  3VI5 A;  1M9A A;  4XS6 A;  5BIR A;  17GS A;  3HOH A;  1TRQ A;  2Z77 A;  3VLN A;  4HU9 A;  1SII A;  1WMN A;  2WGQ A;  4GSN A;  4GQC A;  3N9J A;  4LYL B;  1CQH A;  3ER7 A;  3LTB A;  1YF0 A;  2GT5 A;  2R4V A;  4HM7 B;  1A23 A;  4ID0 A;  3RNT A;  1Z6M A;  2R41 A;  2XSO B;  4MEI A;  1S72 3;  3U97 A;  4IPB A;  4H61 A;  1B9Y C;  1E3R A;  3ZFL A;  3IR4 A;  1BAN A;  5CO3 A;  4BA7 A;  1YKA A;  4PQI A;  1RNB A;  4ECC A;  1YJN 3;  2RUF A;  3MPH A;  4NAX A;  3PR8 A;  4TR0 A;  1FZU A;  1A90 A;  3HYP A;  1UDI I;  1W7C A;  3DZL A;  1BNI A;  3GL3 A;  3HVS A;  2HMK B;  5G5E A;  3T0U A;  1DYU A;  1GD4 A;  2MC8 A;  4ECB A;  5JWR B;  1VQN 3;  2OE0 A;  1XWA A;  5GAN D;  5D73 A;  1T7P B;  4DSS A;  1G02 A;  5DQS A;  3KZT A;  2VCT A;  1YEX A;  1DMM A;  1TRW A;  3L9V A;  1L5G B;  1FYS A;  5D83 A;  3AGN A;  1W5Z A;  1TRS A;  3CQF A;  4DVC A;  5A4V A;  5D96 A;  1BSA A;  3WGD A;  4EE0 A;  1RN1 A;  1GSE A;  2OQE C;  3FLJ A;  5IMV A;  4RI6 A;  2YV9 A;  5DDL A;  3N54 B;  2AYT A;  1GL8 A;  4FO5 A;  4AJ8 A;  6GSY A;  3GSS A;  1ZYQ B;  1B2S A;  2JU5 A;  1US1 A;  2R5G A;  4RUV A;  3EF8 A;  2VLU A;  3GUR A;  1ZYE A;  1ERT A;  3UJ1 A;  1XW9 A;  5DAL B;  1GTA A;  3PCR A;  1Q7Y 4;  5ID2 B;  1IVU A;  2L1S A;  2FNO A;  1B8X A;  4G2E A;  3ZIV A;  2RBI A;  3BCI A;  2OBI A;  1OHP A;  3IK9 A;  14GS A;  1KSI A;  5IW9 A;  1V57 A;  5DVB A;  1NDO B;  5AYR B;  3G0K A;  2REM A;  2GLR A;  5G2G A;  3UOM A;  3SX1 A;  2R4I A;  2HLS A;  3H93 A;  4NMU A;  3F8U A;  3ISO A;  2E2V A;  1YJ9 3;  5D81 A;  3EPT A;  5CK6 A;  2YX9 A;  3F9U A;  2PU9 C;  1ZCP A;  1I2F A;  1PMT A;  3CTG A;  4HOH A;  3TDG A;  1U6T A;  3OR5 A;  2F86 B;  1X9M B;  1RSN A;  1Q40 A;  2JDI H;  2GSP A;  2LJA A;  4IVF A;  4G19 A;  3WA2 X;  2KAA A;  3F7X A;  1TU5 A;  4MPF A;  1D6Y A;  4PXO A;  5B8B A;  3URP A;  1SKW B;  4XBX A;  2IIY A;  4WBJ A;  3MAK A;  3VUR A;  2QGV A;  4CW9 A;  4TXO B;  3CCU 3;  2GQK A;  1RTU A;  1RQM A;  1E2Y A;  2HRN A;  2JZR A;  4BIK A;  4MF5 A;  1KWI A;  4GB5 A;  1W6G A;  2R2J A;  5DRE A;  4OFT A;  1TRP A;  1M3J A;  2LEG A;  4ICY A;  3IV4 A;  3IBH A;  3DRN A;  3IPZ A;  1OF5 B;  3M8C A;  2BMX A;  4GWR A;  1URM A;  1Z9H A;  5IMZ A;  5KN1 A;  1W01 A;  1UI8 A;  1UUW B;  1W2B 2;  4KDX A;  1KEB A;  2JL4 A;  1F6M C;  1OPY