1G0TA

Dsbc mutant c101s
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
215
structure length
215
Chain Sequence
b'DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYSHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL:DISULFIDE INTERCHANGE PROTEIN DSBC
publication title Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 68
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2000-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10411 DsbC_N Disulfide bond isomerase protein N-terminus
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 1g0tA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1g0tA02
1VF2A 4IBPA 1GSEA 1B8XA 1GTIA 3GX0A 2REMA 3HYPA 3ZL5A 2H72A 7GSSA 3Q6OA 4IHUA 4KDYA 2N5AA 3EURA 2PVQA 3GYKA 3UL3A 2WCIA 3KP9A 1TI1A 3E0UA 3FRCA 2GT5A 2J9HA 5G1KA 5HR3A 4FYUA 1XW5A 3WT1A 2L4QA 2PUKC 4ZB8A 3ISOA 3KMNA 1ON4A 1ML6A 5IQYA 1K0BA 4XTSA 4ZL8A 2HT9A 5IMAA 4BA7A 3GN3A 4ZL7A 5F0GA 2D2ZA 4MH2A 3IC4A 2CX4A 4QL9A 3TJGA 4EE0A 1TK5B 2CZ3A 5IIZA 4FO5A 1DBYA 2YV7A 3MWHA 3GKXA 2WS2A 1HYUA 1A24A 3LSZA 1GSYA 5IO2A 3MDKA 4KGIA 5ECHB 3FR3A 2E2MA 3CXGA 1FAAA 5D9VA 2YCDA 4I2UA 5ECPB 1XOBA 2G2QA 2V6KA 3GH6A 4TR0A 2DC5A 10GSA 1X5EA 3D4MA 3KTLA 3RHBA 2R4VA 1O6JA 1KTEA 4I6XA 3G7IA 4OO5A 2H1GA 3F3QA 4DSRA 4TXVA 3U6VA 2B5YA 1PKZA 4GRFA 3VFIA 2NDOA 3IK7A 3VLNA 4TR1B 1ERVA 1NM3A 2H6YA 1ERTA 3UBLA 2X64A 4V1Ap 4KSOA 4MJAA 2MBSA 3EWLA 1UN2A 5F05A 1MDKA 3GHAA 2V41A 4JRRA 2H75A 3Q19A 5F06A 4MPFA 1YF0A 5KN1A 5IMVA 3M0FA 3GKNA 4QL7A 1YF1A 1QXHA 2HRFA 3O6TA 1UC7A 3WD6A 1BQ7A 5EY6A 2FA4A 2LEGA 2B6MA 2H1AA 4G2EA 4J56E 5A4VA 3IOSA 5H5QA 4MA9A 5HFGA 2I1UA 2GSQA 1BJXA 1TK0B 3APOA 3WGXA 2C3QA 1URMA 3NIVA 3S9FA 6GSUA 3HHVA 1B9XC 2R3XA 1H75A 2IFQA 3ZFLA 5JCUA 3APSA 3D22A 2EIQA 1SL0B 4XIHA 3DIEA 3C1SA 1HNCA 6GSYA 3TRPA 2L5OA 3KH7A 1OE7A 1I9DA 2YN1A 1XCCA 3L9UA 2VL2C 4K9ZA 4TXOB 3H4KA 4MH3A 3IV4A 1V57A 2GDRA 3OR5A 5J9CA 2V1MA 3KCMA 6GSWA 1F3AA 4ACSA 2L6CA 4WKWA 5B7CA 5A4UA 1R5PA 4ID0A 1YKAA 3KEBA 5DAKB 3ZMKA 3TJJA 4KH7A 3KMOA 2OBKA 5CYYA 5C04A 4AGSA 3HCZA 1GNWA 2FUG2 5DALB 3GMFA 1PRXA 2JZSA 4OFMA 1TRSA 4L5LA 4PX1A 2ALBA 2DMLA 4HJ2A 2P5QA 2H0IA 1B4PA 2HSHA 5GAND 4KAEA 1ST9A 2FWHA 1M99A 3HXSA 2GS3A 3BBYA 1Y6EA 4E8HA 1JLVA 3TOUA 1FVJA 1ZGNA 2TRCP 4D73A 2HFDA 1NW2A 5AISA 2E7PA 1VF3A 4AF2A 4MLYA 4EKZA 3ME8A 3HKRA 4OFNA 4NHWA 1OC3A 13GSA 1O81A 2MMZA 4ZB9A 1OKDA 3C1RA 2VL2A 3A2XA 5GAPD 5D9TA 5AN1A 4ILFA 2RUEA 1G0TA 1TDIA 4EUYA 1PGTA 4WBJA 1GTAA 3Q74A 2XBQA 4EVMA 2BTOT 1FW1A 3EE2A 2GSRA 2FD3A 1BYEA 1Z3EA 1AQXA 4HI7A 2P5RA 1U87A 4X43A 4DSSA 2JL4A 2RUFA 5G30A 3LWAA 1NHYA 4ZBDA 3P7XA 2AUVA 2OE0A 4MF7A 2IY2A 3KTBA 4LL4B 1VF4A 3IE3A 1QQ2A 1O73A 3VWWA 1GSSA 2E2GA 2HZEA 2HNLA 2MMNA 1O7UA 1ILOA 1XZOA 3TKQA 1AQWA 3CTGA 2GSTA 1T3BA 2YP6A 2H0HA 1B4QA 4GSTA 3I43A 3SWLA 4KDUA 2PN8A 3EMPA 4EO3A 4EXJA 4GQFA 2N5FA 1V98A 2VL3A 3RPPA 3VURA 1E2YA 3WGEA 3HJMA 4ML6A 3O76A 3QFAC 1Z6MA 3RAZA 3R2QA 4FYBA 1F6MC 2YWNA 2B5XA 2DJ3A 4PQ1A 3CSHA 5H5RA 2DJ2A 4GSSA 2JSYA 2JACA 3LQ7A 3VWVA 2NTOA 2L57A 4LMVA 2CVDA 4AJ8A 3LEFA 2CQ9A 4WR5A 5EL8A 3HJOA 3L9SA 5ECSA 1JZWA 1A0FA 2DBCA 1JZRA 5ELGA 3QPMA 2X99A 3F8UA 2LRNA 2HZEB 2P0GA 4ISDA 5IO0A 1JZDA 4K1FA 1Z9HA 4LLRA 3N5OA 1B48A 4IP1A 2O89A 1XWKA 4JR4A 1MEKA 4WEYA 3P90A 1WPIA 5DCGA 4IKHA 5L71A 2KOKA 5F07A 2OADA 3CRUA 1FOVA 2VCXA 1XPVA 1YDKA 1X9MB 2P31A 3ZRDA 2RLIA 3M9JA 5ECLB 2H1BA 3HD5A 6GSTA 3NZNA 4I97A 1XFLA 2MZCA 2AV4A 3IR4A 1EV4A 4TN8A 1GLQA 3EU3A 2CAIA 3UBKA 1F3BA 4Q5NA 2K8SA 1HNAA 1DE2A 1JZOA 2VIMA 4IQ1A 3TRXA 5ENUA 4JZQA 1T7PB 3TJFA 3GV1A 4K7OA 2VOCA 3KD0A 3KXOA 2FA8A 3QFBC 3UJ1A 3HVXA 5DVBA 3I9V2 4IN0A 1CQGA 4PQHA 4WR4A 4F0CA 4MJBA 2I81A 4L0WA 4K0NA 3KM6A 5KN0A 4O5RA 1MD4A 2VCWA 3GX8A 3FW2A 3VI5A 1SK0A 3DGQA 3FR6A 4JE1A 3HZ8A 1T4ZA 4GXZA 4YQVA 3ZZXA 4F9ZA 2YJ7A 3ERFA 2RM5A 1PL2A 5A4WA 1SYRA 2AB6A 4O92A 3V1WA 2ES7A 1JHBA 2QC7A 4I2TA 2LQOA 2J23A 2PWJA 4CHSA 2LJAA 3DVWA 4HZ4A 1FG4A 2PPTA 4QQ7A 1ZYEA 5DJMA 2HYXA 2DJJA 2DJ0A 5IMZA 1K3OA 3DRNA 3GFKA 2HXKA 4IELA 5ID2B 3TDGA 3RHCA 1SKWB 1YKCA 1THXA 2LQQA 3QD9A 1GH2A 1M9BA 14GSA 1M2AA 1VGLA 1M2BA 5GSTA 3QOUA 2CZ2A 1XVWA 3ZYWA 4NWYA 2VAFA 2IN3A 2IIYA 3BD2A 3M3MA 2ON5A 2H0GA 3APQA 3FR9A 2XPEA 1KNGA 4NMUA 4MABA 4TR1A 1GSUA 2M46A 5CREA 4F0BA 1TXXA 3JCML 1R5AA 1SJZA 5JWRB 1K0MA 4ML1A 3WYWA 1SYXA 2VLVA 3O3TA 3TCOA 3ZITA 2I3YA 2V6OA 1WRYA 3J7Yk 1FO5A 4JU5A 2B5EA 5A5KA 4EDZA 3ZFBA 4ZILA 3GIXA 3C73A 4NPBA 5ECNB 2H74A 3KZQA 3N9JA 4GF0A 1OKTA 4POMA 3LFLA 4PGTA 1OVNA 2XBIA 5D96A 1QFNA 4TR3A 3ZIVA 3J7Yb 2WFCA 1ZZYA 3H1NA 3BJ5A 4WF5A 5G2ZA 3DEXA 1ACVA 2HLSA 4NXIA 1TKDB 4KB3A 1G7EA 4GWRA 3GKMA 1M0UA 5LCZA 4KW6A 2YZUA 20GSA 3HVSA 4IP6A 1JFUA 4RQRA 4TXOA 4PNFA 2GQKA 3W6GA 1Y25A 3CSJA 5ECRB 4IVFA 4BVXA 4HQSA 1LBKA 3ZIJA 2YNXA 3PR8A 1U3IA 4YAVA 2IMKA 4ZL9A 3GNJA 5DAKA 3GSSA 1FVKA 1AAZA 2HE3A 3TKSC 1SKRB 3LXZA 5DALA 1AXDA 1RK4A 1TOFA 1WMJA 3FYGA 4EC0A 1TU8A 4KCAA 3P2AA 4EDYA 2ZCTA 2IMEA 3P8WA 1EP7A 1OYJA 1S3CA 3CSIA 3D21A 3TKSE 2F8FA 4POKA 2N5BA 4EF0A 2H8LA 2H6XA 3VI7A 2OE3A 1A0RP 1A2JA 3DXBA 4IQAA 2DJ1A 5IMDA 5LD0A 4PUFC 3GKKA 3HA9A 2RM6A 1C72A 1XWCA 3D4TA 3BCIA 1K3YA 4MJCA 3EINA 2FHEA 2JZRA 4CW9A 4PXOA 3W8SA 1V2AA 5ELAA 1OE8A 2DIYA 3FK8A 1GSQA 5CRGA 4I5QA 1HQOA 5ABRA 5D9XA 1EGOA 2L6DA 2QSIA 4NAXA 1TU7A 2A4VA 4GSNA 3IK9A 2VLUA 3QMXA 5FWGA 4HEA2 1V58A 2PBJA 3TKSA 2LJKA 4KUNA 1GULA 4BWSA 2VM1A 1EP8A 5AIVA 5H5SA 4TKYA 5E59A 4DEJA 5DJLA 2YWMA 2FLSA 4KSMA 1HNBA 5DBQA 3GL3A 3F4SA 1X5CA 4XRAA 3K8NA 4K6XA 1EOHA 5D73A 5CRWA 2LSTA 2CX3A 5CO3A 2FNOA 4MZWA 5JWQB 1M2DA 1BEDA 5AIXA 4P3YB 4E8EA 4Q5FA 3MNGA 5G1LA 2FWGA 4HUAA 3RBTA 4HU7A 1AIUA 1G7OA 1PKWA 1U88A 1G6WA 2R37A 1V40A 1X0RA 3L4NA 3DWVA 1YEPA 2C0GA 5COHA 4IS0A 1PD21 1BX9A 2JU5A 3TRQA 2DMMA 3KIJA 1XOAA 1SJIA 1T1VA 3IA1A 5CRHA 2YOIA 2M72A 1Z7PA 2DLXA 4JEDA 1ZYQB 3TKRA 3CRTA 4YH2A 5HFKA 4V2LA 1GSFA 2B7JA 3GSTA 3ED3A 3QCPA 5EPFA 2GVPA 2VCZA 3ERWA 4ECCA 3M9KA 4PNGA 1O8WA 4AJ6A 3TGZA 2VCVA 4G19A 5B8BA 3ZVJA 1K3LA 2WJUA 4XS6A 4MPGA 2CT6A 4WF4A 2GZPA 4RQXA 3U5RE 4GTUA 2QKEA 5DQSA 3GH9A 1PA3A 3PGTA 3L9VA 1SK1A 2ON7A 2IMIA 2IYJA 2YV9A 3AY8A 1QK8A 1YY7A 4N10A 1XXUA 1J08A 2HI7A 4NV2A 3D5JA 3EYTA 4EL1A 1A8LA 3TUEA 2G0FA 2AYTA 3GTUB 3F6DA 3ZTLA 5FT3A 5KEJA 16GSA 2JZTA 4YAPA 1EOGA 2CVBA 4GCIA 1WOUA 2KLXA 2MBTA 2TIRA 1PQNA 2WGRA 4XCSA 1SJ6A 3VPQA 1PMTA 4LA1A 4ZXGA 1M7TA 1CQHA 5J4UA 1QMVA 4L5OA 3FKFA 2R5GA 2YWIA 4F03A 1K0AA 2C0EA 1GWCA 1IYHA 2XPDA 4OO4A 2IJYA 4G10A 3IXRA 5EVOA 3WT2A 2OE1A 4FIWA 5DQYA 4K2DA 1H4OA 2AJQB 1GL8A 19GSA 3DYRA 2R6KA 11GSA 4GQCA 4PUAA 3BOAA 3PINA 1F9MA 4K7NA 1NHOA 4JBBA 3Q18A 3I6AA 3UMAA 2O85A 2MMOA 4X0XA 1MDJA 2HZFA 2X8HA 1Z5YE 5D9WA 2Z9SA 2B7KA 3GRXA 4KE3A 1XVQA 4O7HA 3C71A 3MSZA 5ID2A 1OC9B 3M8NA 2KUCA 2KP2A 1MTCA 4Q5QA 22GSA 2K9FA 3FZ5A 1K0NA 2IWTA 9GSSA 4JR6A 2FWEA 2H01A 4IGJA 18GSA 3C7MA 2LNTA 5CP1A 3PH9A 2VD0A 2PGTA 3ZMLA 1DUGA 1G6YA 2WULA 5IM9A 4MCUA 1SL1B 2CV4A 2F9SA 1Z6NA 2VM2A 4O32A 2CVKA 3EU4A 1PX6A 2LTKA 5IOXA 5LNKe 2L59A 2H30A 4TW5A 2V2GA 2IMFA 2LRCA 4YQUA 4Z7XA 2C3TA 4MP4A 3M1GA 5GSSA 1J9BA 1LU4A 1ZMAA 4AJ7A 3UEMA 4XS1A 3QR6A 3HY2A 2PU9C 3LYPA 3EVIA 4V1Ag 2CA8A 2MYGA 1U3AA 3RDWA 1NSWA 3RPNA 4POLA 6GSSA 1WP0A 4RI7A 5ECKB 2BJXA 1T4YA 1YJ6A 4J2FA 1UVZA 5DDLA 2KP1A 3EMXA 2EIOA 1AW9A 2AAWA 3CYNA 2O87A 4K7IA 3E9JB 1TRUA 4K0GA 4N30A 1EEMA 4LL1B 3FHKA 1DE1A 1PSQA 1ZOFA 1SD8A 2LS5A 1T00A 1YQ1A 4LMWA 1VF1A 4F82A 4OCEA 2PMTA 2OKAA 1EWXA 4ZBAA 1GRXA 4YQMA 1A2LA 1N8JA 1J0FA 1EGRA 2GZZA 3HDCA 2VCQA 5HR1A 5CNWA 1SU9A 4DVCA 3UARA 1A8YA 1BAYA 5ECIB 1GUHA 1Q4JA 2FWFA 2XC2A 1FB0A 2VUPA 2OACA 2PERA 3UVTA 2X8GA 3L78A 3D0ZA 1GP1A 3C8EA 1X9SB 5D8IA 3CTFA 1THOA 4HOJA 5JCWA 2FY6A 2VD1A 1TJDA 1OC8A 1MDIA 4HU9A 4TOPA 2L5LA 2DIZA 1TI3A 3DKSA 3F0IA 5AGYA 3MAKA 1MD3A 3GA4A 5IOWA 4XHMA 4L0UA 3ZREA 4XS4A 3IAS2 4NV5A 1TTZA 2NPBA 3F4TA 4KA0A 4XRDA 3BCKA 2K6VA 2EIRA 1U6TA 1JLWA 3GUSA 4MMMA 1ERWA 1N2AA 4H86A 4FH8A 4KDXA 3VPTA 1M9AA 3DD3A 1FHEA 2L4CA 4POBA 1AC1A 3CMIA 1QGVA 4ECJA 4IW9A 1YEXA 1TK8B 4WETA 2LUSA 4HS1A 2WB9A 5HQPA 2WDUA 3F9UA 1K0CA 4MZBA 3US3A 1RQMA 4BWQA 5J41A 1GUKA 1R4WA 1S3DA 2H6ZA 2VL9A 2GT6A 2NBSA 4PURA 1X5DA 4OWYA 2I4AA 3F3RA 2C3NA 3I69A 4CDOA 4MK3A 4OD7A 1ABAA 2GLRA 1TRVA 4XS4B 2H73A 1WIKA 1Q98A 1TRWA 2LRTA 2K8VA 2YWOA 3KP8A 2B1LA 4IJIA 4OFTA 4BL7A 2H1DA 4OMVA 3GURA 5ECOB 2OA7A 2ZUPA 2H71A 1A23A 5ECQB 5KN2A 3IPZA 5J5NA 1XWBA 1WJKA 2IL3A 1KBNA 2YZHA 1VRSD 3A3TA 2C8UA 1SD9A 1DSBA 2IPAA 3W8JA 1F37A 2LKUA 3HVVA 3QAVA 3QAGA 1QUWA 1HD2A 1R26A 5KN3A 1WWJA 4F2IA 3TJKA 3HZ4A 2C0DA 3F4RA 1EEJA 3UVHA 4ULXA 1XW9A 3TB2A 1WE0A 3LJRA 3ME7A 4K8MA 2PVOC 3TJBA 5C00A 4ZBBA 4V2NA 2IFQB 4TRXA 5CRDA 2C4JA 2K18A 4HDEA 4I8BA 4NHZA 1K0DA 1GTUA 2AHEA 1TP9A 3FEUA 4X1UA 2XHFA 4G9HA 3ZLPA 3UOMA 3L0HA 2GQLA 17GSA 1ZCPA 1EZKA 3GTUA 2H19A 3IRAA 3LYKA 2LV3A 1O85A 4FYCA 2TRXA 4MDCA 4IJ3A 5IMFA 1A2MA 3CBUA 2BMXA 2JADA 5IPGA 3KGKA 5G5EA 2M80A 3LXTA 2DSAA 2H70A 1O8XA 2CAQA 3DMLA 3HJPA 4N0VA 1E6BA 4MF5A 3G9BA 1SL2B 2VLTA 3IAM2 2YPMA 4MF6A 4BPYA 3NOFA 1ZL9A 3KH9A 1AQVA 1OAZA 2H66A 5JCGA 5G31A 3E3EA 2HSYA 2R2JA 4D73B 3QAWA 4ZB6A 1IYIA 2E0QA 2F3MA 4ZIJA 8GSSA 1K0OA 2O7KA 1GUMA 2FCHA 6GSXA 2B1KA 3GL5A 2OBIA 3F6FA 2OJLA 4V2MA 5HFIA 1GTBA 2LNSA 5HR2A 5CAXA 2EC4A 3QDNA 1ERUA 1FB6A 3TOTA 1XBSA 4N11A 2V32A 2WZ9A 1XIYA 3LG6A 2RIIA 2A2RA 3F63A 5IPHA 2IMDA 5B8AA 1T8EB 2WRTA 3IHQA 3WGDA 2C1YA 1OC9A 4N0ZA 4HZ2A 2A2SA 1AUCA 2FGXA 4DSSB 2B3SA 1GSDA 1Z7RA 1W89A 4TR4A 5B6MA 2C0FA 1RW1A 3ZVJD 2GQMA 3LORA 2GGTA 5G5FA 1GNEA 4MZCA 1EV9A 2GTUA 3FZ4A 4KCEA 2F51A 1BG5A 1F2EA 1W4VA 2YANA 1S3AA 4GLTA 3IDVA 4KNDA 1XW6A 1LJRA 12GSA 2JSZA 3SBCA 5INYA 1SK2A 1XWAA 1TW9A 2LJRA 2MMAA 3A2VA 3DVXA 5F8BA 2NVLA 4ECBA 2VCTA 5D93A 1XWGA 1USBA 3VK9A 4Q5RA 3FZ9A 3D6IA 1B9YC 5ECMB 3H93A 5J3RA 3EC3A 1PN9A 5DCHA 2HRNA 2DJKA 3G7YA 2VO4A 3UAPA 3IBHA 5J9BA 2QGVA 5E4WA 3KJYA 3TKPA 4RI6A 4WBRD 3G7JA 2YJHA 4HJMA 5IMCA 1UA5A 2X8CA 5B6NA 4KX4A 1KEBA 4WXTA 1V9WA 4PQIA 4RUVA 3UIWA 5HR0A 1SKSB 1PX7A 3A5WA 6GSVA 3ERGA 3FZAA 5FHIA 1YZXA 2ZNMA 2C80A 1PL1A 4HQZA 4DSQA 4MJEA 3VWUA 1X9WB 3H8QA 3FY7A 2H76A 2GSSA 3A2WA 2F8AA 1GLPA 2KHPA 3H79A 3LGCA 4J57E 5GZZB 5JWOB 2O8VB 2I9HA 2GZYA 4OCFA 4TVEA 3VWXA 1SENA 4BVYA 1R7HA 1I5GA 4ECIA 4L8EA
chains in the Genus database with same CATH superfamily
1VF2A 1SQWA 4IBPA 3EHCA 1GSEA 1UUGB 1B8XA 1IDPA 1GTIA 3GX0A 2REMA 1BSDA 1GMPA 4J8TA 7RNTA 3IHGA 3HYPA 3ZL5A 1T2HA 2H72A 7GSSA 3Q6OA 4IHUA 4I4KA 1RTUA 3G8ZA 2N5AA 4KDYA 2BNGA 3EURA 3EBYA 4KZ1A 2O3OA 2PVQA 2AADA 3HVNA 3GYKA 3UL3A 2WCIA 3NX0A 3KP9A 2CFWA 1TI1A 3E0UA 3FRCA 1IU7A 2GT5A 2J9HA 5G1KA 1VQ43 5HR3A 1E97A 3HI7A 1I3IA 4HM4B 1XW5A 4FYUA 3WT1A 2BMQB 3SOYA 2L4QA 1BUJA 4H3UA 2HSMA 1EA2A 2XRXB 2PUKC 3HX8A 3ISOA 4ZB8A 3KMNA 1ON4A 1ML6A 5IQYA 5EVHA 3I563 1YJW3 1K0BA 1MWUA 4XTSA 4EXRA 4HKVB 1CYVA 4ZL8A 3CPOA 3NV0A 3CXC2 2HT9A 5IMAA 4BA7A 3GN3A 4ZL7A 5FGOA 2CK3H 5F0GA 2D2ZA 4MH2A 3IC4A 1WMOA 3PS8A 2CX4A 3TJGA 4EE0A 4QL9A 1TK5B 3LXUX 3IMAB 3PCRA 2CZ3A 5IIZA 5D82A 3FG4A 4FO5A 1DBYA 3VGNA 2YV7A 3MWHA 3GKXA 4N6V0 4WYKB 1F8NA 2WS2A 3UB1A 1HYUA 1A24A 1DMNA 3LSZA 1GSYA 5IO2A 3PPUA 4LEHA 1V74A 3MDKA 4KGIA 5ECHB 1US1A 1LOVA 1I2FA 2K54A 2K3DA 3FR3A 2E2MA 3CXGA 1FAAA 5D9VA 2YCDA 2ML6A 4I2UA 5ECPB 2OCTA 4ORLA 4XB5A 1XOBA 2G2QA 2V6KA 1AVKA 3GH6A 5KOXA 1YI23 2DC5A 4TR0A 2HMMB 3G0KA 1NU3A 10GSA 4KF9A 1X5EA 3D4MA 1GS3A 3KTLA 1RMSA 3RHBA 2R4VA 1O6JA 5RNTA 1KTEA 2MF7A 4I6XA 3G7IA 4OO5A 2H1GA 3F3QA 4DSRA 2CIUA 4TXVA 3U6VA 2B5YA 1PKZA 3DUKA 4GRFA 3VFIA 3E99A 2NDOA 3IK7A 3VLNA 4TR1B 3X41A 1ERVA 1NM3A 2H6YA 1ERTA 2Z7AA 3UBLA 1AQZA 2X64A 1A90A 4V1Ap 1K734 4WHAA 4KSOA 5CLKA 4MJAA 3MKIA 2MBSA 3EWLA 1UN2A 3U1WA 5F05A 1MDKA 3GHAA 2V41A 4DKIA 3J7Yd 4JRRA 1OGXA 2H75A 3Q19A 1B2UA 4X2HA 4BIRA 1TFKA 3FG1A 5F06A 4MPFA 1YF0A 1JKGB 5KN1A 5IMVA 4RNYA 3M0FA 3GKNA 2QEX3 4QL7A 1YF1A 1QXHA 2HRFA 4O2HA 1UC7A 3O6TA 3WD6A 2MC8A 1BQ7A 5EY6A 1NJI4 5AYSC 3LZAA 4GL6A 2FA4A 3UJMA 2LEGA 1FUSA 2B6MA 2H1AA 4K2XA 4G2EA 4J56E 5IF6A 2IMJA 5A4VA 1W6CA 3IOSA 2QGUA 5H5QA 2UZ8A 1K9M4 1OH0A 2BU4A 4MA9A 3FCSB 4XBTA 5HFGA 5HOHA 2DKIA 1BUQA 2I1UA 2GSQA 1BJXA 1TK0B 3APOA 3WGXA 1DVCA 2JDIH 4KFEA 1URMA 2C3QA 1RNTA 3NIVA 3S9FA 6GSUA 3HHVA 1B9XC 2R3XA 1H75A 2IFQA 1WNHA 3CQFA 3ZFLA 5JCUA 3APSA 3D22A 4BIKA 1ISKA 1RCKA 1OCVA 2EIQA 1SL0B 4XIHA 3DIEA 3C1SA 4ZM8A 1HNCA 4IIAA 6GSYA 3TRPA 2HMOB 2L5OA 1KSIA 3KH7A 5GSPA 1IT7A 1OE7A 2CX0A 1I9DA 2YN1A 1XCCA 3L9UA 5AEUB 3G4S3 3G713 2VL2C 4K9ZA 4TXOB 4LZIA 3H4KA 4MH3A 3IV4A 1V57A 3URPA 2XSHB 2GDRA 4BVXB 3D5IA 4J5KA 3OR5A 5J9CA 3LTAA 2V1MA 3KCMA 6GSWA 3V92A 5BRTA 2KRTA 1F3AA 4ACSA 2L6CA 3DZLA 4WKWA 3SYUA 1CYUA 3O8YA 5B7CA 5A4UA 1R5PA 4ID0A 1WMNA 1YKAA 1EKMA 3KEBA 1ZX2A 3V99A 5DAKB 4MMZB 3ZMKA 3TJJA 4L7KA 4KH7A 3KMOA 2C10A 2CFGA 2V1LA 2OBKA 5CYYA 5C04A 3AHSA 1VQ73 4AGSA 2JQ5A 3HCZA 1GNWA 2FUG2 5AI1A 1M3JA 5DALB 4HVNA 3GMFA 1PRXA 2JZSA 2ZHXB 4OFMA 1TRSA 4L5LA 2ZA4A 4PX1A 2ALBA 2DMLA 1VQN3 4HJ2A 2P5QA 3WOEB 4MJDA 2H0IA 1B4PA 2HSHA 5GAND 4KAEA 1ST9A 2FWHA 2RCDA 1M99A 3HXSA 2GS3A 3BBYA 1Y6EA 2FXTA 4E8HA 4OUQA 1JLVA 3TOUA 1FVJA 1ZGNA 2TRCP 4D73A 1VQO3 3CC43 2HFDA 1NW2A 4EW5A 5AISA 2E7PA 1VF3A 3OX9A 4AF2A 4MLYA 4EKZA 3ME8A 1M3IA 1TRPA 3HKRA 4HAAA 4OFNA 4NHWA 1OC3A 3KSPA 13GSA 1O81A 2MMZA 4EBGA 4ZB9A 1OKDA 1ZYPA 1GD3A 3C1RA 2VL2A 3A2XA 5GAPD 3DY5A 4L8OA 5D9TA 5AN1A 4ILFA 2RUEA 2C4BA 4RNTA 1G0TA 2YFLB 1TDIA 4EUYA 1GMQA 2L1SA 1PGTA 2O9UX 2XGNA 3DGYA 1FOHA 1FW7A 4WBJA 1GTAA 3Q74A 2XBQA 5BXQA 1YGWA 4EVMA 1VQK3 1B21A 3GZXB 1GSPA 2BTOT 4CY6A 1BRIA 5IEPA 1FW1A 3EE2A 2CX1A 2GSRA 2FD3A 2XFSA 1IK3A 1BYEA 4BL3A 1Z3EA 2D42A 1O7HB 1I8VA 1AQXA 2KF4A 2C11A 4HI7A 2P5RA 1U87A 3F8XA 4X43A 4DSSA 4L8PA 2JL4A 2RUFA 3S67A 3LWAA 5G30A 1NHYA 3LW9A 4WP5A 4ZBDA 3A76A 3P7XA 2AUVA 2OE0A 4MF7A 2IY2A 3KTBA 2R0CA 4LL4B 1VF4A 3IE3A 1OGZA 3FF0A 1QQ2A 1O73A 3VWWA 1GSSA 1GD4A 2E2GA 3SVAA 1NB3I 2HZEA 2HNLA 2MMNA 1O7UA 4R9KA 1ILOA 1XZOA 3TKQA 1GOUA 4LSOA 1W4NA 1AQWA 3CTGA 2GSTA 4RZMA 4TX4A 1T3BA 2YP6A 2H0HA 1B4QA 4GSTA 3I43A 3SWLA 4KDUA 1OUNA 2PN8A 3EMPA 4EO3A 4EXJA 4GQFA 5AIIA 3AMOA 1DMQA 2N5FA 1YGEA 1V98A 2VL3A 3RPPA 3VURA 3WR2A 1W7CA 1E2YA 2BMOB 3WGEA 3HJMA 3QFAC 2R0PA 4N6UA 3O76A 1Z6MA 4ML6A 3JUPA 5IENA 3R2QA 1S723 3RAZA 4FYBA 1F6MC 3GZYB 6GSPA 2YWNA 2XF3A 2B5XA 1RRLA 2DJ3A 1UI7A 4PQ1A 3CSHA 4K5SA 5H5RA 2FNQA 1CH0A 2DJ2A 4GSSA 3GZBA 2JSYA 2JACA 2P0XA 2R4IA 1YHQ3 3LQ7A 1TRQA 2NTOA 3VWVA 1FYSA 2L57A 4LMVA 2CVDA 4AJ8A 5JPUA 1EG9B 4JRFA 3KFQC 2GSPA 3LEFA 2CQ9A 3T8UA 4WR5A 5EL8A 3HJOA 4HOHA 3L9SA 5ECSA 3PGBA 1JZWA 3FZWA 1A0FA 2DBCA 3PZWA 1JZRA 1BRHA 1MWRA 1R4YA 5ELGA 3QPMA 2X99A 3F8UA 2LRNA 2HZEB 2P0GA 4O5UA 3KSED 1RJOA 4ISDA 4XDVA 5IO0A 1JZDA 4K1FA 1Z9HA 4LLRA 1VQP3 1STFI 3N5OA 5IW9A 1B48A 2Z6BA 4IP1A 4FR9A 2O89A 3MG2A 5KP4A 1XWKA 5AYRB 5KP3A 3AMOB 4JR4A 2GBXB 1MEKA 4WEYA 7STDA 3P90A 4USSA 1WPIA 2HMKB 5DCGA 4IKHA 3MG1A 3CCR3 5L71A 1TP6A 2KOKA 5F07A 4EC6A 2OADA 1Q42A 3CRUA 1FOVA 5KP1A 2VCXA 1XPVA 5D83A 1YDKA 1X9MB 2P31A 3ZRDA 2RLIA 3M9JA 1KC84 5ECLB 2H1BA 3D79A 3HD5A 6GSTA 3NZNA 5TGNA 3A5EA 3CME3 8CHOA 4I97A 3CCJ3 1XFLA 2MZCA 1EQKA 2AV4A 3IR4A 1EV4A 4TN8A 1GLQA 1UCIA 3EU3A 2CAIA 1QAKA 1U5OA 3UBKA 1F3BA 3G16A 1M904 3EPTA 4Q5NA 3X3YA 4O5QA 1NWWA 2K8SA 1HNAA 1DE2A 1JZOA 2VIMA 3DXOA 4IQ1A 3MWZA 3TRXA 1FGQA 5ENUA 2F5WA 4JZQA 3JUMA 1T7PB 3TJFA 3GV1A 4K7OA 1BSAA 2VOCA 2Z77A 3KD0A 3KXOA 3Q90A 3CC23 2FA8A 1GY6A 3QFBC 3UJ1A 3HVXA 5DVBA 3I9V2 4IN0A 1CQGA 4PQHA 4WR4A 1FUTA 1X1XA 4F0CA 4MJBA 2I81A 4L0WA 4K0NA 3KM6A 5KN0A 1O7GB 4O5RA 3DGLA 1MD4A 2VCWA 3GX8A 3FW2A 3VI5A 3LT9A 3GWRA 2CG0A 1SK0A 4CCVA 3DGQA 1N9JA 4R80A 3FR6A 4JE1A 3HZ8A 1T4ZA 4GXZA 1RDSA 4YQVA 3ZZXA 1OACA 4F9ZA 5EQLA 4RNZA 3K63A 3AGNA 2YJ7A 3ERFA 2RM5A 1PL2A 5A4WA 3S5CA 1RGHA 1SYRA 3K7CA 2AB6A 4O92A 3MSOA 3UL6A 3V1WA 2ES7A 3RDEA 1JHBA 2QC7A 4FMAA 4IT7A 3FGYA 4I2TA 4HJLB 4HM8B 2LQOA 2J23A 2PWJA 4CHSA 2LJAA 3DVWA 4MMYB 4HZ4A 4WYKA 1FG4A 2PPTA 4QQ7A 1ZS7A 1ZYEA 4XDWA 5DJMA 2HYXA 3DM8A 2DJJA 2DJ0A 5IMZA 2HRAA 1K3OA 3DRNA 3GFKA 2HXKA 1IQYA 4IELA 5ID2B 3CMA3 3D5GA 3TDGA 2BHMA 3RHCA 1SKWB 4A5PA 1YKCA 1THXA 2LQQA 3QD9A 1GH2A 1M9BA 3FLJA 14GSA 3LH4A 1M2AA 1VGLA 1M2BA 5GSTA 4BTYA 3QOUA 2CZ2A 1XVWA 1GY7A 3ZYWA 4NWYA 2VAFA 1JJ22 2IN3A 1K41A 1TU5A 2IIYA 3NHXA 1M9GA 3BD2A 3M3MA 2ON5A 1WTHA 2H0GA 3APQA 3FR9A 2XPEA 4YKGA 1KNGA 4NMUA 3LT8A 4MABA 4TR1A 1TTOA 2CG1A 1I3FA 3STDA 1GSUA 1MWTA 2F4YA 4KFDA 2M46A 5CREA 4F0BA 5JBSA 1BIRA 1C7HA 3D4AA 1TXXA 3JCML 1R5AA 1DE3A 1SJZA 4N6TA 5JWRB 1K0MA 4ML1A 3WYWA 5HGRA 1SYXA 2VLVA 3O3TA 3TCOA 3ZITA 2I3YA 2V6OA 1WRYA 3J7Yk 1FO5A 4JU5A 2B5EA 5A5KA 1JKGA 1RGEA 4EDZA 1SARA 2E2VA 1N8R4 3VSYA 3ZFBA 2L4VA 4ZILA 3GIXA 3RNTA 3C73A 1STDA 2KAAA 4NPBA 5ECNB 2P05A 1O7WB 2H74A 3KZQA 3N9JA 4GF0A 1OKTA 4POMA 5AIFA 3LFLA 4PGTA 4WFOA 1BSEA 2GU3A 1OVNA 2M7OA 2XBIA 5D96A 1QFNA 3A5IA 4TR3A 3ZIVA 4N3VA 3J7Yb 2WFCA 3H51A 1ZZYA 3BJ5A 1BANA 3H1NA 3JVCA 1MGRA 4EIPA 1SIIA 4WF5A 5G2ZA 1BRKA 3I0YA 3DEXA 1G02A 1ACVA 2HLSA 4NXIA 1TKDB 3I553 4KB3A 1G7EA 3ECFA 2QA1A 4GWRA 3GKMA 1M0UA 3MHEA 4N6MA 5LCZA 4KW6A 2YZUA 20GSA 3HVSA 4IP6A 1N9EA 1JFUA 4RQRA 4TXOA 4PNFA 2GQKA 3W6GA 1Y25A 3CSJA 5ECRB 3PYJA 4IVFA 4BVXA 4Z2UA 4HQSA 1LBKA 3ZIJA 1BAOA 2YNXA 3PR8A 1U3IA 4YAVA 5ELJA 2IMKA 3BB9A 2RGQA 2W0QA 4R9LA 1IVUA 4FMCA 3CU3A 2GEYA 4ZL9A 2KF6A 3GNJA 5DAKA 1YNVX 4N6LA 2CFDA 4HM1B 3GSSA 3MPHA 5BIRA 2P0MA 1FVKA 1OHOA 3NUVA 1AAZA 3DMCA 2HE3A 3TKSC 1SKRB 3LXZA 2B1XB 2BT3A 5DALA 1IV9A 3Q3FA 1AXDA 1O7NB 1RK4A 1TOFA 4WWUC 1WMJA 3FYGA 4EC0A 1W01A 1TU8A 2CFLA 4KCAA 2F56A 3P2AA 4EDYA 5FW5A 2RFRA 3V98A 4XBYA 3BLZA 5DRVA 2ZCTA 1NO3A 2IMEA 3P8WA 1EP7A 1OYJA 4PTSA 3EBTA 1S3CA 3CSIA 3D21A 3TKSE 2F8FA 4POKA 1J2BA 1RGAA 2N5BA 4EF0A 2H8LA 2H6XA 3VI7A 2OTJ3 2OE3A 1RHLA 3WA3A 1A0RP 1A2JA 4BTWA 3DXBA 4IQAA 2E2UA 3CPW2 2DJ1A 5IMDA 5LD0A 5M19A 1RRHA 4PUFC 3KN4A 3T8NA 3GKKA 3HA9A 2RM6A 9RNTA 1C72A 3B7CA 1XWCA 3D4TA 3UL5A 3B4OA 3BCIA 1K3YA 4MJCA 3EINA 2FHEA 5AIGA 2JZRA 4AEQA 4CW9A 4PXOA 3EQQB 3W8SA 1V2AA 3T0UA 5ELAA 1OE8A 4CY8A 2DIYA 3NBBA 3FK8A 1GSQA 1YVSA 2A15A 5CRGA 3NBJA 4I5QA 1HQOA 3Q1CA 5ABRA 3WHOA 5D9XA 1EGOA 2L6DA 2QSIA 4NAXA 1PN0A 1TU7A 2A4VA 4GSNA 4XM4A 4K5RA 3IK9A 2W9QA 2VLUA 3QMXA 1W6YA 5FWGA 4HEA2 1V58A 3GSPA 3ZG5A 2PBJA 3TKSA 2LJKA 1YJ93 3AHWA 4KUNA 1GULA 4HM2B 4BWSA 2VM1A 1EP8A 1UGIA 1PFOA 5AIVA 5H5SA 2YFIB 1UUWB 4TKYA 5E59A 4DEJA 5DJLA 2YWMA 2FLSA 1W6GA 4KSMA 2XR8B 1HNBA 