A;  1M99 A;  1I3I A;  5IIZ A;  3B4P A;  1UCK A;  3HCZ A;  1MTC A;  3O3T A;  4NWY A;  3LYP A;  4XS4 A;  3D79 A;  1VQ9 3;  3LTD A;  2GSR A;  2L6D A;  4POM A;  1J0F A;  3Q18 A;  4BIR A;  1K0N A;  1VQM 3;  2C11 A;  3MSZ A;  1SYX A;  5COH A;  3G9B A;  3CXC 2;  5J41 A;  3UBL A;  2GST A;  3CRT A;  1A8L A;  4WBR D;  5IG0 A;  4XRA A;  2GS3 A;  4TX4 A;  3A2X A;  1TRV A;  2OWP A;  1Z3E A;  1LJR A;  3T8N A;  3HIG A;  3F7S A;  2WDU A;  3D4M A;  3UBK A;  1RHL A;  2C8U A;  4EDY A;  3NUV A;  1K3Y A;  2ZHX B;  4QL9 A;  2O3O A;  3SYU A;  4BL7 A;  2HT9 A;  1UVZ A;  5A4U A;  5G1K A;  3ZYW A;  1RGH A;  1XWC A;  4HUA A;  1SJZ A;  2Y73 A;  4KT3 B;  3ZVJ A;  4L0W A;  4L0U A;  3HVX A;  5AIH A;  2I1U A;  3QRD A;  2CH9 A;  2E0Q A;  1HKX A;  4FCM A;  4N0V A;  13GS A;  4FCJ A;  5DCG A;  5J4U A;  2LST A;  2K8V A;  2OJL A;  4Q5F A;  1DUG A;  3FR9 A;  2BTO T;  1F37 A;  3ERG A;  2F8F A;  2L5O A;  1RRL A;  4RQR A;  1UUV B;  4HJM A;  4R9K A;  2PVO C;  3IE3 A;  1BRH A;  1C72 A;  4MJD A;  2FLS A;  4V2L A;  1DE3 A;  3C71 A;  2H30 A;  5HFG A;  4AKY A;  4MMM A; 
#chains in the Genus database with same CATH homology
 1AQV A;  4ZXG A;  4HZ2 A;  2H0H A;  5F06 A;  5HR2 A;  1KBN A;  2VLT A;  3G7Y A;  1T4Y A;  2CT6 A;  3KMN A;  3D4T A;  1HYU A;  4Q5N A;  3TJG A;  1HQO A;  4ZIL A;  2B7J A;  2OE3 A;  4ZBD A;  1EP7 A;  4EUY A;  5IMA A;  1K0C A;  2H73 A;  3CSJ A;  2YV7 A;  2YAN A;  1TKD B;  2VIM A;  1F3B A;  2HXK A;  3C73 A;  1Z7R A;  3J7Y k;  4YAP A;  1NHY A;  4F0B A;  2A2S A;  1SKR B;  4KCE A;  9GSS A;  1OC9 A;  4WXT A;  3GFK A;  2LQQ A;  3KGK A;  3TOU A;  4MNN A;  1JFU A;  3TKS A;  3HZ8 A;  2YJH A;  4O7H A;  1R26 A;  1A24 A;  5AN1 A;  3D22 A;  1NHO A;  3GRX A;  3QDN A;  1X0R A;  2MMN A;  2DSA A;  2WRT A;  2H01 A;  3S9F A;  2QSI A;  2CV4 A;  4POL A;  5GZZ B;  3U6V A;  2DJ0 A;  3BD2 A;  5H5S A;  2TIR A;  4GST A;  5DQY A;  2CZ3 A;  1O8X A;  1YZX A;  1T1V A;  3VWV A;  1PA3 A;  2CAQ A;  5IQY A;  2R6K A;  3H8Q A;  3VPT A;  1HNB A;  2KLX A;  2H76 A;  4X4J A;  2B1K A;  1Q4J A;  3ZML A;  3DYR A;  4K8M A;  2B1L A;  3KZQ A;  3UAR A;  2YJ7 A;  3L9S A;  3KTL A;  2PER A;  2V41 A;  4IW9 A;  2QKE A;  3VWW A;  5IOX A;  2VCV A;  3QAV A;  2B5E A;  2O8V B;  2VLV A;  1XW5 A;  2HE3 A;  2HSH A;  4K2D A;  4DSS B;  1O8W A;  1UC7 A;  2ON7 A;  3LXZ A;  2H70 A;  2R37 A;  2LNS A;  1T00 A;  4XRD A;  3GL5 A;  3F3R A;  2YPM A;  4BVX A;  1KTE A;  2F9S A;  3U5R E;  4TR1 A;  3M9J A;  3Q74 A;  2EIO A;  4MA9 A;  3HHV A;  4O5R A;  1YDK A;  3QOU A;  3TOT A;  1ERU A;  1GSD A;  2CA8 A;  2LUS A;  1S3D A;  4YAV A;  3V1W A;  4BWS A;  2DIY A;  4E8H A;  4K0G A;  3HKR A;  1H75 A;  5ENU A;  3IHQ A;  4TXV A;  2FA8 A;  2VAF A;  3CSI A;  1NM3 A;  4MJB A;  5KEJ A;  3RDW A;  1YF1 A;  1Z5Y E;  3RPN A;  4TVE A;  2G0F A;  1FO5 A;  4HOJ A;  3EE2 A;  2WFC A;  5IOW A;  4LA1 A;  1VF2 A;  1Z6N A;  4XTS A;  4F2I A;  2K6V A;  3IAS 2;  1O7U A;  2HSY A;  2P5R A;  4PQH A;  3M3M A;  1F3A A;  2C4J A;  5H5Q A;  4BVY A;  1XXU A;  2YOI A;  1M0U A;  3FRC A;  3LW9 A;  4GTU A;  2IJY A;  1B4Q A;  3HJP A;  4K2X A;  1FB6 A;  1GRX A;  5B8A A;  2WCI A;  2LQO A;  1B9X C;  1XFL A;  4TR4 A;  4OCF A;  5IMF A;  3KH9 A;  1F9M A;  1GUH A;  4OO4 A;  1BED A;  1HNA A;  1NSW A;  5GST A;  5HFK A;  1BJX A;  5IM9 A;  5D9V A;  3WD6 A;  5FT3 A;  1U3I A;  4OMV A;  4DEJ A;  2XBQ A;  3IDV A;  1K3L A;  1WRY A;  2ES7 A;  2H6X A;  4HZ4 A;  3ZRE A;  4KB3 A;  5D9X A;  3GUS A;  4KDU A;  4GSS A;  2LRN A;  2L59 A;  1FOH A;  5GSS A;  3A3T A;  2KOK A;  4J2F A;  1V58 A;  4JR6 A;  3HD5 A;  5C04 A;  4EC0 A;  3D5J A;  2FD3 A;  1XVQ A;  4ZBB A;  1G6W A;  5INY A;  4IGJ A;  4OCE A;  5DBQ A;  1XVW A;  4FH8 A;  5IMC A;  4BL7 B;  4LMV A;  7GSS A;  4MJE A;  3GX0 A;  5D93 A;  3W8J A;  1O81 A;  3CTF A;  2ALB A;  1PX6 A;  2WZ9 A;  5EPF A;  1XWG A;  1V2A A;  3ZIT A;  1XCC A;  1A0F A;  3DGQ A;  2C0D A;  1T8E B;  1YKC A;  4HS1 A;  1A0R P;  4MZC A;  3KMO A;  4XIH A;  4G9H A;  1BG5 A;  2YN1 A;  4ZL7 A;  3EMX A;  5IO0 A;  1DBY A;  3RHC A;  2NDO A;  4F03 A;  1S3A A;  4FQU A;  5E4W A;  1WMJ A;  1OYJ A;  1XWB A;  5ELA A;  3F63 A;  4OD7 A;  2XHF A;  2XBI A;  1EZK A;  5ECN B;  1U88 A;  2R0P A;  1U87 A;  2FCH A;  3LOR A;  3F4R A;  1AC1 A;  4QL7 A;  3P2A A;  6GSV A;  5G31 A;  2JZS A;  2FWG A;  3GIX A;  3CRU A;  4EIQ A;  4ML6 A;  2DKI A;  4BWQ A;  3AY8 A;  1YY7 A;  1OC9 B;  3TKS E;  4IN0 A;  2DKH A;  3CSH A;  2K18 A;  1X5D A;  1EGR A;  5ECQ B;  3LWA A;  4ECJ A;  2H74 A;  3HY2 A;  1H4O A;  1N8J A;  4POK A;  2WS2 A;  3TUE A;  2CVK A;  11GS A;  2O7K A;  4EIP A;  3QPM