5DBQA 3KCHA 3GL3A 3F4SA 1X5CA 4XRAA 3K8NA 4K6XA 1EOHA 5D73A 1LRAA 5CRWA 2LSTA 2CX3A 5CO3A 1BGSA 2FNOA 4MZWA 5JWQB 3S28A 1M2DA 1BEDA 3EN8A 1FGMA 5AIXA 3X3ZA 1S5AA 2UX0A 4P3YB 4E8EA 4Q5FA 3MNGA 5G1LA 2FWGA 4HUAA 3RBTA 4HU7A 1RGFA 1GMRA 1RN7A 2A4HA 1MWSA 1FA3A 1AIUA 3BNEA 1G7OA 4LYLB 1AVLA 1PKWA 1U88A 1G6WA 2R37A 4FQUA 4XBXA 1V40A 1X0RA 3L4NA 5BVBA 4BL7B 3DWVA 1YEPA 2C0GA 1R4CA 5COHA 4IS0A 3K0ZA 1PD21 1BX9A 2JU5A 3TRQA 4HYZA 2DMMA 3KIJA 1XOAA 3HOHA 1SJIA 1T1VA 3MG3A 3WA2X 3IA1A 5CRHA 2YOIA 3N9HA 2M72A 1JRQA 1Z7PA 3QRDA 3DGMA 2KF5A 2DLXA 1BNIA 4JEDA 1ZYQB 1B27A 2Q07A 1I2GA 3TKRA 3CRTA 4YH2A 1A2KA 5HFKA 4V2LA 1GSFA 2B7JA 2GU1A 1QAFA 3GSTA 1UCLA 3ED3A 3QCPA 2LYXA 3ER7A 5IG3A 2OOVC 5EPFA 2GVPA 2VCZA 3F9SA 5AIHA 3ERWA 4ECCA 3M9KA 1FGRA 4PNGA 1YIJ3 1O8WA 1LQGC 3D3LA 3JUNA 3GAXA 4AJ6A 3TGZA 2VCVA 4G19A 4CJNA 2P09A 8RNTA 5B8BA 3K5TA 3ZFZA 2WGOA 3ZVJA 1K3LA 1SIHA 2WJUA 4XS6A 1ULJB 4FCMA 2HOHA 3UNLA 2CT6A 1A67A 4MPGA 4OVMA 4WF4A 1ASKA 2GZPA 4RQXA 3U5RE 4GTUA 2KCDA 1IVXA 2QKEA 5DQSA 2CKFB 3GH9A 1PA3A 3PGTA 3L9VA 4K1VA 5D81A 3KZTA 4NHFA 1SK1A 1N8QA 2ON7A 2QA2A 2IMIA 3LTBA 3SLUA 2IYJA 2YV9A 1I0VA 1QK8A 1YY7A 3AY8A 4N10A 1XXUA 2IUJA 1J08A 1ROAA 2HI7A 4NV2A 3D5JA 3EYTA 4EL1A 1A8LA 3TUEA 1OF5B 4EYCA 2G0FA 1ZO2A 2AYTA 3GTUB 3F6DA 1IVVA 3ZTLA 5FT3A 5KEJA 3DH2A 16GSA 2JZTA 4YAPA 1EOGA 4EIQA 2CVBA 4GCIA 1HKXA 1WOUA 2KLXA 1ZYNA 1Y4KA 2MBTA 2TIRA 1PQNA 3FMWA 4K1UA 3ROBA 1LOXA 4O8SA 2WGRA 4XCSA 1SJ6A 1AY7A 1KD14 3VPQA 4R1KA 3BNCA 2QA43 1PMTA 4LA1A 4ZXGA 1M7TA 3CCL3 1A2VA 1CQHA 5J4UA 1QMVA 1BNJA 3AGOA 4L5OA 4HZ9B 3NM7A 2OQEC 3FKFA 2R5GA 2YWIA 4F03A 1W5ZA 1K0AA 2C0EA 1GWCA 1I0XA 1IYHA 2XPDA 4OO4A 2IJYA 4G10A 3IXRA 5EVOA 1AR0A 2PNCA 3WT2A 2FGTA 2OE1A 1QMAA 3OXAA 4FIWA 1UCJA 5DQYA 4K2DA 2W2CA 1W2ZA 1H4OA 2BIRA 2AJQB 1GL8A 4JF8A 19GSA 3DYRA 2R6KA 1CEWI 11GSA 4GQCA 4PUAA 3BOAA 2CWUA 3PINA 1F9MA 4K7NA 1NHOA 4JBBA 3Q18A 3I6AA 3PXMA 1XG8A 3UMAA 5CXOA 1TFOA 2O85A 3DGOA 2MMOA 4X0XA 1MDJA 5IG0A 2HZFA 1NB5I 1BVIA 2X8HA 1Z5YE 7GSPA 5D9WA 2Z9SA 1BNSA 1YIT3 1BSBA 2B7KA 3GRXA 5IG5A 4KE3A 1XVQA 4O7HA 1AV4A 4MMXB 3C71A 3MSZA 1GYBA 1FGTA 2SARA 5ID2A 2WO0A 4NREA 1OC9B 1BU4A 2KXGA 2KUCA 3M8NA 2KP2A 5STDA 3X40A 1MTCA 4Q5QA 1LNIA 4HBRA 22GSA 2K9FA 3FZ5A 5EEOA 1K0NA 2IWTA 9GSSA 2W56A 4JR6A 2BMRB 3F8HA 2OQEA 2FWEA 2H01A 1Q7Y4 4IGJA 2INXA 18GSA 3C7MA 2LNTA 5CP1A 1Q7HA 3PH9A 1IV7A 2VD0A 2PGTA 3ZMLA 3WODG 6STDA 2CWVA 5JPPA 1DUGA 1G6YA 2WULA 5IM9A 3GZRA 4MCUA 3WOFB 1SL1B 2CV4A 4BU4A 1W2B2 1D6UA 2F9SA 1Z6NA 2VM2A 4O32A 1GOYA 1VQ53 2CVKA 1ZGXA 4GSPA 3EU4A 1PX6A 2LTKA 1U8CB 4LGQA 5IOXA 3K9MC 2L59A 1Q9EA 5LNKe 2H30A 1MOLA 4TW5A 2V2GA 2IMFA 1O7PB 2LRCA 4YQUA 1RLSA 1RGCA 4Z7XA 1IQ8A 3RGRA 2C3TA 3M8CA 4MP4A 3M1GA 5AEWB 5GSSA 1J9BA 1LU4A 1ZMAA 4AJ7A 1B2MA 3UEMA 1E3RA 4XS1A 1ROVA 3QR6A 1RN1A 3HY2A 2PU9C 3LYPA 4J9AA 3X3XA 3EVIA 4V1Ag 2CA8A 2MYGA 1U3AA 3RDWA 4G0LA 1Q40A 1NSWA 3RPNA 4POLA 1JB2A 6GSSA 1WP0A 4RI7A 5ECKB 2BJXA 1T4YA 1YJ6A 4J2FA 1UVZA 3LOYA 5DDLA 1B2ZA 1X1YA 3B4PA 5LC6A 2KP1A 3EMXA 2W56B 4EV2A 2HMNB 1VQ63 2EIOA 4MEIA 1AW9A 2CC3A 2AAWA 3CYNA 2O87A 4K7IA 5I97A 3E9JB 1TRUA 4K0GA 1JBSA 4N30A 4G0KA 4AKZA 1EEMA 4LL1B 3FHKA 1DE1A 1PSQA 1ZOFA 1SD8A 2LS5A 2J8XB 1IQXA 5CK6A 1IT8A 1T00A 1YQ1A 4LMWA 1JN5B 1N5HA 1VF1A 4F82A 2F98A 4OCEA 2PMTA 1LVNA 3GRDA 2OKAA 1B2SA 1EWXA 4ZBAA 1GRXA 4YQMA 1A2LA 2CHCA 1N8JA 1J0FA 1EGRA 2GZZA 3HDCA 2VCQA 4QWTA 5HR1A 5CNWA 1SU9A 4DVCA 1LOYA 5ELUA 3CCE3 3NXJA 3UARA 1UI8A 1A8YA 1BAYA 5ECIB 2WOHA 1GUHA 3LMLA 1Q4JA 1GY5A 2W03A 2FWFA 2XC2A 4BVYB 1O7MB 1FB0A 2VUPA 2OACA 2PERA 1UUVB 1Q40B 3UVTA 2X8GA 3L78A 4Z2TA 3D0ZA 3F14A 1GP1A 3C8EA 1X9SB 5D8IA 3BIRA 1D6YA 3CTFA 2X4AA 3BNDA 2HMJB 1THOA 1NNVA 4K90B 4HOJA 5JCWA 4O02B 2FY6A 3F7XA 1FZUA 3CCV3 2VD1A 1JNQA 1TJDA 3Q2PA 1OC8A 2HRKA 1MDIA 4HU9A 4TOPA 2Z76A 2AAEA 2L5LA 2DIZA 2WGQA 1TI3A 3DKSA 1BSCA 4HSCX 3F0IA 1BRJA 5AGYA 2Y74A 2YFJB 3MAKA 2I9WA 1MD3A 3GA4A 5IOWA 1DYUA 4XHMA 4L0UA 1W02A 1Q864 3ZREA 4XS4A 3JUQA 3IAS2 3EX9A 4NV5A 2CWTA 1K8A4 1TTZA 2RBIA 4OK0A 2NPBA 1JBRA 3F4TA 4IPBA 4KA0A 1RKYA 4XRDA 1A2PA 1HU9A 3BCKA 3IJEB 2K6VA 2BO9B 1W00A 3NV0B 3CCM3 2EIRA 1BRSA 1DMMA 2RSXA 1U6TA 1JLWA 4X2OA 5IG4A 1MNLA 3GUSA 1JB5A 2HMLB 1B20A 3EC9A 4MMMA 2UGIA 1ERWA 1N2AA 4H86A 4FH8A 4KDXA 3VPTA 2W04A 1M9AA 3DD3A 4KVHA 3MYDA 1FHEA 2L4CA 4GHOA 2IUKA 2WOFA 3ALAA 3KKGA 5A0OB 4POBA 1AC1A 3CMIA 4N6OB 5BU4A 1QGVA 5M1AA 4ECJA 2PZVA 4IW9A 1YEXA 4G0IA 3SX1A 1TK8B 1RNBA 3NQYA 4WETA 1VQL3 2LUSA 4HS1A 2WB9A 3NBRA 5HQPA 2WDUA 5M18A 3CCS3 3EE1A 3F9UA 1K0CA 4MZBA 3US3A 1RQMA 3SXXA 4BWQA 5J41A 4R4KA 1GUKA 2E2TA 1R4WA 1S3DA 2H6ZA 2VL9A 2GT6A 1C54A 2NBSA 4PURA 1X5DA 4OWYA 2I4AA 3F3RA 2C3NA 1G96A 3DGNA 1BNFA 3I69A 4CDOA 4MK3A 4N6NB 4OD7A 1ABAA 2Y73A 5KOWA 1VQ93 2GLRA 3L0RA 1TRVA 4XS4B 3FH1A 3U97A 2H73A 1WIKA 2F99A 1Q98A 1TRWA 1GOVA 2LRTA 2K8VA 3KIIA 4HM3B 2YWOA 2ZL8A 3KP8A 1PYLA 2B1LA 4IJIA 4OFTA 2B24B 2GBWB 4BL7A 2GXFA 2H1DA 4OMVA 3MYTA 3GURA 5ECOB 4Z2RA 3BNBA 4HM0B 2OA7A 2XEPA 2ZUPA 1PFPA 2H71A 3F7SA 1A23A 5ECQB 1LQMB 5KN2A 3IPZA 3F40A 5J5NA 1XWBA 1WJKA 2IL3A 4L8EA 1KBNA 2YZHA 1VRSD 3A3TA 2C8UA 1LNHA 1SD9A 2STDA 1DSBA 2IPAA 3W8JA 2YX9A 3LTCA 1F37A 3OWYA 2LKUA 3HVVA 3QAVA 1VZZA 3QAGA 1QUWA 1HD2A 1R26A 5KN3A 1WWJA 4F2IA 1QJGA 3B8LA 1RGGA 3TJKA 4J5GA 3HZ4A 2C0DA 3F4RA 1LOWA 3X42A 1EEJA 3UVHA 4ULXA 3EJVA 1XW9A 3TB2A 1BOXA 2OTL3 1ULIB 1K28A 3FKAA 1WE0A 1WMPA 1KQS2 3LJRA 1T5YA 2R0GA 2P38A 3ME7A 2A2PA 4K8MA 2PVOC 3TJBA 2DKHA 5C00A 4ZBBA 4V2NA 2IFQB 1M1XB 3QK9A 4TRXA 2UUGC 4MNNA 3VF1A 5CRDA 2C4JA 1B3SA 2K18A 3FF2A 2R41A 4HDEA 4X4JA 4I8BA 4NHZA 1DVDA 1K0DA 4RBNA 1GTUA 2AHEA 1CQSA 1TP9A 3FEUA 3HIGA 2XHFA 4G9HA 4X1UA 3ZLPA 3UOMA 1OHSA 3L0HA 2F5MA 5CF1A 2GQLA 4FMDA 1TUHA 17GSA 1BRGA 1ZCPA 1I2EA 1OF5A 1Q814 1EZKA 3GTUA 2H19A 3IRAA 3LYKA 4FMBA 2LV3A 1O85A 3EN1B 4FYCA 2TRXA 3PCSA 4MDCA 4IJ3A 5IMFA 5BMUA 1A2MA 3CBUA 2BMXA 2JADA 5IPGA 3KGKA 5G5EA 5IERA 1I70A 1UCKA 2CH9A 3G6E3 1IYYA 2M80A 3LXTA 2DSAA 2H70A 1O8XA 1M1K4 2CW9A 1LXEA 1D6ZA 2CAQA 4BL2A 3DMLA 3HJPA 4N0VA 1E6BA 4MF5A 3G9BA 3FG3A 5IEOA 2VLTA 3IAM2 1SL2B 3OW22 3BU4A 2YPMA 1Z1SA 4MF6A 4BPYA 1QALA 3OWSA 3NOFA 1ZL9A 3R3EA 3KH9A 3HZPA 1BRNL 3CCU3 1PU4A 1QVF2 1AQVA 1OAZA 2H66A 5JCGA 5G31A 3D9RA 4H61A 4KT3B 3E3EA 1L5GB 2GEXA 1TIJA 2HSYA 2R2JA 5DREA 4D73B 2XH9A 3S27A 3QAWA 3OWUA 1RSNA 3CCQ3 3OV4A 4ZB6A 1BNEA 4CDLA 1IYIA 2E0QA 2LQVA 2F3MA 4ZIJA 4FCJA 8GSSA 2SBLA 1K0OA 2O7KA 1GUMA 2FCHA 6GSXA 4STDA 2RNTA 3SEDA 2B1KA 3GL5A 3MIXA 2OBIA 1B2XA 3F6FA 3CNXA 2OJLA 4V2MA 5HFIA 3S29A 1GTBA 2LNSA 5HR2A 5CAXA 2EC4A 1SPUA 3QDNA 4G1MB 1ERUA 1FB6A 3TOTA 2W9PA 1XBSA 4N11A 2V32A 2WZ9A 1VQM3 1JB4A 1XIYA 1WQLB 1BNRA 6RNTA 1FGOA 4GB5A 1E3VA 3LG6A 2ML5A 3N8BA 2RIIA 2A2RA 3F63A 5IPHA 2IMDA 3KE7A 5B8AA 3H3HA 1Q824 1T8EB 4FCZA 3N54B 2WRTA 3IHQA 3WGDA 1UGHI 1QVG2 2C1YA 1OC9A 4N0ZA 3EB8A 1HYFA 4HZ2A 1DETA 3NM2A 1UW1A 2A2SA 1AUCA 2FGXA 4DSSB 2OOVA 4HZBB 2B3SA 3RGAA 1GSDA 1Z7RA 1W89A 4TR4A 5B6MA 1HZ1A 4HM6B 2C0FA 4KFFA 1RW1A 3ZVJD 2GQMA 3LORA 3NQZA 2W6JH 3HIIA 2GGTA 5G5FA 1GNEA 4MZCA 1EV9A 3IPTA 2GTUA 3FZ4A 4KCEA 1YJN3 2F51A 2X49A 3WMDA 1BG5A 1F2EA 1W4VA 1KWIA 1S3AA 2YANA 4GLTA 3CC73 3IDVA 1X1UA 4KNDA 1XW6A 1LJRA 12GSA 2JSZA 1UDII 3SBCA 5INYA 1SK2A 1XWAA 1OHPA 1TW9A 2LJRA 2MMAA 4Q53A 3A2VA 3DVXA 5F8BA 2NVLA 4ECBA 2VCTA 3LYGA 5D93A 1XWGA 1X1WA 1YVBI 3CD63 2KF3A 1USBA 3VK9A 2IA7A 4Q5RA 3FZ9A 2OWPA 3D6IA 1B9YC 5ECMB 2XFTA 1BNGA 3WDGB 3H93A 2QIYA 5J3RA 3EC3A 1PN9A 5DCHA 1JBTA 5CF2A 1RGLA 2HRNA 4AKYA 2DJKA 1MGWA 3JUOA 1NDOB 4HM7B 5G2GA 4HM5B 1OPYA 1PY3A 1RCLA 3G7YA 2VO4A 1FUWA 3UAPA 1T2IA 3IBHA 3FSDA 5J9BA 3LTDA 1VQ83 1IVWA 1VQQA 2QGVA 2CFKA 1RGKA 5E4WA 3KJYA 3TKPA 4RI6A 5LC7A 3SOAA 4WBRD 4O3VA 4LMIA 1SJWA 3G7JA 2YJHA 3IC8A 4HJMA 5IMCA 1UA5A 2X8CA 5B6NA 4KX4A 1KEBA 2D1WA 4U13A 4CPKA 4WXTA 1V9WA 4PQIA 3HK4A 4RUVA 3UIWA 5HR0A 1SKSB 1PX7A 3A5WA 1JN5A 3EF8A 6GSVA 3ERGA 4K61A 3ZG0A 3FZAA 1RN4A 5FHIA 2XGLA 1YZXA 1EUIC 2ZNMA 2C80A 1PL1A 1N5PA 4HQZA 2XSOB 4DSQA 4MJEA 4PEJA 3VWUA 1X9WB 4ICYA 3H8QA 3FY7A 2H76A 4YKFA 2GSSA 3A2WA 4EV5A 2F8AA 2ZDJA 1GLPA 2KHPA 3H79A 3LGCA 4J57E 2F86B 5GZZB 5JWOB 2O8VB 2I9HA 2GZYA 4OCFA 2K0MA 1JV2B 4BTXA 1S3RA 4TVEA 3VWXA 1SENA 4BVYA 1R7HA 1I5GA 4ECIA 3CNMA
chains in the Genus database with same CATH topology