A;  3GN3 A;  4KAE A;  4JBB A;  6GSW A;  1MD4 A;  2LKU A;  10GS A;  4KSM A;  1YJ6 A;  1GLQ A;  4EKZ A;  4JE1 A;  4GQF A;  4Z2U A;  1PQN A;  2HNL A;  4AJ6 A;  3UIW A;  3MNG A;  1G0T A;  2C3N A;  2YNX A;  5CRH A;  2GTU A;  1WOU A;  2KUC A;  3GST A;  2B6M A;  3TJJ A;  1ZOF A;  3FW2 A;  2A2R A;  3UEM A;  2N5A A;  4MF6 A;  2F3M A;  3RAZ A;  4K7I A;  4HI7 A;  3GKN A;  2KP2 A;  1BYE A;  3F0I A;  2DIZ A;  2RLI A;  5ELG A;  1ZGN A;  4MZB A;  1X5E A;  1EEM A;  1V98 A;  1SYR A;  1YQ1 A;  1ILO A;  2HYX A;  1USB A;  2XPE A;  4PUR A;  5D9W A;  3KEB A;  1X5C A;  3FKF A;  3A5I A;  3FZA A;  1OE7 A;  1FAA A;  1EP8 A;  1ZMA A;  3EWL A;  1SL1 B;  4IP6 A;  2TRC P;  5CRD A;  3ZTL A;  3F3Q A;  2DJ1 A;  1GLP A;  5AIX A;  4BVX B;  5A4W A;  4I2T A;  1UN2 A;  2HRK A;  1J08 A;  1O85 A;  2VL2 A;  4TR1 B;  4F82 A;  3FR6 A;  5FHI A;  4ISD A;  1THO A;  4KGI A;  4N11 A;  1IYI A;  3DXB A;  4NXI A;  3RHB A;  4YQM A;  3PIN A;  4EVM A;  3LFL A;  4QQ7 A;  2L5L A;  3M9K A;  4ACS A;  3LYK A;  2XPD A;  4MDC A;  5GAP D;  1GP1 A;  1WWJ A;  3FK8 A;  1IYH A;  4Z2R A;  3M0F A;  3A2W A;  1XIY A;  2GZZ A;  4G0K A;  1EOG A;  1EV9 A;  2DML A;  1GSQ A;  2YZU A;  2MMO A;  3L4N A;  3MIX A;  2CVD A;  4G0L A;  2F8A A;  2RM5 A;  1SJ6 A;  1EGO A;  4HDE A;  3LGC A;  4AGS A;  2I3Y A;  3G7I A;  4IS0 A;  2QA1 A;  3VWU A;  4NHW A;  2WJU A;  5ECM B;  2WB9 A;  1ERV A;  1YEP A;  3DVW A;  1DE2 A;  4PNF A;  5KN0 A;  1VF1 A;  5J5N A;  1PL2 A;  1EOH A;  1PGT A;  2LJR A;  3E3E A;  3KP9 A;  3QR6 A;  2ZCT A;  3EIN A;  2RUE A;  3HVV A;  4KCA A;  2V2G A;  1TI3 A;  2CX3 A;  1EEJ A;  2P0G A;  5G2Z A;  1PRX A;  4IQ1 A;  4Z2T A;  4HQS A;  1GH2 A;  4BVY B;  1QGV A;  5ABR A;  4MJC A;  1M2D A;  4POB A;  1QUW A;  1WE0 A;  2E7P A;  4N0Z A;  3SBC A;  3KCM A;  1AUC A;  2KHP A;  3IXR A;  2HI7 A;  3PPU A;  4HQZ A;  1GUM A;  4EDZ A;  2O89 A;  4RI7 A;  1OAZ A;  3IAM 2;  3IA1 A;  5IO2 A;  3MWH A;  4IJI A;  2OBK A;  1TTZ A;  4ZL8 A;  1M2A A;  1GTB A;  5BMU A;  2E2G A;  2J9H A;  2DC5 A;  3APS A;  3VWX A;  2AV4 A;  1VF3 A;  3FZ5 A;  5HR1 A;  2V1M A;  4LLR A;  3ERF A;  2AAW A;  3KXO A;  1QXH A;  4MK3 A;  1S3C A;  1SK0 A;  3WT2 A;  4D73 A;  1TJD A;  3G7J A;  1PSQ A;  1WJK A;  4TN8 A;  3K8N A;  1MEK A;  1R4W A;  2N5F A;  3HXS A;  1R5P A;  