1VF2A 4IBPA 1GSEA 1B8XA 1GTIA 3GX0A 2REMA 3IHGA 3HYPA 3ZL5A 2H72A 7GSSA 3Q6OA 4IHUA 4KDYA 2N5AA 3EURA 2PVQA 3GYKA 3UL3A 2WCIA 3KP9A 1TI1A 3E0UA 3FRCA 2GT5A 2J9HA 5G1KA 5HR3A 4FYUA 1XW5A 3WT1A 2L4QA 2HSMA 2PUKC 4ZB8A 3ISOA 3KMNA 1ON4A 1ML6A 5IQYA 1K0BA 4XTSA 4ZL8A 2HT9A 5IMAA 4BA7A 3GN3A 4ZL7A 5F0GA 2D2ZA 4MH2A 3IC4A 2CX4A 4QL9A 3TJGA 4EE0A 1TK5B 2CZ3A 5IIZA 4FO5A 1DBYA 2YV7A 3MWHA 3GKXA 2WS2A 1HYUA 1A24A 3LSZA 1GSYA 5IO2A 3PPUA 3MDKA 4KGIA 5ECHB 3FR3A 2E2MA 3CXGA 1FAAA 5D9VA 2YCDA 4I2UA 5ECPB 1XOBA 2G2QA 2V6KA 3GH6A 5KOXA 4TR0A 2DC5A 10GSA 4KF9A 1X5EA 3D4MA 3KTLA 3RHBA 2R4VA 1O6JA 1KTEA 4I6XA 3G7IA 4OO5A 2H1GA 3F3QA 4DSRA 4TXVA 3U6VA 2B5YA 1PKZA 4GRFA 3VFIA 2NDOA 3IK7A 3VLNA 4TR1B 1ERVA 1NM3A 2H6YA 1ERTA 3UBLA 2X64A 4V1Ap 4KSOA 4MJAA 2MBSA 3EWLA 1UN2A 5F05A 1MDKA 3GHAA 2V41A 4JRRA 2H75A 3Q19A 5F06A 4MPFA 1YF0A 5KN1A 5IMVA 3M0FA 3GKNA 4QL7A 1YF1A 1QXHA 2HRFA 3O6TA 1UC7A 3WD6A 1BQ7A 5EY6A 2FA4A 2LEGA 2B6MA 2H1AA 4K2XA 4G2EA 4J56E 5A4VA 3IOSA 5H5QA 2UZ8A 4MA9A 5HFGA 2DKIA 2I1UA 2GSQA 1BJXA 1TK0B 3APOA 3WGXA 2C3QA 1URMA 3NIVA 3S9FA 6GSUA 3HHVA 1B9XC 2R3XA 1H75A 2IFQA 3ZFLA 5JCUA 3APSA 3D22A 2EIQA 1SL0B 4XIHA 3DIEA 3C1SA 1HNCA 6GSYA 3TRPA 2L5OA 3KH7A 1OE7A 1I9DA 2YN1A 1XCCA 3L9UA 2VL2C 4K9ZA 4TXOB 3H4KA 4MH3A 3IV4A 1V57A 2GDRA 4BVXB 3OR5A 5J9CA 2V1MA 3KCMA 6GSWA 5BRTA 1F3AA 4ACSA 2L6CA 4WKWA 5B7CA 5A4UA 1R5PA 4ID0A 1YKAA 3KEBA 5DAKB 3ZMKA 3TJJA 4KH7A 3KMOA 2OBKA 5CYYA 5C04A 4AGSA 3HCZA 1GNWA 2FUG2 5DALB 3GMFA 1PRXA 2JZSA 4OFMA 1TRSA 4L5LA 4PX1A 2ALBA 2DMLA 4HJ2A 2P5QA 2H0IA 1B4PA 2HSHA 5GAND 4KAEA 1ST9A 2FWHA 1M99A 3HXSA 2GS3A 3BBYA 1Y6EA 4E8HA 1JLVA 3TOUA 1FVJA 1ZGNA 2TRCP 4D73A 2HFDA 1NW2A 5AISA 2E7PA 1VF3A 4AF2A 4MLYA 4EKZA 3ME8A 3HKRA 4OFNA 4NHWA 1OC3A 13GSA 1O81A 2MMZA 4ZB9A 1OKDA 1ZYPA 3C1RA 2VL2A 3A2XA 5GAPD 5D9TA 5AN1A 4ILFA 2RUEA 1G0TA 1TDIA 4EUYA 1PGTA 1FOHA 4WBJA 1GTAA 3Q74A 2XBQA 4EVMA 2BTOT 4CY6A 1FW1A 3EE2A 2GSRA 2FD3A 1BYEA 1Z3EA 1AQXA 4HI7A 2P5RA 1U87A 4X43A 4DSSA 2JL4A 2RUFA 5G30A 3LWAA 1NHYA 3LW9A 4ZBDA 3P7XA 2AUVA 2OE0A 4MF7A 2IY2A 3KTBA 2R0CA 4LL4B 1VF4A 3IE3A 1QQ2A 1O73A 3VWWA 1GSSA 2E2GA 2HZEA 2HNLA 2MMNA 1O7UA 1ILOA 1XZOA 3TKQA 1AQWA 3CTGA 2GSTA 1T3BA 2YP6A 2H0HA 1B4QA 4GSTA 3I43A 3SWLA 4KDUA 2PN8A 3EMPA 4EO3A 4EXJA 4GQFA 2N5FA 1V98A 2VL3A 3RPPA 3VURA 1E2YA 3WGEA 3HJMA 4ML6A 2R0PA 3O76A 3QFAC 1Z6MA 3RAZA 3R2QA 4FYBA 1F6MC 2YWNA 2B5XA 2DJ3A 4PQ1A 3CSHA 4K5SA 5H5RA 2DJ2A 4GSSA 2JSYA 2JACA 3LQ7A 3VWVA 2NTOA 2L57A 4LMVA 2CVDA 4AJ8A 3LEFA 2CQ9A 4WR5A 5EL8A 3HJOA 3L9SA 5ECSA 1JZWA 1A0FA 2DBCA 1JZRA 5ELGA 3QPMA 2X99A 3F8UA 2LRNA 2HZEB 2P0GA 4O5UA 4ISDA 5IO0A 1JZDA 4K1FA 1Z9HA 4LLRA 3N5OA 1B48A 4IP1A 2O89A 1XWKA 4JR4A 1MEKA 4WEYA 3P90A 4USSA 1WPIA 5DCGA 4IKHA 5L71A 2KOKA 5F07A 2OADA 3CRUA 1FOVA 2VCXA 1XPVA 1YDKA 1X9MB 2P31A 3ZRDA 2RLIA 3M9JA 5ECLB 2H1BA 3HD5A 6GSTA 3NZNA 4I97A 1XFLA 2MZCA 2AV4A 3IR4A 1EV4A 4TN8A 1GLQA 3EU3A 2CAIA 3UBKA 1F3BA 3EPTA 4Q5NA 4O5QA 2K8SA 1HNAA 1DE2A 1JZOA 2VIMA 4IQ1A 3TRXA 5ENUA 4JZQA 1T7PB 3TJFA 3GV1A 4K7OA 2VOCA 3KD0A 3KXOA 2FA8A 3QFBC 3UJ1A 3HVXA 5DVBA 3I9V2 4IN0A 1CQGA 4PQHA 4WR4A 4F0CA 4MJBA 2I81A 4L0WA 4K0NA 3KM6A 5KN0A 4O5RA 1MD4A 2VCWA 3GX8A 3FW2A 3VI5A 1SK0A 3DGQA 3FR6A 4JE1A 3HZ8A 1T4ZA 4GXZA 4YQVA 3ZZXA 4F9ZA 2YJ7A 3ERFA 2RM5A 1PL2A 5A4WA 1SYRA 2AB6A 4O92A 3V1WA 2ES7A 1JHBA 2QC7A 4I2TA 2LQOA 2J23A 2PWJA 4CHSA 2LJAA 3DVWA 4HZ4A 1FG4A 2PPTA 4QQ7A 1ZYEA 5DJMA 2HYXA 2DJJA 2DJ0A 5IMZA 2HRAA 1K3OA 3DRNA 3GFKA 2HXKA 4IELA 5ID2B 3TDGA 3RHCA 1SKWB 4A5PA 1YKCA 1THXA 2LQQA 3QD9A 1GH2A 1M9BA 14GSA 1M2AA 1VGLA 1M2BA 5GSTA 3QOUA 2CZ2A 1XVWA 3ZYWA 4NWYA 2VAFA 2IN3A 2IIYA 3BD2A 3M3MA 2ON5A 2H0GA 3APQA 3FR9A 2XPEA 4YKGA 1KNGA 4NMUA 4MABA 4TR1A 1GSUA 2M46A 5CREA 4F0BA 1TXXA 3JCML 1R5AA 1SJZA 5JWRB 1K0MA 4ML1A 3WYWA 1SYXA 2VLVA 3O3TA 3TCOA 3ZITA 2I3YA 2V6OA 1WRYA 3J7Yk 1FO5A 4JU5A 2B5EA 5A5KA 4EDZA 3ZFBA 4ZILA 3GIXA 3C73A 4NPBA 5ECNB 2H74A 3KZQA 3N9JA 4GF0A 1OKTA 4POMA 3LFLA 4PGTA 1OVNA 2XBIA 5D96A 1QFNA 3A5IA 4TR3A 3ZIVA 3J7Yb 2WFCA 1ZZYA 3H1NA 3BJ5A 4EIPA 4WF5A 5G2ZA 3DEXA 1ACVA 2HLSA 4NXIA 1TKDB 4KB3A 1G7EA 4GWRA 2QA1A 3GKMA 1M0UA 5LCZA 4KW6A 2YZUA 20GSA 3HVSA 4IP6A 1JFUA 4RQRA 4TXOA 4PNFA 2GQKA 3W6GA 1Y25A 3CSJA 5ECRB 4Z2UA 4IVFA 4BVXA 4HQSA 1LBKA 3ZIJA 2YNXA 3PR8A 1U3IA 4YAVA 2IMKA 4ZL9A 3GNJA 5DAKA 3GSSA 1FVKA 1AAZA 2HE3A 3TKSC 1SKRB 3LXZA 5DALA 1AXDA 1RK4A 1TOFA 1WMJA 3FYGA 4EC0A 1TU8A 4KCAA 3P2AA 4EDYA 2ZCTA 2IMEA 3P8WA 1EP7A 1OYJA 4PTSA 1S3CA 3CSIA 3D21A 3TKSE 2F8FA 4POKA 2N5BA 4EF0A 2H8LA 2H6XA 3VI7A 2OE3A 1A0RP 1A2JA 3DXBA 4IQAA 2DJ1A 5IMDA 5LD0A 4PUFC 3GKKA 3HA9A 2RM6A 1C72A 1XWCA 3D4TA 3BCIA 1K3YA 4MJCA 3EINA 2FHEA 2JZRA 4CW9A 4PXOA 3W8SA 1V2AA 5ELAA 1OE8A 4CY8A 2DIYA 3FK8A 1GSQA 5CRGA 4I5QA 1HQOA 5ABRA 5D9XA 1EGOA 2L6DA 2QSIA 4NAXA 1PN0A 1TU7A 2A4VA 4GSNA 4K5RA 3IK9A 2VLUA 3QMXA 5FWGA 4HEA2 1V58A 2PBJA 3TKSA 2LJKA 4KUNA 1GULA 4BWSA 2VM1A 1EP8A 5AIVA 5H5SA 4TKYA 5E59A 4DEJA 5DJLA 2YWMA 2FLSA 4KSMA 1HNBA 5DBQA 3GL3A 3F4SA 1X5CA 4XRAA 3K8NA 4K6XA 1EOHA 5D73A 5CRWA 2LSTA 2CX3A 5CO3A 2FNOA 4MZWA 5JWQB 1M2DA 1BEDA 5AIXA 4P3YB 4E8EA 4Q5FA 3MNGA 5G1LA 2FWGA 4HUAA 3RBTA 4HU7A 2A4HA 1AIUA 1G7OA 1PKWA 1U88A 1G6WA 2R37A 4FQUA 1V40A 1X0RA 3L4NA 4BL7B 3DWVA 1YEPA 2C0GA 5COHA 4IS0A 1PD21 1BX9A 2JU5A 3TRQA 2DMMA 3KIJA 1XOAA 1SJIA 1T1VA 3IA1A 5CRHA 2YOIA 2M72A 1Z7PA 2DLXA 4JEDA 1ZYQB 3TKRA 3CRTA 4YH2A 5HFKA 4V2LA 1GSFA 2B7JA 3GSTA 3ED3A 3QCPA 5EPFA 2GVPA 2VCZA 3ERWA 4ECCA 3M9KA 4PNGA 1O8WA 4AJ6A 3TGZA 2VCVA 4G19A 5B8BA 3ZVJA 1K3LA 2WJUA 4XS6A 4MPGA 2CT6A 4WF4A 2GZPA 4RQXA 3U5RE 4GTUA 2QKEA 5DQSA 3GH9A 1PA3A 3PGTA 3L9VA 1SK1A 2ON7A 2QA2A 2IMIA 2IYJA 2YV9A 3AY8A 1QK8A 1YY7A 4N10A 1XXUA 1J08A 2HI7A 4NV2A 3D5JA 3EYTA 4EL1A 1A8LA 3TUEA 2G0FA 2AYTA 3GTUB 3F6DA 3ZTLA 5FT3A 5KEJA 16GSA 2JZTA 4YAPA 1EOGA 4EIQA 2CVBA 4GCIA 1WOUA 2KLXA 1ZYNA 2MBTA 2TIRA 1PQNA 3FMWA 2WGRA 4XCSA 1SJ6A 3VPQA 1PMTA 4LA1A 4ZXGA 1M7TA 1CQHA 5J4UA 1QMVA 4L5OA 3FKFA 2R5GA 2YWIA 4F03A 1K0AA 2C0EA 1GWCA 1IYHA 2XPDA 4OO4A 2IJYA 4G10A 3IXRA 5EVOA 3WT2A 2OE1A 4FIWA 5DQYA 4K2DA 1H4OA 2AJQB 1GL8A 19GSA 3DYRA 2R6KA 11GSA 4GQCA 4PUAA 3BOAA 3PINA 1F9MA 4K7NA 1NHOA 4JBBA 3Q18A 3I6AA 3UMAA 2O85A 2MMOA 4X0XA 1MDJA 2HZFA 2X8HA 1Z5YE 5D9WA 2Z9SA 2B7KA 3GRXA 4KE3A 1XVQA 4O7HA 3C71A 3MSZA 5ID2A 1OC9B 3M8NA 2KUCA 2KP2A 1MTCA 4Q5QA 22GSA 2K9FA 3FZ5A 1K0NA 2IWTA 9GSSA 4JR6A 2FWEA 2H01A 4IGJA 18GSA 3C7MA 2LNTA 5CP1A 3PH9A 2VD0A 2PGTA 3ZMLA 1DUGA 1G6YA 2WULA 5IM9A 4MCUA 1SL1B 2CV4A 2F9SA 1Z6NA 2VM2A 4O32A 2CVKA 3EU4A 1PX6A 2LTKA 5IOXA 5LNKe 2L59A 2H30A 4TW5A 2V2GA 2IMFA 2LRCA 4YQUA 4Z7XA 2C3TA 4MP4A 3M1GA 5GSSA 1J9BA 1LU4A 1ZMAA 4AJ7A 3UEMA 4XS1A 3QR6A 3HY2A 2PU9C 3LYPA 3EVIA 4V1Ag 2CA8A 2MYGA 1U3AA 3RDWA 4G0LA 1NSWA 3RPNA 4POLA 6GSSA 1WP0A 4RI7A 5ECKB 2BJXA 1T4YA 1YJ6A 4J2FA 1UVZA 5DDLA 2KP1A 3EMXA 2EIOA 1AW9A 2AAWA 3CYNA 2O87A 4K7IA 3E9JB 1TRUA 4K0GA 4N30A 4G0KA 1EEMA 4LL1B 3FHKA 1DE1A 1PSQA 1ZOFA 1SD8A 2LS5A 1T00A 1YQ1A 4LMWA 1VF1A 4F82A 4OCEA 2PMTA 2OKAA 1EWXA 4ZBAA 1GRXA 4YQMA 1A2LA 1N8JA 1J0FA 1EGRA 2GZZA 3HDCA 2VCQA 5HR1A 5CNWA 1SU9A 4DVCA 3UARA 1A8YA 1BAYA 5ECIB 1GUHA 1Q4JA 2FWFA 2XC2A 4BVYB 1FB0A 2VUPA 2OACA 2PERA 3UVTA 2X8GA 3L78A 4Z2TA 3D0ZA 1GP1A 3C8EA 1X9SB 5D8IA 3CTFA 2X4AA 1THOA 4HOJA 5JCWA 2FY6A 2VD1A 1TJDA 1OC8A 2HRKA 1MDIA 4HU9A 4TOPA 2L5LA 2DIZA 1TI3A 3DKSA 3F0IA 5AGYA 3MAKA 1MD3A 3GA4A 5IOWA 4XHMA 4L0UA 3ZREA 4XS4A 3IAS2 4NV5A 1TTZA 2NPBA 3F4TA 4KA0A 4XRDA 3BCKA 2K6VA 2EIRA 1U6TA 1JLWA 3GUSA 4MMMA 1ERWA 1N2AA 4H86A 4FH8A 4KDXA 3VPTA 1M9AA 3DD3A 3MYDA 1FHEA 2L4CA 4POBA 1AC1A 3CMIA 1QGVA 4ECJA 4IW9A 1YEXA 4G0IA 1TK8B 4WETA 2LUSA 4HS1A 2WB9A 5HQPA 2WDUA 3F9UA 1K0CA 4MZBA 3US3A 1RQMA 4BWQA 5J41A 1GUKA 1R4WA 1S3DA 2H6ZA 2VL9A 2GT6A 2NBSA 4PURA 1X5DA 4OWYA 2I4AA 3F3RA 2C3NA 3I69A 4CDOA 4MK3A 4OD7A 1ABAA 5KOWA 2GLRA 1TRVA 4XS4B 2H73A 1WIKA 1Q98A 1TRWA 2LRTA 2K8VA 2YWOA 3KP8A 2B1LA 4IJIA 4OFTA 4BL7A 2H1DA 4OMVA 3GURA 5ECOB 4Z2RA 2OA7A 2ZUPA 2H71A 1A23A 5ECQB 5KN2A 3IPZA 5J5NA 1XWBA 1WJKA 2IL3A 1KBNA 2YZHA 1VRSD 3A3TA 2C8UA 1SD9A 1DSBA 2IPAA 3W8JA 1F37A 2LKUA 3HVVA 3QAVA 3QAGA 1QUWA 1HD2A 1R26A 5KN3A 1WWJA 4F2IA 3TJKA 3HZ4A 2C0DA 3F4RA 1EEJA 3UVHA 4ULXA 1XW9A 3TB2A 1WE0A 3LJRA 2R0GA 3ME7A 2A2PA 4K8MA 2PVOC 3TJBA 2DKHA 5C00A 4ZBBA 4V2NA 2IFQB 4TRXA 4MNNA 5CRDA 2C4JA 2K18A 4HDEA 4X4JA 4I8BA 4NHZA 1K0DA 1GTUA 2AHEA 1TP9A 3FEUA 4X1UA 2XHFA 4G9HA 3ZLPA 3UOMA 3L0HA 2GQLA 17GSA 1ZCPA 1EZKA 3GTUA 2H19A 3IRAA 3LYKA 2LV3A 1O85A 4FYCA 2TRXA 4MDCA 4IJ3A 5IMFA 5BMUA 1A2MA 3CBUA 2BMXA 2JADA 5IPGA 3KGKA 5G5EA 2M80A 3LXTA 2DSAA 2H70A 1O8XA 2CAQA 3DMLA 3HJPA 4N0VA 1E6BA 4MF5A 3G9BA 1SL2B 2VLTA 3IAM2 2YPMA 4MF6A 4BPYA 3NOFA 1ZL9A 3R3EA 3KH9A 1AQVA 1OAZA 2H66A 5JCGA 5G31A 3E3EA 2HSYA 2R2JA 4D73B 3QAWA 4ZB6A 1IYIA 2E0QA 2F3MA 4ZIJA 8GSSA 1K0OA 2O7KA 1GUMA 2FCHA 6GSXA 2B1KA 3GL5A 3MIXA 2OBIA 3F6FA 2OJLA 4V2MA 5HFIA 1GTBA 2LNSA 5HR2A 5CAXA 2EC4A 3QDNA 1ERUA 1FB6A 3TOTA 1XBSA 4N11A 2V32A 2WZ9A 1XIYA 3LG6A 2RIIA 2A2RA 3F63A 5IPHA 2IMDA 5B8AA 1T8EB 2WRTA 3IHQA 3WGDA 2C1YA 1OC9A 4N0ZA 4HZ2A 2A2SA 1AUCA 2FGXA 4DSSB 2B3SA 1GSDA 1Z7RA 1W89A 4TR4A 5B6MA 2C0FA 1RW1A 3ZVJD 2GQMA 3LORA 2GGTA 5G5FA 1GNEA 4MZCA 1EV9A 2GTUA 3FZ4A 4KCEA 2F51A 2X49A 1BG5A 1F2EA 1W4VA 2YANA 1S3AA 4GLTA 3IDVA 4KNDA 1XW6A 1LJRA 12GSA 2JSZA 3SBCA 5INYA 1SK2A 1XWAA 1TW9A 2LJRA 2MMAA 3A2VA 3DVXA 5F8BA 2NVLA 4ECBA 2VCTA 5D93A 1XWGA 1USBA 3VK9A 4Q5RA 3FZ9A 3D6IA 1B9YC 5ECMB 3H93A 5J3RA 3EC3A 1PN9A 5DCHA 2HRNA 2DJKA 3G7YA 2VO4A 3UAPA 3IBHA 5J9BA 2QGVA 5E4WA 3KJYA 3TKPA 4RI6A 4WBRD 3G7JA 2YJHA 3IC8A 4HJMA 5IMCA 1UA5A 2X8CA 5B6NA 4KX4A 1KEBA 4WXTA 1V9WA 4PQIA 4RUVA 3UIWA 5HR0A 1SKSB 1PX7A 3A5WA 6GSVA 3ERGA 3FZAA 5FHIA 1YZXA 2ZNMA 2C80A 1PL1A 4HQZA 4DSQA 4MJEA 3VWUA 1X9WB 4ICYA 3H8QA 3FY7A 2H76A 4YKFA 2GSSA 3A2WA 2F8AA 1GLPA 2KHPA 3H79A 3LGCA 4J57E 5GZZB 5JWOB 2O8VB 2I9HA 2GZYA 4OCFA 4TVEA 3VWXA 1SENA 4BVYA 1R7HA 1I5GA 4ECIA 4L8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF2 A;  4IBP A;  1GSE A;  1B8X A;  1GTI A;  3GX0 A;  2REM A;  3HYP A;  3ZL5 A;  