4TOP A;  1JLV A;  2DJJ A;  1LU4 A;  3CXG A;  3QFA C;  1GTU A;  2AB6 A;  5JCG A;  4K7O A;  3HJO A;  4FIW A;  4WF5 A;  1ABA A;  1BAY A;  3UL3 A;  4ECI A;  1SJI A;  4JZQ A;  4KDY A;  3CBU A;  2CAI A;  2L6C A;  2GSQ A;  4FYB A;  1X9W B;  1JZO A;  1VRS D;  4GXZ A;  2OKA A;  5B6M A;  2L4C A;  2GDR A;  1PL1 A;  3IC8 A;  3TB2 A;  2C0G A;  4TRX A;  4ZIJ A;  1FW1 A;  3I6A A;  2IPA A;  3TRP A;  1ZL9 A;  3GH6 A;  2ZNM A;  3F6D A;  5F07 A;  1XWK A;  4WF4 A;  4X0X A;  1B48 A;  2A4V A;  3EU4 A;  1LBK A;  3MDK A;  1OC8 A;  2MMA A;  4BPY A;  5LCZ A;  1M9B A;  4MZW A;  4MF7 A;  4I6X A;  3A5W A;  2H1D A;  2X64 A;  4K1F A;  4NHZ A;  4KW6 A;  1K0B A;  2HZE A;  1XOA A;  1FVJ A;  4I97 A;  2MMZ A;  5B7C A;  2HRF A;  5KOX A;  1UA5 A;  5DCH A;  4MPG A;  2IMF A;  1PX7 A;  5EY6 A;  4OO5 A;  2LJK A;  1AQX A;  2HRA A;  4HJ2 A;  4KF9 A;  1AQW A;  1R7H A;  4JRR A;  1A2L A;  4GLT A;  4FYU A;  2IMD A;  4CY6 A;  2DLX A;  2MBS A;  2VCW A;  3APQ A;  3TJF A;  2CX4 A;  2I81 A;  2FY6 A;  3FYG A;  5CNW A;  1TK8 B;  2Z9S A;  3FMW A;  3BBY A;  2FUG 2;  1TU8 A;  3ZZX A;  3O6T A;  3D0Z A;  2V6O A;  2M80 A;  2OE1 A;  3J7Y b;  1AIU A;  4L8E A;  1TK0 B;  2VOC A;  3H79 A;  4K5R A;  3ZRD A;  1K0A A;  4ZBA A;  4G0I A;  5KN2 A;  1QQ2 A;  3QD9 A;  1G7O A;  5ECP B;  3TKQ A;  2PN8 A;  3LG6 A;  2H71 A;  4WKW A;  4P3Y B;  3IRA A;  1GSF A;  2VL9 A;  5DAK A;  3IHG A;  3TKR A;  4IQA A;  4O32 A;  2WUL A;  5DJL A;  1GNW A;  2PPT A;  1A8Y A;  1ST9 A;  3DD3 A;  22GS A;  2JSZ A;  2G2Q A;  1SD9 A;  3QAW A;  2C80 A;  3NZN A;  4XS4 B;  2YP6 A;  4YQU A;  3LJR A;  2VM2 A;  4FYC A;  4XS1 A;  5CRE A;  18GS A;  3QFB C;  5ECL B;  4MH3 A;  2B5X A;  4KSO A;  4E8E A;  2X49 A;  2H75 A;  1JZR A;  2GT6 A;  2YWO A;  4V1A g;  3C7M A;  2GSS A;  3PH9 A;  3C1S A;  2N5B A;  2VCZ A;  2H0I A;  1I9D A;  1V9W A;  4AJ7 A;  1NW2 A;  3BJ5 A;  2EC4 A;  3W8S A;  2RII A;  2R3X A;  1WP0 A;  5JWO B;  2GVP A;  6GSS A;  1FG4 A;  1PN0 A;  2NVL A;  6GSX A;  1FVK A;  3VI7 A;  1X9S B;  2HSM A;  3DVX A;  4IKH A;  2PWJ A;  2AJQ B;  3P7X A;  1O73 A;  5ECK B;  4X1U A;  1AW9 A;  3KD0 A;  3Q19 A;  3FZ9 A;  4IEL A;  5IPH A;  3DML A;  4KA0 A;  4F9Z A;  4KH7 A;  4MH2 A;  4XCS A;  2NTO A;  3DEX A;  1XZO A;  2C1Y A;  2L57 A;  5AGY A;  1OE8 A;  2PBJ A;  3GMF A;  3R2Q A;  3I9V 2;  3KH7 A;  3TKS C;  3EYT A;  5J3R A;  2FA4 A;  1Y25 A;  5CRW A;  4JU5 A;  1GUL A;  3GNJ A;  1SKS B;  4X43 A;  4D73 B;  2EIQ A;  2YWN A;  3VPQ A;  5F0G A;  4PGT A;  1AAZ A;  1TXX A;  4OWY A;  2YWM A;  3IC4 A;  1A2M A;  2C0E A;  4OFM A;  4IBP A;  2PVQ A;  3EU3 A;  3FEU A;  5IPG A;  3APO A;  2VUP A;  3UMA A;  2YWI A;  1TRU A;  2GGT A;  1Z7P A;  4ILF A;  2IMK A;  1RK4 A;  1DSB A;  2EIR A;  4O5Q A;  2P31 A;  3RBT A;  2O87 A;  1VF4 A;  2VO4 A;  2H72 A;  2L4Q A;  4V1A p;  2DMM A;  4K0N A;  2QC7 A;  3EC3 A;  4ML1 A;  3TKP A;  2K9F A;  3ME8 A;  1MDJ A;  1K0D A;  5J9C A;  4AF2 A;  1MDI A;  2OAC A;  1U3A A;  5LNK e;  3ZFB A;  3VK9 A;  5CYY A;  1CQG A;  2HFD A;  4ZB8 A;  1XW6 A;  5HQP A;  2FHE A;  2IL3 A;  3ED3 A;  2NPB A;  4GRF A;  3WYW A;  5G5F A;  3SWL A;  1QFN A;  4EXJ A;  3FY7 A;  4EO3 A;  1B4P A;  2VD1 A;  1TDI A;  3I43 A;  1WPI A;  1A2J A;  3P90 A;  5HFI A;  2GQL A;  2D2Z A;  3M8N A;  5FWG A;  3HDC A;  3GYK A;  5D8I A;  2X99 A;  4K7N A;  2HZE B;  3O76 A;  2IN3 A;  2VCX A;  1RW1 A;  3LSZ A;  2CVB A;  4NPB A;  1E6B A;  5CP1 A;  2H1A A;  4A5P A;  2ZUP A;  2DJK A;  16GS A;  2DBC A;  3ZVJ D;  2GQM A;  4K6X A;  4OFN A;  2JAC A;  5C00 A;  1JHB A;  1XBS A;  2C0F A;  2CZ2 A;  3ZMK A;  2C3T A;  2LS5 A;  3TGZ A;  3GKK A;  1TOF A;  2GZP A;  2UZ8 A;  2HZF A;  3KTB A;  3DIE A;  5HR3 A;  2P5Q A;  2JZT A;  5DJM A;  3EUR A;  2QA2 A;  1SL2 B;  3GTU A;  4J57 E;  3FHK A;  3TCO A;  3TRQ A;  4J56 E;  3F4T A;  3TJK A;  1J9B A;  4NV5 A;  2LRC A;  4ZB6 A;  1SU9 A;  2A2P A;  5ECI B;  1K0O A;  2XC2 A;  4YH2 A;  3C1R A;  3D6I A;  2OA7 A;  2LRT A;  2X8G A;  3GX8 A;  2IFQ A;  3C8E A;  1EV4 A;  4G10 A;  3DKS A;  5DAK B;  3L9U A;  3I69 A;  5KOW A;  2K8S A;  2DJ2 A;  3IOS A;  1GSS A;  3UVH A;  1PD2 1;  1W89 A;  2H6Y A;  2H8L A;  5ECO B;  1GSU A;  1HD2 A;  3ZIJ A;  3R3E A;  2IYJ A;  3Q6O A;  4K9Z A;  4WEY A;  1W4V A;  4YKF A;  3HJM A;  1F2E A;  3A2V A;  1T3B A;  1I5G A;  2X4A A;  4TKY A;  1AXD A;  3M1G A;  2J23 A;  4L5L A;  4KND A;  1SEN A;  4PQ1 A;  1QMV A;  3RPP A;  3BCK A;  2V32 A;  4KX4 A;  1G7E A;  4MCU A;  2IWT A;  4WR5 A;  5CAX A;  2YCD A;  5CRG A;  4MP4 A;  2H6Z A;  2R0C A;  1FB0 A;  3F4S A;  4N10 A;  3GKM A;  3EMP A;  5D9T A;  2B7K A;  2H19 A;  2TRX A;  3GHA