2H72 A;  7GSS A;  3Q6O A;  4IHU A;  4KDY A;  2N5A A;  3EUR A;  2PVQ A;  3GYK A;  3UL3 A;  2WCI A;  3KP9 A;  1TI1 A;  3E0U A;  3FRC A;  2GT5 A;  2J9H A;  5G1K A;  5HR3 A;  4FYU A;  1XW5 A;  3WT1 A;  2L4Q A;  2PUK C;  4ZB8 A;  3ISO A;  3KMN A;  1ON4 A;  1ML6 A;  5IQY A;  1K0B A;  4XTS A;  4ZL8 A;  2HT9 A;  5IMA A;  4BA7 A;  3GN3 A;  4ZL7 A;  5F0G A;  2D2Z A;  4MH2 A;  3IC4 A;  2CX4 A;  4QL9 A;  3TJG A;  4EE0 A;  1TK5 B;  2CZ3 A;  5IIZ A;  4FO5 A;  1DBY A;  2YV7 A;  3MWH A;  3GKX A;  2WS2 A;  1HYU A;  1A24 A;  3LSZ A;  1GSY A;  5IO2 A;  3MDK A;  4KGI A;  5ECH B;  3FR3 A;  2E2M A;  3CXG A;  1FAA A;  5D9V A;  2YCD A;  4I2U A;  5ECP B;  1XOB A;  2G2Q A;  2V6K A;  3GH6 A;  4TR0 A;  2DC5 A;  10GS A;  1X5E A;  3D4M A;  3KTL A;  3RHB A;  2R4V A;  1O6J A;  1KTE A;  4I6X A;  3G7I A;  4OO5 A;  2H1G A;  3F3Q A;  4DSR A;  4TXV A;  3U6V A;  2B5Y A;  1PKZ A;  4GRF A;  3VFI A;  2NDO A;  3IK7 A;  3VLN A;  4TR1 B;  1ERV A;  1NM3 A;  2H6Y A;  1ERT A;  3UBL A;  2X64 A;  4V1A p;  4KSO A;  4MJA A;  2MBS A;  3EWL A;  1UN2 A;  5F05 A;  1MDK A;  3GHA A;  2V41 A;  4JRR A;  2H75 A;  3Q19 A;  5F06 A;  4MPF A;  1YF0 A;  5KN1 A;  5IMV A;  3M0F A;  3GKN A;  4QL7 A;  1YF1 A;  1QXH A;  2HRF A;  3O6T A;  1UC7 A;  3WD6 A;  1BQ7 A;  5EY6 A;  2FA4 A;  2LEG A;  2B6M A;  2H1A A;  4G2E A;  4J56 E;  5A4V A;  3IOS A;  5H5Q A;  4MA9 A;  5HFG A;  2I1U A;  2GSQ A;  1BJX A;  1TK0 B;  3APO A;  3WGX A;  2C3Q A;  1URM A;  3NIV A;  3S9F A;  6GSU A;  3HHV A;  1B9X C;  2R3X A;  1H75 A;  2IFQ A;  3ZFL A;  5JCU A;  3APS A;  3D22 A;  2EIQ A;  1SL0 B;  4XIH A;  3DIE A;  3C1S A;  1HNC A;  6GSY A;  3TRP A;  2L5O A;  3KH7 A;  1OE7 A;  1I9D A;  2YN1 A;  1XCC A;  3L9U A;  2VL2 C;  4K9Z A;  4TXO B;  3H4K A;  4MH3 A;  3IV4 A;  1V57 A;  2GDR A;  3OR5 A;  5J9C A;  2V1M A;  3KCM A;  6GSW A;  1F3A A;  4ACS A;  2L6C A;  4WKW A;  5B7C A;  5A4U A;  1R5P A;  4ID0 A;  1YKA A;  3KEB A;  5DAK B;  3ZMK A;  3TJJ A;  4KH7 A;  3KMO A;  2OBK A;  5CYY A;  5C04 A;  4AGS A;  3HCZ A;  1GNW A;  2FUG 2;  5DAL B;  3GMF A;  1PRX A;  2JZS A;  4OFM A;  1TRS A;  4L5L A;  4PX1 A;  2ALB A;  2DML A;  4HJ2 A;  2P5Q A;  2H0I A;  1B4P A;  2HSH A;  5GAN D;  4KAE A;  1ST9 A;  2FWH A;  1M99 A;  3HXS A;  2GS3 A;  3BBY A;  1Y6E A;  4E8H A;  1JLV A;  3TOU A;  1FVJ A;  1ZGN A;  2TRC P;  4D73 A;  2HFD A;  1NW2 A;  5AIS A;  2E7P A;  1VF3 A;  4AF2 A;  4MLY A;  4EKZ A;  3ME8 A;  3HKR A;  4OFN A;  4NHW A;  1OC3 A;  13GS A;  1O81 A;  2MMZ A;  4ZB9 A;  1OKD A;  3C1R A;  2VL2 A;  3A2X A;  5GAP D;  5D9T A;  5AN1 A;  4ILF A;  2RUE A;  1G0T A;  1TDI A;  4EUY A;  1PGT A;  4WBJ A;  1GTA A;  3Q74 A;  2XBQ A;  4EVM A;  2BTO T;  1FW1 A;  3EE2 A;  2GSR A;  2FD3 A;  1BYE A;  1Z3E A;  1AQX A;  4HI7 A;  2P5R A;  1U87 A;  4X43 A;  4DSS A;  2JL4 A;  2RUF A;  5G30 A;  3LWA A;  1NHY A;  4ZBD A;  3P7X A;  2AUV A;  2OE0 A;  4MF7 A;  2IY2 A;  3KTB A;  4LL4 B;  1VF4 A;  3IE3 A;  1QQ2 A;  1O73 A;  3VWW A;  1GSS A;  2E2G A;  2HZE A;  2HNL A;  2MMN A;  1O7U A;  1ILO A;  1XZO A;  3TKQ A;  1AQW A;  3CTG A;  2GST A;  1T3B A;  2YP6 A;  2H0H A;  1B4Q A;  4GST A;  3I43 A;  3SWL A;  4KDU A;  2PN8 A;  3EMP A;  4EO3 A;  4EXJ A;  4GQF A;  2N5F A;  1V98 A;  2VL3 A;  3RPP A;  3VUR A;  1E2Y A;  3WGE A;  3HJM A;  4ML6 A;  3O76 A;  3QFA C;  1Z6M A;  3RAZ A;  3R2Q A;  4FYB A;  1F6M C;  2YWN A;  2B5X A;  2DJ3 A;  4PQ1 A;  3CSH A;  5H5R A;  2DJ2 A;  4GSS A;  2JSY A;  2JAC A;  3LQ7 A;  3VWV A;  2NTO A;  2L57 A;  4LMV A;  2CVD A;  4AJ8 A;  3LEF A;  2CQ9 A;  4WR5 A;  5EL8 A;  3HJO A;  3L9S A;  5ECS A;  1JZW A;  1A0F A;  2DBC A;  1JZR A;  5ELG A;  3QPM A;  2X99 A;  3F8U A;  2LRN A;  2HZE B;  2P0G A;  4ISD A;  5IO0 A;  1JZD A;  4K1F A;  1Z9H A;  4LLR A;  3N5O A;  1B48 A;  4IP1 A;  2O89 A;  1XWK A;  4JR4 A;  1MEK A;  4WEY A;  3P90 A;  1WPI A;  5DCG A;  4IKH A;  5L71 A;  2KOK A;  5F07 A;  2OAD A;  3CRU A;  1FOV A;  2VCX A;  1XPV A;  1YDK A;  1X9M B;  2P31 A;  3ZRD A;  2RLI A;  3M9J A;  5ECL B;  2H1B A;  3HD5 A;  6GST A;  3NZN A;  4I97 A;  1XFL A;  2MZC A;  2AV4 A;  3IR4 A;  1EV4 A;  4TN8 A;  1GLQ A;  3EU3 A;  2CAI A;  3UBK A;  1F3B A;  4Q5N A;  2K8S A;  1HNA A;  1DE2 A;  1JZO A;  2VIM A;  4IQ1 A;  3TRX A;  5ENU A;  4JZQ A;  1T7P B;  3TJF A;  3GV1 A;  4K7O A;  2VOC A;  3KD0 A;  3KXO A;  2FA8 A;  3QFB C;  3UJ1 A;  3HVX A;  5DVB A;  3I9V 2;  4IN0 A;  1CQG A;  4PQH A;  4WR4 A;  4F0C A;  4MJB A;  2I81 A;  4L0W A;  4K0N A;  3KM6 A;  5KN0 A;  4O5R A;  1MD4 A;  2VCW A;  3GX8 A;  3FW2 A;  3VI5 A;  1SK0 A;  3DGQ A;  3FR6 A;  4JE1 A;  3HZ8 A;  1T4Z A;  4GXZ A;  4YQV A;  3ZZX A;  4F9Z A;  2YJ7 A;  3ERF A;  2RM5 A;  1PL2 A;  5A4W A;  1SYR A;  2AB6 A;  4O92 A;  3V1W A;  2ES7 A;  1JHB A;  2QC7 A;  4I2T A;  2LQO A;  2J23 A;  2PWJ A;  4CHS A;  2LJA A;  3DVW A;  4HZ4 A;  1FG4 A;  2PPT A;  4QQ7 A;  1ZYE A;  5DJM A;  2HYX A;  2DJJ A;  2DJ0 A;  5IMZ A;  1K3O A;  3DRN A;  3GFK A;  2HXK A;  4IEL A;  5ID2 B;  3TDG A;  3RHC A;  1SKW B;  1YKC A;  1THX A;  2LQQ A;  3QD9 A;  1GH2 A;  1M9B A;  14GS A;  1M2A A;  1VGL A;  1M2B A;  5GST A;  3QOU A;  2CZ2 A;  1XVW A;  3ZYW A;  4NWY A;  2VAF A;  2IN3 A;  2IIY A;  3BD2 A;  3M3M A;  2ON5 A;  2H0G A;  3APQ A;  3FR9 A;  2XPE A;  1KNG A;  4NMU A;  4MAB A;  4TR1 A;  1GSU A;  2M46 A;  5CRE A;  4F0B A;  1TXX A;  3JCM L;  1R5A A;  1SJZ A;  5JWR B;  1K0M A;  4ML1 A;  3WYW A;  1SYX A;  2VLV A;  3O3T A;  3TCO A;  3ZIT A;  2I3Y A;  2V6O A;  1WRY A;  3J7Y k;  1FO5 A;  4JU5 A;  2B5E A;  5A5K A;  4EDZ A;  3ZFB A;  4ZIL A;  3GIX A;  3C73 A;  4NPB A;  5ECN B;  2H74 A;  3KZQ A;  3N9J A;  4GF0 A;  1OKT A;  4POM A;  3LFL A;  4PGT A;  1OVN A;  2XBI A;  5D96 A;  1QFN A;  4TR3 A;  3ZIV A;  3J7Y b;  2WFC A;  1ZZY A;  3H1N A;  3BJ5 A;  4WF5 A;  5G2Z A;  3DEX A;  1ACV A;  2HLS A;  4NXI A;  1TKD B;  4KB3 A;  1G7E A;  4GWR A;  3GKM A;  1M0U A;  5LCZ A;  4KW6 A;  2YZU A;  20GS A;  3HVS A;  4IP6 A;  1JFU A;  4RQR A;  4TXO A;  4PNF A;  2GQK A;  3W6G A;  1Y25 A;  3CSJ A;  5ECR B;  4IVF A;  4BVX A;  4HQS A;  1LBK A;  3ZIJ A;  2YNX A;  3PR8 A;  1U3I A;  4YAV A;  2IMK A;  4ZL9 A;  3GNJ A;  5DAK A;  3GSS A;  1FVK A;  1AAZ A;  2HE3 A;  3TKS C;  1SKR B;  3LXZ A;  5DAL A;  1AXD A;  1RK4 A;  1TOF A;  1WMJ A;  3FYG A;  4EC0 A;  1TU8 A;  4KCA A;  3P2A A;  4EDY A;  2ZCT A;  2IME A;  3P8W A;  1EP7 A;  1OYJ A;  1S3C A;  3CSI A;  3D21 A;  3TKS E;  2F8F A;  4POK A;  2N5B A;  4EF0 A;  2H8L A;  2H6X A;  3VI7 A;  2OE3 A;  1A0R P;  1A2J A;  3DXB A;  4IQA A;  2DJ1 A;  5IMD A;  5LD0 A;  4PUF C;  3GKK A;  3HA9 A;  2RM6 A;  1C72 A;  1XWC A;  3D4T A;  3BCI A;  1K3Y A;  4MJC A;  3EIN A;  2FHE A;  2JZR A;  4CW9 A;  4PXO A;  3W8S A;  1V2A A;  5ELA A;  1OE8 A;  2DIY A;  3FK8 A;  1GSQ A;  5CRG A;  4I5Q A;  1HQO A;  5ABR A;  5D9X A;  1EGO A;  2L6D A;  2QSI A;  4NAX A;  1TU7 A;  2A4V A;  4GSN A;  3IK9 A;  2VLU A;  3QMX A;  5FWG A;  4HEA 2;  1V58 A;  2PBJ A;  3TKS A;  2LJK A;  4KUN A;  1GUL A;  4BWS A;  2VM1 A;  1EP8 A;  5AIV A;  5H5S A;  4TKY A;  5E59 A;  4DEJ A;  5DJL A;  2YWM A;  2FLS A;  4KSM A;  1HNB A;  5DBQ A;  3GL3 A;  3F4S A;  1X5C A;  4XRA A;  3K8N A;  4K6X A;  1EOH A;  5D73 A;  5CRW A;  2LST A;  2CX3 A;  5CO3 A;  2FNO A;  4MZW A;  5JWQ B;  1M2D A;  1BED A;  5AIX A;  4P3Y B;  4E8E A;  4Q5F A;  3MNG A;  5G1L A;  2FWG A;  4HUA A;  3RBT A;  4HU7 A;  1AIU A;  1G7O A;  1PKW A;  1U88 A;  1G6W A;  2R37 A;  1V40 A;  1X0R A;  3L4N A;  3DWV A;  1YEP A;  2C0G A;  5COH A;  4IS0 A;  1PD2 1;  1BX9 A;  2JU5 A;  3TRQ A;  2DMM A;  3KIJ A;  1XOA A;  1SJI A;  1T1V A;  3IA1 A;  5CRH A;  2YOI A;  2M72 A;  1Z7P A;  2DLX A;  4JED A;  1ZYQ B;  3TKR A;  3CRT A;  4YH2 A;  5HFK A;  4V2L A;  1GSF A;  2B7J A;  3GST A;  3ED3 A;  3QCP A;  5EPF A;  2GVP A;  2VCZ A;  3ERW A;  4ECC A;  3M9K A;  4PNG A;  1O8W A;  4AJ6 A;  3TGZ A;  2VCV A;  4G19 A;  5B8B A;  3ZVJ A;  1K3L A;  2WJU A;  4XS6 A;  4MPG A;  2CT6 A;  4WF4 A;  2GZP A;  4RQX A;  3U5R E;  4GTU A;  2QKE A;  5DQS A;  3GH9 A;  1PA3 A;  3PGT A;  3L9V A;  1SK1 A;  2ON7 A;  2IMI A;  2IYJ A;  2YV9 A;  3AY8 A;  1QK8 A;  1YY7 A;  4N10 A;  1XXU A;  1J08 A;  2HI7 A;  4NV2 A;  3D5J A;  3EYT A;  4EL1 A;  1A8L A;  3TUE A;  2G0F A;  2AYT A;  3GTU B;  3F6D A;  3ZTL A;  5FT3 A;  5KEJ A;  16GS A;  2JZT A;  4YAP A;  1EOG A;  2CVB A;  4GCI A;  1WOU A;  2KLX A;  2MBT A;  2TIR A;  1PQN A;  2WGR A;  4XCS A;  1SJ6 A;  3VPQ A;  1PMT A;  4LA1 A;  4ZXG A;  1M7T A;  1CQH A;  5J4U A;  1QMV A;  4L5O A;  3FKF A;  2R5G A;  2YWI A;  4F03 A;  1K0A A;  2C0E A;  1GWC A;  1IYH A;  2XPD A;  4OO4 A;  2IJY A;  4G10 A;  3IXR A;  5EVO A;  3WT2 A;  2OE1 A;  4FIW A;  5DQY A;  4K2D A;  1H4O A;  2AJQ B;  1GL8 A;  19GS A;  3DYR A;  2R6K A;  11GS A;  4GQC A;  4PUA A;  3BOA A;  3PIN A;  1F9M A;  4K7N A;  1NHO A;  4JBB A;  3Q18 A;  3I6A A;  3UMA A;  2O85 A;  2MMO A;  4X0X A;  1MDJ A;  2HZF A;  2X8H A;  1Z5Y E;  5D9W A;  2Z9S A;  2B7K A;  3GRX A;  4KE3 A;  1XVQ A;  4O7H A;  3C71 A;  3MSZ A;  5ID2 A;  1OC9 B;  3M8N A;  2KUC A;  2KP2 A;  1MTC A;  4Q5Q A;  22GS A;  2K9F A;  3FZ5 A;  1K0N A;  2IWT A;  9GSS A;  4JR6 A;  2FWE A;  2H01 A;  4IGJ A;  18GS A;  3C7M A;  2LNT A;  5CP1 A;  3PH9 A;  2VD0 A;  2PGT A;  3ZML A;  1DUG A;  1G6Y A;  2WUL A;  5IM9 A;  4MCU A;  1SL1 B;  2CV4 A;  2F9S A;  1Z6N A;  2VM2 A;  4O32 A;  2CVK A;  3EU4 A;  1PX6 A;  2LTK A;  5IOX A;  5LNK e;  2L59 A;  2H30 A;  4TW5 A;  2V2G A;  2IMF A;  2LRC A;  4YQU A;  4Z7X A;  2C3T A;  4MP4 A;  3M1G A;  5GSS A;  1J9B A;  1LU4 A;  1ZMA A;  4AJ7 A;  3UEM A;  4XS1 A;  3QR6 A;  3HY2 A;  2PU9 C;  3LYP A;  3EVI A;  4V1A g;  2CA8 A;  2MYG A;  1U3A A;  3RDW A;  1NSW A;  3RPN A;  4POL A;  6GSS A;  1WP0 A;  4RI7 A;  5ECK B;  2BJX A;  1T4Y A;  1YJ6 A;  4J2F A;  1UVZ A;  5DDL A;  2KP1 A;  3EMX A;  2EIO A;  1AW9 A;  2AAW A;  3CYN A;  2O87 A;  4K7I A;  3E9J B;  1TRU A;  4K0G A;  4N30 A;  1EEM A;  4LL1 B;  3FHK A;  1DE1 A;  1PSQ A;  1ZOF A;  1SD8 A;  2LS5 A;  1T00 A;  1YQ1 A;  4LMW A;  1VF1 A;  4F82 A;  4OCE A;  2PMT A;  2OKA A;  1EWX A;  4ZBA A;  1GRX A;  4YQM A;  1A2L A;  1N8J A;  1J0F A;  1EGR A;  2GZZ A;  3HDC A;  2VCQ A;  5HR1 A;  5CNW A;  1SU9 A;  4DVC A;  3UAR A;  1A8Y A;  1BAY A;  5ECI B;  1GUH A;  1Q4J A;  2FWF A;  2XC2 A;  1FB0 A;  2VUP A;  2OAC A;  2PER A;  3UVT A;  2X8G A;  3L78 A;  3D0Z A;  1GP1 A;  3C8E A;  1X9S B;  5D8I A;  3CTF A;  1THO A;  4HOJ A;  5JCW A;  2FY6 A;  2VD1 A;  1TJD A;  1OC8 A;  1MDI A;  4HU9 A;  4TOP A;  2L5L A;  2DIZ A;  1TI3 A;  3DKS A;  3F0I A;  5AGY A;  3MAK A;  1MD3 A;  3GA4 A;  5IOW A;  4XHM A;  4L0U A;  3ZRE A;  4XS4 A;  3IAS 2;  4NV5 A;  1TTZ A;  2NPB A;  3F4T A;  4KA0 A;  4XRD A;  3BCK A;  2K6V A;  2EIR A;  1U6T A;  1JLW A;  3GUS A;  4MMM A;  1ERW A;  1N2A A;  4H86 A;  4FH8 A;  4KDX A;  3VPT A;  1M9A A;  3DD3 A;  1FHE A;  2L4C A;  4POB A;  1AC1 A;  3CMI A;  1QGV A;  4ECJ A;  4IW9 A;  1YEX A;  1TK8 B;  4WET A;  2LUS A;  4HS1 A;  2WB9 A;  5HQP A;  2WDU A;  3F9U A;  1K0C A;  4MZB A;  3US3 A;  1RQM A;  4BWQ A;  5J41 A;  1GUK A;  1R4W A;  1S3D A;  2H6Z A;  2VL9 A;  2GT6 A;  2NBS A;  4PUR A;  1X5D A;  4OWY A;  2I4A A;  3F3R A;  2C3N A;  3I69 A;  4CDO A;  4MK3 A;  4OD7 A;  1ABA A;  2GLR A;  1TRV A;  4XS4 B;  2H73 A;  1WIK A;  1Q98 A;  1TRW A;  2LRT A;  2K8V A;  2YWO A;  3KP8 A;  2B1L A;  4IJI A;  4OFT A;  4BL7 A;  2H1D A;  4OMV A;  3GUR A;  5ECO B;  2OA7 A;  2ZUP A;  2H71 A;  1A23 A;  5ECQ B;  5KN2 A;  3IPZ A;  5J5N A;  1XWB A;  1WJK A;  2IL3 A;  1KBN A;  2YZH A;  1VRS D;  3A3T A;  2C8U A;  1SD9 A;  1DSB A;  2IPA A;  3W8J A;  1F37 A;  2LKU A;  3HVV A;  3QAV A;  3QAG A;  1QUW A;  1HD2 A;  1R26 A;  5KN3 A;  1WWJ A;  4F2I A;  3TJK A;  3HZ4 A;  2C0D A;  3F4R A;  1EEJ A;  3UVH A;  4ULX A;  1XW9 A;  3TB2 A;  1WE0 A;  3LJR A;  3ME7 A;  4K8M A;  2PVO C;  3TJB A;  5C00 A;  4ZBB A;  4V2N A;  2IFQ B;  4TRX A;  5CRD A;  2C4J A;  2K18 A;  4HDE A;  4I8B A;  4NHZ A;  1K0D A;  1GTU A;  2AHE A;  1TP9 A;  3FEU A;  4X1U A;  2XHF A;  4G9H A;  3ZLP A;  3UOM A;  3L0H A;  2GQL A;  17GS A;  1ZCP A;  1EZK A;  3GTU A;  2H19 A;  3IRA A;  3LYK A;  2LV3 A;  1O85 A;  4FYC A;  2TRX A;  4MDC A;  4IJ3 A;  5IMF A;  1A2M A;  3CBU A;  2BMX A;  2JAD A;  5IPG A;  3KGK A;  5G5E A;  2M80 A;  3LXT A;  2DSA A;  2H70 A;  1O8X A;  2CAQ A;  3DML A;  3HJP A;  4N0V A;  1E6B A;  4MF5 A;  3G9B A;  1SL2 B;  2VLT A;  3IAM 2;  2YPM A;  4MF6 A;  4BPY A;  3NOF A;  1ZL9 A;  3KH9 A;  1AQV A;  1OAZ A;  2H66 A;  5JCG A;  5G31 A;  3E3E A;  2HSY A;  2R2J A;  4D73 B;  3QAW A;  4ZB6 A;  1IYI A;  2E0Q A;  2F3M A;  4ZIJ A;  8GSS A;  1K0O A;  2O7K A;  1GUM A;  2FCH A;  6GSX A;  2B1K A;  3GL5 A;  2OBI A;  3F6F A;  2OJL A;  4V2M A;  5HFI A;  1GTB A;  2LNS A;  5HR2 A;  5CAX A;  2EC4 A;  3QDN A;  1ERU A;  1FB6 A;  3TOT A;  1XBS A;  4N11 A;  2V32 A;  2WZ9 A;  1XIY A;  3LG6 A;  2RII A;  2A2R A;  3F63 A;  5IPH A;  2IMD A;  5B8A A;  1T8E B;  2WRT A;  3IHQ A;  3WGD A;  2C1Y A;  1OC9 A;  4N0Z A;  4HZ2 A;  2A2S A;  1AUC A;  2FGX A;  4DSS B;  2B3S A;  1GSD A;  1Z7R A;  1W89 A;  4TR4 A;  5B6M A;  2C0F A;  1RW1 A;  3ZVJ D;  2GQM A;  3LOR A;  2GGT A;  5G5F A;  1GNE A;  4MZC A;  1EV9 A;  2GTU A;  3FZ4 A;  4KCE A;  2F51 A;  1BG5 A;  1F2E A;  1W4V A;  2YAN A;  1S3A A;  4GLT A;  3IDV A;  4KND A;  1XW6 A;  1LJR A;  12GS A;  2JSZ A;  3SBC A;  5INY A;  1SK2 A;  1XWA A;  1TW9 A;  2LJR A;  2MMA A;  3A2V A;  3DVX A;  5F8B A;  2NVL A;  4ECB A;  2VCT A;  5D93 A;  1XWG A;  1USB A;  3VK9 A;  4Q5R A;  3FZ9 A;  3D6I A;  1B9Y C;  5ECM B;  3H93 A;  5J3R A;  3EC3 A;  1PN9 A;  5DCH A;  2HRN A;  2DJK A;  3G7Y A;  2VO4 A;  3UAP A;  3IBH A;  5J9B A;  2QGV A;  5E4W A;  3KJY A;  3TKP A;  4RI6 A;  4WBR D;  3G7J A;  2YJH A;  4HJM A;  5IMC A;  1UA5 A;  2X8C A;  5B6N A;  4KX4 A;  1KEB A;  4WXT A;  1V9W A;  4PQI A;  4RUV A;  3UIW A;  5HR0 A;  1SKS B;  1PX7 A;  3A5W A;  6GSV A;  3ERG A;  3FZA A;  5FHI A;  1YZX A;  2ZNM A;  2C80 A;  1PL1 A;  4HQZ A;  4DSQ A;  4MJE A;  3VWU A;  1X9W B;  3H8Q A;  3FY7 A;  2H76 A;  2GSS A;  3A2W A;  2F8A A;  1GLP A;  2KHP A;  3H79 A;  3LGC A;  4J57 E;  5GZZ B;  5JWO B;  2O8V B;  2I9H A;  2GZY A;  4OCF A;  4TVE A;  3VWX A;  1SEN A;  4BVY A;  1R7H A;  1I5G A;  4ECI A;  4L8E A; 
#chains in the Genus database with same CATH topology
 1VF2 A;  1SQW A;  4IBP A;  3EHC A;  1GSE A;  1UUG B;  1B8X A;  1IDP A;  1GTI A;  3GX0 A;  2REM A;  1BSD A;  1GMP A;  4J8T A;  7RNT A;  3IHG A;  3HYP A;  3ZL5 A;  1T2H A;  2H72 A;  7GSS A;  3Q6O A;  4IHU A;  4I4K A;  1RTU A;  3G8Z A;  2N5A A;  4KDY A;  2BNG A;  3EUR A;  3EBY A;  4KZ1 A;  2O3O A;  2PVQ A;  2AAD A;  3HVN A;  3GYK A;  3UL3 A;  2WCI A;  3NX0 A;  3KP9 A;  2CFW A;  1TI1 A;  3E0U A;  3FRC A;  1IU7 A;  2GT5 A;  2J9H A;  5G1K A;  1VQ4 3;  5HR3 A;  1E97 A;  3HI7 A;  1I3I A;  4HM4 B;  1XW5 A;  4FYU A;  3WT1 A;  2BMQ B;  3SOY A;  2L4Q A;  1BUJ A;  4H3U A;  2HSM A;  1EA2 A;  2XRX B;  2PUK C;  3HX8 A;  3ISO A;  4ZB8 A;  3KMN A;  1ON4 A;  1ML6 A;  5IQY A;  5EVH A;  3I56 3;  1YJW 3;  1K0B A;  1MWU A;  4XTS A;  4EXR A;  4HKV B;  1CYV A;  4ZL8 A;  3CPO A;  3NV0 A;  3CXC 2;  2HT9 A;  5IMA A;  4BA7 A;  3GN3 A;  4ZL7 A;  5FGO A;  2CK3 H;  5F0G A;  2D2Z A;  4MH2 A;  3IC4 A;  1WMO A;  3PS8 A;  2CX4 A;  3TJG A;  4EE0 A;  4QL9 A;  1TK5 B;  3LXU X;  3IMA B;  3PCR A;  2CZ3 A;  5IIZ A;  5D82 A;  3FG4 A;  4FO5 A;  1DBY A;  3VGN A;  2YV7 A;  3MWH A;  3GKX A;  4N6V 0;  4WYK B;  1F8N A;  2WS2 A;  3UB1 A;  1HYU A;  1A24 A;  1DMN A;  3LSZ A;  1GSY A;  5IO2 A;  3PPU A;  4LEH A;  1V74 A;  3MDK A;  4KGI A;  5ECH B;  1US1 A;  1LOV A;  1I2F A;  2K54 A;  2K3D A;  3FR3 A;  2E2M A;  3CXG A;  1FAA A;  5D9V A;  2YCD A;  2ML6 A;  4I2U A;  5ECP B;  2OCT A;  4ORL A;  4XB5 A;  1XOB A;  2G2Q A;  2V6K A;  1AVK A;  3GH6 A;  5KOX A;  1YI2 3;  2DC5 A;  4TR0 A;  2HMM B;  3G0K A;  1NU3 A;  10GS A;  4KF9 A;  1X5E A;  3D4M A;  1GS3 A;  3KTL A;  1RMS A;  3RHB A;  2R4V A;  1O6J A;  5RNT A;  1KTE A;  2MF7 A;  4I6X A;  3G7I A;  4OO5 A;  2H1G A;  3F3Q A;  4DSR A;  2CIU A;  4TXV A;  3U6V A;  2B5Y A;  1PKZ A;  3DUK A;  4GRF A;  3VFI A;  3E99 A;  2NDO A;  3IK7 A;  3VLN A;  4TR1 B;  3X41 A;  1ERV A;  1NM3 A;  2H6Y A;  1ERT A;  2Z7A A;  3UBL A;  1AQZ A;  2X64 A;  1A90 A;  4V1A p;  1K73 4;  4WHA A;  4KSO A;  5CLK A;  4MJA A;  3MKI A;  2MBS A;  3EWL A;  1UN2 A;  3U1W A;  5F05 A;  1MDK A;  3GHA A;  2V41 A;  4DKI A;  3J7Y d;  4JRR A;  1OGX A;  2H75 A;  3Q19 A;  1B2U A;  4X2H A;  4BIR A;  1TFK A;  3FG1 A;  5F06 A;  4MPF A;  1YF0 A;  1JKG B;  5KN1 A;  5IMV A;  4RNY A;  3M0F A;  3GKN A;  2QEX 3;  4QL7 A;  1YF1 A;  1QXH A;  2HRF A;  4O2H A;  1UC7 A;  3O6T A;  3WD6 A;  2MC8 A;  1BQ7 A;  5EY6 A;  1NJI 4;  5AYS C;  3LZA A;  4GL6 A;  2FA4 A;  3UJM A;  2LEG A;  1FUS A;  2B6M A;  2H1A A;  4K2X A;  4G2E A;  4J56 E;  5IF6 A;  2IMJ A;  5A4V A;  1W6C A;  3IOS A;  2QGU A;  5H5Q A;  2UZ8 A;  1K9M 4;  1OH0 A;  2BU4 A;  4MA9 A;  3FCS B;  4XBT A;  5HFG A;  5HOH A;  2DKI A;  1BUQ A;  2I1U A;  2GSQ A;  1BJX A;  1TK0 B;  3APO A;  3WGX A;  1DVC A;  2JDI H;  4KFE A;  1URM A;  2C3Q A;  1RNT A;  3NIV A;  3S9F A;  6GSU A;  3HHV A;  1B9X C;  2R3X A;  1H75 A;  2IFQ A;  1WNH A;  3CQF A;  3ZFL A;  5JCU A;  3APS A;  3D22 A;  4BIK A;  1ISK A;  1RCK A;  1OCV A;  2EIQ A;  1SL0 B;  4XIH A;  3DIE A;  3C1S A;  4ZM8 A;  1HNC A;  4IIA A;  6GSY A;  3TRP A;  2HMO B;  2L5O A;  1KSI A;  3KH7 A;  5GSP A;  1IT7 A;  1OE7 A;  2CX0 A;  1I9D A;  2YN1 A;  1XCC A;  3L9U A;  5AEU B;  3G4S 3;  3G71 3;  2VL2 C;  4K9Z A;  4TXO B;  4LZI A;  3H4K A;  4MH3 A;  3IV4 A;  1V57 A;  3URP A;  2XSH B;  2GDR A;  4BVX B;  3D5I A;  4J5K A;  3OR5 A;  5J9C A;  3LTA A;  2V1M A;  3KCM A;  6GSW A;  3V92 A;  5BRT A;  2KRT A;  1F3A A;  4ACS A;  2L6C A;  3DZL A;  4WKW A;  3SYU A;  1CYU A;  3O8Y A;  5B7C A;  5A4U A;  1R5P A;  4ID0 A;  1WMN A;  1YKA A;  1EKM A;  3KEB A;  1ZX2 A;  3V99 A;  5DAK B;  4MMZ B;  3ZMK A;  3TJJ A;  4L7K A;  4KH7 A;  3KMO A;  2C10 A;  2CFG A;  2V1L A;  2OBK A;  5CYY A;  5C04 A;  3AHS A;  1VQ7 3;  4AGS A;  2JQ5 A;  3HCZ A;  1GNW A;  2FUG 2;  5AI1 A;  1M3J A;  5DAL B;  4HVN A;  3GMF A;  1PRX A;  2JZS A;  2ZHX B;  4OFM A;  1TRS A;  4L5L A;  2ZA4 A;  4PX1 A;  2ALB A;  2DML A;  1VQN 3;  4HJ2 A;  2P5Q A;  3WOE B;  4MJD A;  2H0I A;  1B4P A;  2HSH A;  5GAN D;  4KAE A;  1ST9 A;  