A;  1SK1 A;  2R0G A;  4YKG A;  2FWH A;  2I9H A;  4JR4 A;  2WGR A;  3H1N A;  1Q98 A;  4WET A;  1R5A A;  4RQX A;  2B5Y A;  4PUF C;  2LV3 A;  1BQ7 A;  3UAP A;  3QCP A;  4KE3 A;  3WGX A;  4L5O A;  3LEF A;  4WR4 A;  4GCI A;  2B3S A;  1TW9 A;  2IME A;  2E2M A;  2X8H A;  2VCQ A;  12GS A;  4K5S A;  2FWF A;  2VL3 A;  3GV1 A;  4DSQ A;  5ECS A;  19GS A;  5DAL A;  2DJ3 A;  5H5R A;  2PUK C;  5ID2 A;  1ERW A;  2V6K A;  8GSS A;  3QAG A;  2CQ9 A;  3VFI A;  4V2N A;  4MLY A;  4I8B A;  2IMI A;  3HZ4 A;  3BOA A;  1FHE A;  3US3 A;  3ERW A;  2ON5 A;  3KM6 A;  4Q5Q A;  4V2M A;  4Z7X A;  4IP1 A;  4O5U A;  3LQ7 A;  3ME7 A;  3MYD A;  3TJB A;  5G30 A;  4LMW A;  4TR3 A;  3KP8 A;  5EL8 A;  1VGL A;  1JZD A;  1ML6 A;  2M72 A;  5EVO A;  3W6G A;  5JCW A;  2AHE A;  3JCM L;  1M2B A;  3HA9 A;  4NV2 A;  4HU7 A;  1ACV A;  6GST A;  2AUV A;  1GSY A;  3N5O A;  4TW5 A;  3L78 A;  3ZLP A;  3E0U A;  4LL4 B;  4EL1 A;  1O6J A;  2MZC A;  5F05 A;  1PKZ A;  4TXO A;  5JWQ B;  4ZB9 A;  1N2A A;  4CDO A;  1GTI A;  2PGT A;  1ON4 A;  4HEA 2;  3FR3 A;  1OC3 A;  4F0C A;  1ZYP A;  1K0M A;  2H1G A;  4PTS A;  2F51 A;  3FZ4 A;  2VL2 C;  4PNG A;  4N30 A;  4YQV A;  1OKD A;  3GA4 A;  4CHS A;  1OVN A;  3H4K A;  3ZL5 A;  1OKT A;  2H0G A;  1QK8 A;  1GWC A;  4JED A;  2O85 A;  3L0H A;  4KUN A;  1G6Y A;  1ZYN A;  2MYG A;  3WGE A;  4MAB A;  4IHU A;  4IJ3 A;  2FGX A;  5B6N A;  5ECR B;  1SL0 B;  1GNE A;  2OAD A;  20GS A;  1PKW A;  2X8C A;  1MD3 A;  1Y6E A;  5AIV A;  2PMT A;  4CY8 A;  1EWX A;  1KNG A;  4MJA A;  1V40 A;  3WT1 A;  1SK2 A;  1GUK A;  1K3O A;  5HR0 A;  4H86 A;  1JZW A;  5JCU A;  2GZY A;  1TU7 A;  2JAD A;  2H1B A;  2IY2 A;  3P8W A;  1MDK A;  4I2U A;  3CYN A;  1TP9 A;  1T4Z A;  5J9B A;  3GKX A;  4Q5R A;  6GSU A;  5IMD A;  3GH9 A;  3IK7 A;  3UVT A;  5E59 A;  5F8B A;  2H66 A;  1HNC A;  4XHM A;  3GTU B;  5G1L A;  1M7T A;  2VM1 A;  5LD0 A;  1JLW A;  1DE1 A;  4DSR A;  5ECH B;  5A5K A;  4ULX A;  3NIV A;  4LL1 B;  3KIJ A;  2MBT A;  4GF0 A;  1WIK A;  5KN3 A;  1TK5 B;  4USS A;  3LXT A;  2KP1 A;  2YZH A;  3NOF A;  2A4H A;  4O92 A;  2IFQ B;  1ZZY A;  2BJX A;  5BRT A;  1BX9 A;  2JSY A;  3EVI A;  4PX1 A;  2NBS A;  3QMX A;  5AIS A;  3F6F A;  4PUA A;  2C3Q A;  2I4A A;  5L71 A;  3TRX A;  1SD8 A;  2VD0 A;  2LNT A;  1THX A;  