2FWH A;  2RCD A;  1M99 A;  3HXS A;  2GS3 A;  3BBY A;  1Y6E A;  2FXT A;  4E8H A;  4OUQ A;  1JLV A;  3TOU A;  1FVJ A;  1ZGN A;  2TRC P;  4D73 A;  1VQO 3;  3CC4 3;  2HFD A;  1NW2 A;  4EW5 A;  5AIS A;  2E7P A;  1VF3 A;  3OX9 A;  4AF2 A;  4MLY A;  4EKZ A;  3ME8 A;  1M3I A;  1TRP A;  3HKR A;  4HAA A;  4OFN A;  4NHW A;  1OC3 A;  3KSP A;  13GS A;  1O81 A;  2MMZ A;  4EBG A;  4ZB9 A;  1OKD A;  1ZYP A;  1GD3 A;  3C1R A;  2VL2 A;  3A2X A;  5GAP D;  3DY5 A;  4L8O A;  5D9T A;  5AN1 A;  4ILF A;  2RUE A;  2C4B A;  4RNT A;  1G0T A;  2YFL B;  1TDI A;  4EUY A;  1GMQ A;  2L1S A;  1PGT A;  2O9U X;  2XGN A;  3DGY A;  1FOH A;  1FW7 A;  4WBJ A;  1GTA A;  3Q74 A;  2XBQ A;  5BXQ A;  1YGW A;  4EVM A;  1VQK 3;  1B21 A;  3GZX B;  1GSP A;  2BTO T;  4CY6 A;  1BRI A;  5IEP A;  1FW1 A;  3EE2 A;  2CX1 A;  2GSR A;  2FD3 A;  2XFS A;  1IK3 A;  1BYE A;  4BL3 A;  1Z3E A;  2D42 A;  1O7H B;  1I8V A;  1AQX A;  2KF4 A;  2C11 A;  4HI7 A;  2P5R A;  1U87 A;  3F8X A;  4X43 A;  4DSS A;  4L8P A;  2JL4 A;  2RUF A;  3S67 A;  3LWA A;  5G30 A;  1NHY A;  3LW9 A;  4WP5 A;  4ZBD A;  3A76 A;  3P7X A;  2AUV A;  2OE0 A;  4MF7 A;  2IY2 A;  3KTB A;  2R0C A;  4LL4 B;  1VF4 A;  3IE3 A;  1OGZ A;  3FF0 A;  1QQ2 A;  1O73 A;  3VWW A;  1GSS A;  1GD4 A;  2E2G A;  3SVA A;  1NB3 I;  2HZE A;  2HNL A;  2MMN A;  1O7U A;  4R9K A;  1ILO A;  1XZO A;  3TKQ A;  1GOU A;  4LSO A;  1W4N A;  1AQW A;  3CTG A;  2GST A;  4RZM A;  4TX4 A;  1T3B A;  2YP6 A;  2H0H A;  1B4Q A;  4GST A;  3I43 A;  3SWL A;  4KDU A;  1OUN A;  2PN8 A;  3EMP A;  4EO3 A;  4EXJ A;  4GQF A;  5AII A;  3AMO A;  1DMQ A;  2N5F A;  1YGE A;  1V98 A;  2VL3 A;  3RPP A;  3VUR A;  3WR2 A;  1W7C A;  1E2Y A;  2BMO B;  3WGE A;  3HJM A;  3QFA C;  2R0P A;  4N6U A;  3O76 A;  1Z6M A;  4ML6 A;  3JUP A;  5IEN A;  3R2Q A;  1S72 3;  3RAZ A;  4FYB A;  1F6M C;  3GZY B;  6GSP A;  2YWN A;  2XF3 A;  2B5X A;  1RRL A;  2DJ3 A;  1UI7 A;  4PQ1 A;  3CSH A;  4K5S A;  5H5R A;  2FNQ A;  1CH0 A;  2DJ2 A;  4GSS A;  3GZB A;  2JSY A;  2JAC A;  2P0X A;  2R4I A;  1YHQ 3;  3LQ7 A;  1TRQ A;  2NTO A;  3VWV A;  1FYS A;  2L57 A;  4LMV A;  2CVD A;  4AJ8 A;  5JPU A;  1EG9 B;  4JRF A;  3KFQ C;  2GSP A;  3LEF A;  2CQ9 A;  3T8U A;  4WR5 A;  5EL8 A;  3HJO A;  4HOH A;  3L9S A;  5ECS A;  3PGB A;  1JZW A;  3FZW A;  1A0F A;  2DBC A;  3PZW A;  1JZR A;  1BRH A;  1MWR A;  1R4Y A;  5ELG A;  3QPM A;  2X99 A;  3F8U A;  2LRN A;  2HZE B;  2P0G A;  4O5U A;  3KSE D;  1RJO A;  4ISD A;  4XDV A;  5IO0 A;  1JZD A;  4K1F A;  1Z9H A;  4LLR A;  1VQP 3;  1STF I;  3N5O A;  5IW9 A;  1B48 A;  2Z6B A;  4IP1 A;  4FR9 A;  2O89 A;  3MG2 A;  5KP4 A;  1XWK A;  5AYR B;  5KP3 A;  3AMO B;  4JR4 A;  2GBX B;  1MEK A;  4WEY A;  7STD A;  3P90 A;  4USS A;  1WPI A;  2HMK B;  5DCG A;  4IKH A;  3MG1 A;  3CCR 3;  5L71 A;  1TP6 A;  2KOK A;  5F07 A;  4EC6 A;  2OAD A;  1Q42 A;  3CRU A;  1FOV A;  5KP1 A;  2VCX A;  1XPV A;  5D83 A;  1YDK A;  1X9M B;  2P31 A;  3ZRD A;  2RLI A;  3M9J A;  1KC8 4;  5ECL B;  2H1B A;  3D79 A;  3HD5 A;  6GST A;  3NZN A;  5TGN A;  3A5E A;  3CME 3;  8CHO A;  4I97 A;  3CCJ 3;  1XFL A;  2MZC A;  1EQK A;  2AV4 A;  3IR4 A;  1EV4 A;  4TN8 A;  1GLQ A;  1UCI A;  3EU3 A;  2CAI A;  1QAK A;  1U5O A;  3UBK A;  1F3B A;  3G16 A;  1M90 4;  3EPT A;  4Q5N A;  3X3Y A;  4O5Q A;  1NWW A;  2K8S A;  1HNA A;  1DE2 A;  1JZO A;  2VIM A;  3DXO A;  4IQ1 A;  3MWZ A;  3TRX A;  1FGQ A;  5ENU A;  2F5W A;  4JZQ A;  3JUM A;  1T7P B;  3TJF A;  3GV1 A;  4K7O A;  1BSA A;  2VOC A;  2Z77 A;  3KD0 A;  3KXO A;  3Q90 A;  3CC2 3;  2FA8 A;  1GY6 A;  3QFB C;  3UJ1 A;  3HVX A;  5DVB A;  3I9V 2;  4IN0 A;  1CQG A;  4PQH A;  4WR4 A;  1FUT A;  1X1X A;  4F0C A;  4MJB A;  2I81 A;  4L0W A;  4K0N A;  3KM6 A;  5KN0 A;  1O7G B;  4O5R A;  3DGL A;  1MD4 A;  2VCW A;  3GX8 A;  3FW2 A;  3VI5 A;  3LT9 A;  3GWR A;  2CG0 A;  1SK0 A;  4CCV A;  3DGQ A;  1N9J A;  4R80 A;  3FR6 A;  4JE1 A;  3HZ8 A;  1T4Z A;  4GXZ A;  1RDS A;  4YQV A;  3ZZX A;  1OAC A;  4F9Z A;  5EQL A;  4RNZ A;  3K63 A;  3AGN A;  2YJ7 A;  3ERF A;  2RM5 A;  1PL2 A;  5A4W A;  3S5C A;  1RGH A;  1SYR A;  3K7C A;  2AB6 A;  4O92 A;  3MSO A;  3UL6 A;  3V1W A;  2ES7 A;  3RDE A;  1JHB A;  2QC7 A;  4FMA A;  4IT7 A;  3FGY A;  4I2T A;  4HJL B;  4HM8 B;  2LQO A;  2J23 A;  2PWJ A;  4CHS A;  2LJA A;  3DVW A;  4MMY B;  4HZ4 A;  4WYK A;  1FG4 A;  2PPT A;  4QQ7 A;  1ZS7 A;  1ZYE A;  4XDW A;  5DJM A;  2HYX A;  3DM8 A;  2DJJ A;  2DJ0 A;  5IMZ A;  2HRA A;  1K3O A;  3DRN A;  3GFK A;  2HXK A;  1IQY A;  4IEL A;  5ID2 B;  3CMA 3;  3D5G A;  3TDG A;  2BHM A;  3RHC A;  1SKW B;  4A5P A;  1YKC A;  1THX A;  2LQQ A;  3QD9 A;  1GH2 A;  1M9B A;  3FLJ A;  14GS A;  3LH4 A;  1M2A A;  1VGL A;  1M2B A;  5GST A;  4BTY A;  3QOU A;  2CZ2 A;  1XVW A;  1GY7 A;  3ZYW A;  4NWY A;  2VAF A;  1JJ2 2;  2IN3 A;  1K41 A;  1TU5 A;  2IIY A;  3NHX A;  1M9G A;  3BD2 A;  3M3M A;  2ON5 A;  1WTH A;  2H0G A;  3APQ A;  3FR9 A;  2XPE A;  4YKG A;  1KNG A;  4NMU A;  3LT8 A;  4MAB A;  4TR1 A;  1TTO A;  2CG1 A;  1I3F A;  3STD A;  1GSU A;  1MWT A;  2F4Y A;  4KFD A;  2M46 A;  5CRE A;  4F0B A;  5JBS A;  1BIR A;  1C7H A;  3D4A A;  1TXX A;  3JCM L;  1R5A A;  1DE3 A;  1SJZ A;  4N6T A;  5JWR B;  1K0M A;  4ML1 A;  3WYW A;  5HGR A;  1SYX A;  2VLV A;  3O3T A;  3TCO A;  3ZIT A;  2I3Y A;  2V6O A;  1WRY A;  3J7Y k;  1FO5 A;  4JU5 A;  2B5E A;  5A5K A;  1JKG A;  1RGE A;  4EDZ A;  1SAR A;  2E2V A;  1N8R 4;  3VSY A;  3ZFB A;  2L4V A;  4ZIL A;  3GIX A;  3RNT A;  3C73 A;  1STD A;  2KAA A;  4NPB A;  5ECN B;  2P05 A;  1O7W B;  2H74 A;  3KZQ A;  3N9J A;  4GF0 A;  1OKT A;  4POM A;  5AIF A;  3LFL A;  4PGT A;  4WFO A;  1BSE A;  2GU3 A;  1OVN A;  2M7O A;  2XBI A;  5D96 A;  1QFN A;  3A5I A;  4TR3 A;  3ZIV A;  4N3V A;  3J7Y b;  2WFC A;  3H51 A;  1ZZY A;  3BJ5 A;  1BAN A;  3H1N A;  3JVC A;  1MGR A;  4EIP A;  1SII A;  4WF5 A;  5G2Z A;  1BRK A;  3I0Y A;  3DEX A;  1G02 A;  1ACV A;  2HLS A;  4NXI A;  1TKD B;  3I55 3;  4KB3 A;  1G7E A;  3ECF A;  2QA1 A;  4GWR A;  3GKM A;  1M0U A;  3MHE A;  4N6M A;  5LCZ A;  4KW6 A;  2YZU A;  20GS A;  3HVS A;  4IP6 A;  1N9E A;  1JFU A;  4RQR A;  4TXO A;  4PNF A;  2GQK A;  3W6G A;  1Y25 A;  3CSJ A;  5ECR B;  3PYJ A;  4IVF A;  4BVX A;  4Z2U A;  4HQS A;  1LBK A;  3ZIJ A;  1BAO A;  2YNX A;  3PR8 A;  1U3I A;  4YAV A;  5ELJ A;  2IMK A;  3BB9 A;  2RGQ A;  2W0Q A;  4R9L A;  1IVU A;  4FMC A;  3CU3 A;  2GEY A;  4ZL9 A;  2KF6 A;  3GNJ A;  5DAK A;  1YNV X;  4N6L A;  2CFD A;  4HM1 B;  3GSS A;  3MPH A;  5BIR A;  2P0M A;  1FVK A;  1OHO A;  3NUV A;  1AAZ A;  3DMC A;  2HE3 A;  3TKS C;  1SKR B;  3LXZ A;  2B1X B;  2BT3 A;  5DAL A;  1IV9 A;  3Q3F A;  1AXD A;  1O7N B;  1RK4 A;  1TOF A;  4WWU C;  1WMJ A;  3FYG A;  4EC0 A;  1W01 A;  1TU8 A;  2CFL A;  4KCA A;  2F56 A;  3P2A A;  4EDY A;  5FW5 A;  2RFR A;  3V98 A;  4XBY A;  3BLZ A;  5DRV A;  2ZCT A;  1NO3 A;  2IME A;  3P8W A;  1EP7 A;  1OYJ A;  4PTS A;  3EBT A;  1S3C A;  3CSI A;  3D21 A;  3TKS E;  2F8F A;  4POK A;  1J2B A;  1RGA A;  2N5B A;  4EF0 A;  2H8L A;  2H6X A;  3VI7 A;  2OTJ 3;  2OE3 A;  1RHL A;  3WA3 A;  1A0R P;  1A2J A;  4BTW A;  3DXB A;  4IQA A;  2E2U A;  3CPW 2;  2DJ1 A;  5IMD A;  5LD0 A;  5M19 A;  1RRH A;  4PUF C;  3KN4 A;  3T8N A;  3GKK A;  3HA9 A;  2RM6 A;  9RNT A;  1C72 A;  3B7C A;  1XWC A;  3D4T A;  3UL5 A;  3B4O A;  3BCI A;  1K3Y A;  4MJC A;  3EIN A;  2FHE A;  5AIG A;  2JZR A;  4AEQ A;  4CW9 A;  4PXO A;  3EQQ B;  3W8S A;  1V2A A;  3T0U A;  5ELA A;  1OE8 A;  4CY8 A;  2DIY A;  3NBB A;  3FK8 A;  1GSQ A;  1YVS A;  2A15 A;  5CRG A;  3NBJ A;  4I5Q A;  1HQO A;  3Q1C A;  5ABR A;  3WHO A;  5D9X A;  1EGO A;  2L6D A;  2QSI A;  4NAX A;  1PN0 A;  1TU7 A;  2A4V A;  4GSN A;  4XM4 A;  4K5R A;  3IK9 A;  2W9Q A;  2VLU A;  3QMX A;  1W6Y A;  5FWG A;  4HEA 2;  1V58 A;  3GSP A;  3ZG5 A;  2PBJ A;  3TKS A;  2LJK A;  1YJ9 3;  3AHW A;  4KUN A;  1GUL A;  4HM2 B;  4BWS A;  2VM1 A;  1EP8 A;  1UGI A;  1PFO A;  5AIV A;  5H5S A;  2YFI B;  1UUW B;  4TKY A;  5E59 A;  4DEJ A;  5DJL A;  2YWM A;  2FLS A;  1W6G A;  4KSM A;  2XR8 B;  1HNB A;  5DBQ A;  3KCH A;  3GL3 A;  3F4S A;  1X5C A;  4XRA A;  3K8N A;  4K6X A;  1EOH A;  5D73 A;  1LRA A;  5CRW A;  2LST A;  2CX3 A;  5CO3 A;  1BGS A;  2FNO A;  4MZW A;  5JWQ B;  3S28 A;  1M2D A;  1BED A;  3EN8 A;  1FGM A;  5AIX A;  3X3Z A;  1S5A A;  2UX0 A;  4P3Y B;  4E8E A;  4Q5F A;  3MNG A;  5G1L A;  2FWG A;  4HUA A;  3RBT A;  4HU7 A;  1RGF A;  1GMR A;  1RN7 A;  2A4H A;  1MWS A;  1FA3 A;  1AIU A;  3BNE A;  1G7O A;  4LYL B;  1AVL A;  1PKW A;  1U88 A;  1G6W A;  2R37 A;  4FQU A;  4XBX A;  1V40 A;  1X0R A;  3L4N A;  5BVB A;  4BL7 B;  3DWV A;  1YEP A;  2C0G A;  1R4C A;  5COH A;  4IS0 A;  3K0Z A;  1PD2 1;  1BX9 A;  2JU5 A;  3TRQ A;  4HYZ A;  2DMM A;  3KIJ A;  1XOA A;  3HOH A;  1SJI A;  1T1V A;  3MG3 A;  3WA2 X;  3IA1 A;  5CRH A;  2YOI A;  3N9H A;  2M72 A;  1JRQ A;  1Z7P A;  3QRD A;  3DGM A;  2KF5 A;  2DLX A;  1BNI A;  4JED A;  1ZYQ B;  1B27 A;  2Q07 A;  1I2G A;  3TKR A;  3CRT A;  4YH2 A;  1A2K A;  5HFK A;  4V2L A;  1GSF A;  2B7J A;  2GU1 A;  1QAF A;  3GST A;  1UCL A;  3ED3 A;  3QCP A;  2LYX A;  3ER7 A;  5IG3 A;  2OOV C;  5EPF A;  2GVP A;  2VCZ A;  3F9S