3PGT A;  1PN9 A;  1XOB A;  4EF0 A;  4I5Q A;  2FWE A;  1FOV A;  1TI1 A;  1XPV A;  3D21 A;  2M46 A;  2LTK A;  3DWV A;  3KJY A;  4ZL9 A;  3E9J B;  3CMI A;  2RM6 A;  3VI5 A;  1M9A A;  4XS6 A;  17GS A;  3VLN A;  4HU9 A;  4GSN A;  4GQC A;  3N9J A;  1CQH A;  1YF0 A;  2GT5 A;  2R4V A;  1A23 A;  4ID0 A;  1Z6M A;  1B9Y C;  3ZFL A;  3IR4 A;  5CO3 A;  4BA7 A;  1YKA A;  4PQI A;  4ECC A;  2RUF A;  4NAX A;  3PR8 A;  4TR0 A;  3HYP A;  3GL3 A;  3HVS A;  5G5E A;  4ECB A;  5JWR B;  2OE0 A;  1XWA A;  5GAN D;  5D73 A;  1T7P B;  4DSS A;  5DQS A;  2VCT A;  1YEX A;  1TRW A;  3L9V A;  1TRS A;  5A4V A;  4DVC A;  5D96 A;  3WGD A;  4EE0 A;  1GSE A;  5IMV A;  4RI6 A;  2YV9 A;  5DDL A;  2AYT A;  1GL8 A;  4FO5 A;  4AJ8 A;  6GSY A;  3GSS A;  1ZYQ B;  2JU5 A;  2R5G A;  4RUV A;  2VLU A;  3GUR A;  1ZYE A;  1ERT A;  3UJ1 A;  1XW9 A;  5DAL B;  1GTA A;  5ID2 B;  2FNO A;  1B8X A;  4G2E A;  3ZIV A;  3BCI A;  2OBI A;  14GS A;  3IK9 A;  5DVB A;  1V57 A;  2REM A;  2GLR A;  3UOM A;  2HLS A;  3H93 A;  4NMU A;  3F8U A;  3ISO A;  3EPT A;  3F9U A;  2PU9 C;  1ZCP A;  1PMT A;  3CTG A;  3TDG A;  1U6T A;  3OR5 A;  1X9M B;  2LJA A;  4IVF A;  4G19 A;  4MPF A;  4PXO A;  5B8B A;  1SKW B;  2IIY A;  4WBJ A;  3MAK A;  3VUR A;  2QGV A;  4CW9 A;  4TXO B;  2GQK A;  1RQM A;  1E2Y A;  2HRN A;  2JZR A;  4MF5 A;  2R2J A;  4OFT A;  2LEG A;  4ICY A;  3IV4 A;  3IBH A;  3DRN A;  3IPZ A;  2BMX A;  4GWR A;  1URM A;  1Z9H A;  5IMZ A;  5KN1 A;  4KDX A;  1KEB A;  2JL4 A;  1F6M C;  1M99 A;  5IIZ A;  3HCZ A;  1MTC A;  3O3T A;  4NWY A;  3LYP A;  4XS4 A;  2GSR A;  2L6D A;  4POM A;  1J0F A;  3Q18 A;  1K0N A;  3MSZ A;  1SYX A;  5COH A;  3G9B A;  5J41 A;  3UBL A;  2GST A;  3CRT A;  1A8L A;  4WBR D;  4XRA A;  2GS3 A;  3A2X A;  1TRV A;  1Z3E A;  1LJR A;  2WDU A;  3D4M A;  3UBK A;  2C8U A;  4EDY A;  1K3Y A;  4QL9 A;  4BL7 A;  2HT9 A;  1UVZ A;  5A4U A;  5G1K A;  3ZYW A;  1XWC A;  4HUA A;  1SJZ A;  3ZVJ A;  4L0W A;  4L0U A;  3HVX A;  2I1U A;  2E0Q A;  4N0V A;  13GS A;  5DCG A;  5J4U A;  2LST A;  2K8V A;  2OJL A;  4Q5F A;  1DUG A;  3FR9 A;  2BTO T;  1F37 A;  3ERG A;  2F8F A;  2L5O A;  4RQR A;  4HJM A;  2PVO C;  3IE3 A;  1C72 A;  2FLS A;  4V2L A;  3C71 A;  2H30 A;  5HFG A;  4MMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...