A;  5AIH A;  3ERW A;  4ECC A;  3M9K A;  1FGR A;  4PNG A;  1YIJ 3;  1O8W A;  1LQG C;  3D3L A;  3JUN A;  3GAX A;  4AJ6 A;  3TGZ A;  2VCV A;  4G19 A;  4CJN A;  2P09 A;  8RNT A;  5B8B A;  3K5T A;  3ZFZ A;  2WGO A;  3ZVJ A;  1K3L A;  1SIH A;  2WJU A;  4XS6 A;  1ULJ B;  4FCM A;  2HOH A;  3UNL A;  2CT6 A;  1A67 A;  4MPG A;  4OVM A;  4WF4 A;  1ASK A;  2GZP A;  4RQX A;  3U5R E;  4GTU A;  2KCD A;  1IVX A;  2QKE A;  5DQS A;  2CKF B;  3GH9 A;  1PA3 A;  3PGT A;  3L9V A;  4K1V A;  5D81 A;  3KZT A;  4NHF A;  1SK1 A;  1N8Q A;  2ON7 A;  2QA2 A;  2IMI A;  3LTB A;  3SLU A;  2IYJ A;  2YV9 A;  1I0V A;  1QK8 A;  1YY7 A;  3AY8 A;  4N10 A;  1XXU A;  2IUJ A;  1J08 A;  1ROA A;  2HI7 A;  4NV2 A;  3D5J A;  3EYT A;  4EL1 A;  1A8L A;  3TUE A;  1OF5 B;  4EYC A;  2G0F A;  1ZO2 A;  2AYT A;  3GTU B;  3F6D A;  1IVV A;  3ZTL A;  5FT3 A;  5KEJ A;  3DH2 A;  16GS A;  2JZT A;  4YAP A;  1EOG A;  4EIQ A;  2CVB A;  4GCI A;  1HKX A;  1WOU A;  2KLX A;  1ZYN A;  1Y4K A;  2MBT A;  2TIR A;  1PQN A;  3FMW A;  4K1U A;  3ROB A;  1LOX A;  4O8S A;  2WGR A;  4XCS A;  1SJ6 A;  1AY7 A;  1KD1 4;  3VPQ A;  4R1K A;  3BNC A;  2QA4 3;  1PMT A;  4LA1 A;  4ZXG A;  1M7T A;  3CCL 3;  1A2V A;  1CQH A;  5J4U A;  1QMV A;  1BNJ A;  3AGO A;  4L5O A;  4HZ9 B;  3NM7 A;  2OQE C;  3FKF A;  2R5G A;  2YWI A;  4F03 A;  1W5Z A;  1K0A A;  2C0E A;  1GWC A;  1I0X A;  1IYH A;  2XPD A;  4OO4 A;  2IJY A;  4G10 A;  3IXR A;  5EVO A;  1AR0 A;  2PNC A;  3WT2 A;  2FGT A;  2OE1 A;  1QMA A;  3OXA A;  4FIW A;  1UCJ A;  5DQY A;  4K2D A;  2W2C A;  1W2Z A;  1H4O A;  2BIR A;  2AJQ B;  1GL8 A;  4JF8 A;  19GS A;  3DYR A;  2R6K A;  1CEW I;  11GS A;  4GQC A;  4PUA A;  3BOA A;  2CWU A;  3PIN A;  1F9M A;  4K7N A;  1NHO A;  4JBB A;  3Q18 A;  3I6A A;  3PXM A;  1XG8 A;  3UMA A;  5CXO A;  1TFO A;  2O85 A;  3DGO A;  2MMO A;  4X0X A;  1MDJ A;  5IG0 A;  2HZF A;  1NB5 I;  1BVI A;  2X8H A;  1Z5Y E;  7GSP A;  5D9W A;  2Z9S A;  1BNS A;  1YIT 3;  1BSB A;  2B7K A;  3GRX A;  5IG5 A;  4KE3 A;  1XVQ A;  4O7H A;  1AV4 A;  4MMX B;  3C71 A;  3MSZ A;  1GYB A;  1FGT A;  2SAR A;  5ID2 A;  2WO0 A;  4NRE A;  1OC9 B;  1BU4 A;  2KXG A;  2KUC A;  3M8N A;  2KP2 A;  5STD A;  3X40 A;  1MTC A;  4Q5Q A;  1LNI A;  4HBR A;  22GS A;  2K9F A;  3FZ5 A;  5EEO A;  1K0N A;  2IWT A;  9GSS A;  2W56 A;  4JR6 A;  2BMR B;  3F8H A;  2OQE A;  2FWE A;  2H01 A;  1Q7Y 4;  4IGJ A;  2INX A;  18GS A;  3C7M A;  2LNT A;  5CP1 A;  1Q7H A;  3PH9 A;  1IV7 A;  2VD0 A;  2PGT A;  3ZML A;  3WOD G;  6STD A;  2CWV A;  5JPP A;  1DUG A;  1G6Y A;  2WUL A;  5IM9 A;  3GZR A;  4MCU A;  3WOF B;  1SL1 B;  2CV4 A;  4BU4 A;  1W2B 2;  1D6U A;  2F9S A;  1Z6N A;  2VM2 A;  4O32 A;  1GOY A;  1VQ5 3;  2CVK A;  1ZGX A;  4GSP A;  3EU4 A;  1PX6 A;  2LTK A;  1U8C B;  4LGQ A;  5IOX A;  3K9M C;  2L59 A;  1Q9E A;  5LNK e;  2H30 A;  1MOL A;  4TW5 A;  2V2G A;  2IMF A;  1O7P B;  2LRC A;  4YQU A;  1RLS A;  1RGC A;  4Z7X A;  1IQ8 A;  3RGR A;  2C3T A;  3M8C A;  4MP4 A;  3M1G A;  5AEW B;  5GSS A;  1J9B A;  1LU4 A;  1ZMA A;  4AJ7 A;  1B2M A;  3UEM A;  1E3R A;  4XS1 A;  1ROV A;  3QR6 A;  1RN1 A;  3HY2 A;  2PU9 C;  3LYP A;  4J9A A;  3X3X A;  3EVI A;  4V1A g;  2CA8 A;  2MYG A;  1U3A A;  3RDW A;  4G0L A;  1Q40 A;  1NSW A;  3RPN A;  4POL A;  1JB2 A;  6GSS A;  1WP0 A;  4RI7 A;  5ECK B;  2BJX A;  1T4Y A;  1YJ6 A;  4J2F A;  1UVZ A;  3LOY A;  5DDL A;  1B2Z A;  1X1Y A;  3B4P A;  5LC6 A;  2KP1 A;  3EMX A;  2W56 B;  4EV2 A;  2HMN B;  1VQ6 3;  2EIO A;  4MEI A;  1AW9 A;  2CC3 A;  2AAW A;  3CYN A;  2O87 A;  4K7I A;  5I97 A;  3E9J B;  1TRU A;  4K0G A;  1JBS A;  4N30 A;  4G0K A;  4AKZ A;  1EEM A;  4LL1 B;  3FHK A;  1DE1 A;  1PSQ A;  1ZOF A;  1SD8 A;  2LS5 A;  2J8X B;  1IQX A;  5CK6 A;  1IT8 A;  1T00 A;  1YQ1 A;  4LMW A;  1JN5 B;  1N5H A;  1VF1 A;  4F82 A;  2F98 A;  4OCE A;  2PMT A;  1LVN A;  3GRD A;  2OKA A;  1B2S A;  1EWX A;  4ZBA A;  1GRX A;  4YQM A;  1A2L A;  2CHC A;  1N8J A;  1J0F A;  1EGR A;  2GZZ A;  3HDC A;  2VCQ A;  4QWT A;  5HR1 A;  5CNW A;  1SU9 A;  4DVC A;  1LOY A;  5ELU A;  3CCE 3;  3NXJ A;  3UAR A;  1UI8 A;  1A8Y A;  1BAY A;  5ECI B;  2WOH A;  1GUH A;  3LML A;  1Q4J A;  1GY5 A;  2W03 A;  2FWF A;  2XC2 A;  4BVY B;  1O7M B;  1FB0 A;  2VUP A;  2OAC A;  2PER A;  1UUV B;  1Q40 B;  3UVT A;  2X8G A;  3L78 A;  4Z2T A;  3D0Z A;  3F14 A;  1GP1 A;  3C8E A;  1X9S B;  5D8I A;  3BIR A;  1D6Y A;  3CTF A;  2X4A A;  3BND A;  2HMJ B;  1THO A;  1NNV A;  4K90 B;  4HOJ A;  5JCW A;  4O02 B;  2FY6 A;  3F7X A;  1FZU A;  3CCV 3;  2VD1 A;  1JNQ A;  1TJD A;  3Q2P A;  1OC8 A;  2HRK A;  1MDI A;  4HU9 A;  4TOP A;  2Z76 A;  2AAE A;  2L5L A;  2DIZ A;  2WGQ A;  1TI3 A;  3DKS A;  1BSC A;  4HSC X;  3F0I A;  1BRJ A;  5AGY A;  2Y74 A;  2YFJ B;  3MAK A;  2I9W A;  1MD3 A;  3GA4 A;  5IOW A;  1DYU A;  4XHM A;  4L0U A;  1W02 A;  1Q86 4;  3ZRE A;  4XS4 A;  3JUQ A;  3IAS 2;  3EX9 A;  4NV5 A;  2CWT A;  1K8A 4;  1TTZ A;  2RBI A;  4OK0 A;  2NPB A;  1JBR A;  3F4T A;  4IPB A;  4KA0 A;  1RKY A;  4XRD A;  1A2P A;  1HU9 A;  3BCK A;  3IJE B;  2K6V A;  2BO9 B;  1W00 A;  3NV0 B;  3CCM 3;  2EIR A;  1BRS A;  1DMM A;  2RSX A;  1U6T A;  1JLW A;  4X2O A;  5IG4 A;  1MNL A;  3GUS A;  1JB5 A;  2HML B;  1B20 A;  3EC9 A;  4MMM A;  2UGI A;  1ERW A;  1N2A A;  4H86 A;  4FH8 A;  4KDX A;  3VPT A;  2W04 A;  1M9A A;  3DD3 A;  4KVH A;  3MYD A;  1FHE A;  2L4C A;  4GHO A;  2IUK A;  2WOF A;  3ALA A;  3KKG A;  5A0O B;  4POB A;  1AC1 A;  3CMI A;  4N6O B;  5BU4 A;  1QGV A;  5M1A A;  4ECJ A;  2PZV A;  4IW9 A;  1YEX A;  4G0I A;  3SX1 A;  1TK8 B;  1RNB A;  3NQY A;  4WET A;  1VQL 3;  2LUS A;  4HS1 A;  2WB9 A;  3NBR A;  5HQP A;  2WDU A;  5M18 A;  3CCS 3;  3EE1 A;  3F9U A;  1K0C A;  4MZB A;  3US3 A;  1RQM A;  3SXX A;  4BWQ A;  5J41 A;  4R4K A;  1GUK A;  2E2T A;  1R4W A;  1S3D A;  2H6Z A;  2VL9 A;  2GT6 A;  1C54 A;  2NBS A;  4PUR A;  1X5D A;  4OWY A;  2I4A A;  3F3R A;  2C3N A;  1G96 A;  3DGN A;  1BNF A;  3I69 A;  4CDO A;  4MK3 A;  4N6N B;  4OD7 A;  1ABA A;  2Y73 A;  5KOW A;  1VQ9 3;  2GLR A;  3L0R A;  1TRV A;  4XS4 B;  3FH1 A;  3U97 A;  2H73 A;  1WIK A;  2F99 A;  1Q98 A;  1TRW A;  1GOV A;  2LRT A;  2K8V A;  3KII A;  4HM3 B;  2YWO A;  2ZL8 A;  3KP8 A;  1PYL A;  2B1L A;  4IJI A;  4OFT A;  2B24 B;  2GBW B;  4BL7 A;  2GXF A;  2H1D A;  4OMV A;  3MYT A;  3GUR A;  5ECO B;  4Z2R A;  3BNB A;  4HM0 B;  2OA7 A;  2XEP A;  2ZUP A;  1PFP A;  2H71 A;  3F7S A;  1A23 A;  5ECQ B;  1LQM B;  5KN2 A;  3IPZ A;  3F40 A;  5J5N A;  1XWB A;  1WJK A;  2IL3 A;  4L8E A;  1KBN A;  2YZH A;  1VRS D;  3A3T A;  2C8U A;  1LNH A;  1SD9 A;  2STD A;  1DSB A;  2IPA A;  3W8J A;  2YX9 A;  3LTC A;  1F37 A;  3OWY A;  2LKU A;  3HVV A;  3QAV A;  1VZZ A;  3QAG A;  1QUW A;  1HD2 A;  1R26 A;  5KN3 A;  1WWJ A;  4F2I A;  1QJG A;  3B8L A;  1RGG A;  3TJK A;  4J5G A;  3HZ4 A;  2C0D A;  3F4R A;  1LOW A;  3X42 A;  1EEJ A;  3UVH A;  4ULX A;  3EJV A;  1XW9 A;  3TB2 A;  1BOX A;  2OTL 3;  1ULI B;  1K28 A;  3FKA A;  1WE0 A;  1WMP A;  1KQS 2;  3LJR A;  1T5Y A;  2R0G A;  2P38 A;  3ME7 A;  2A2P A;  4K8M A;  2PVO C;  3TJB A;  2DKH A;  5C00 A;  4ZBB A;  4V2N A;  2IFQ B;  1M1X B;  3QK9 A;  4TRX A;  2UUG C;  4MNN A;  3VF1 A;  5CRD A;  2C4J A;  1B3S A;  2K18 A;  3FF2 A;  2R41 A;  4HDE A;  4X4J A;  4I8B A;  4NHZ A;  1DVD A;  1K0D A;  4RBN A;  1GTU A;  2AHE A;  1CQS A;  1TP9 A;  3FEU A;  3HIG A;  2XHF A;  4G9H A;  4X1U A;  3ZLP A;  3UOM A;  1OHS A;  3L0H A;  2F5M A;  5CF1 A;  2GQL A;  4FMD A;  1TUH A;  17GS A;  1BRG A;  1ZCP A;  1I2E A;  1OF5 A;  1Q81 4;  1EZK A;  3GTU A;  2H19 A;  3IRA A;  3LYK A;  4FMB A;  2LV3 A;  1O85 A;  3EN1 B;  4FYC A;  2TRX A;  3PCS A;  4MDC A;  4IJ3 A;  5IMF A;  5BMU A;  1A2M A;  3CBU A;  2BMX A;  2JAD A;  5IPG A;  3KGK A;  5G5E A;  5IER A;  1I70 A;  1UCK A;  2CH9 A;  3G6E 3;  1IYY A;  2M80 A;  3LXT A;  2DSA A;  2H70 A;  1O8X A;  1M1K 4;  2CW9 A;  1LXE A;  1D6Z A;  2CAQ A;  4BL2 A;  3DML A;  3HJP A;  4N0V A;  1E6B A;  4MF5 A;  3G9B A;  3FG3 A;  5IEO A;  2VLT A;  3IAM 2;  1SL2 B;  3OW2 2;  3BU4 A;  2YPM A;  1Z1S A;  4MF6 A;  4BPY A;  1QAL A;  3OWS A;  3NOF A;  1ZL9 A;  3R3E A;  3KH9 A;  3HZP A;  1BRN L;  3CCU 3;  1PU4 A;  1QVF 2;  1AQV A;  1OAZ A;  2H66 A;  5JCG A;  5G31 A;  3D9R A;  4H61 A;  4KT3 B;  3E3E A;  1L5G B;  2GEX A;  1TIJ A;  2HSY A;  2R2J A;  5DRE A;  4D73 B;  2XH9 A;  3S27 A;  3QAW A;  3OWU A;  1RSN A;  3CCQ 3;  3OV4 A;  4ZB6 A;  1BNE A;  4CDL A;  1IYI A;  2E0Q A;  2LQV A;  2F3M A;  4ZIJ A;  4FCJ A;  8GSS A;  2SBL A;  1K0O A;  2O7K A;  1GUM A;  2FCH A;  6GSX A;  4STD A;  2RNT A;  3SED A;  2B1K A;  3GL5 A;  3MIX A;  2OBI A;  1B2X A;  3F6F A;  3CNX A;  2OJL A;  4V2M A;  5HFI A;  3S29 A;  1GTB A;  2LNS A;  5HR2 A;  5CAX A;  2EC4 A;  1SPU A;  3QDN A;  4G1M B;  1ERU A;  1FB6 A;  3TOT A;  2W9P A;  1XBS A;  4N11 A;  2V32 A;  2WZ9 A;  1VQM 3;  1JB4 A;  1XIY A;  1WQL B;  1BNR A;  6RNT A;  1FGO A;  4GB5 A;  1E3V A;  3LG6 A;  2ML5 A;  3N8B A;  2RII A;  2A2R A;  3F63 A;  5IPH A;  2IMD A;  3KE7 A;  5B8A A;  3H3H A;  1Q82 4;  1T8E B;  4FCZ A;  3N54 B;  2WRT A;  3IHQ A;  3WGD A;  1UGH I;  1QVG 2;  2C1Y A;  1OC9 A;  4N0Z A;  3EB8 A;  1HYF A;  4HZ2 A;  1DET A;  3NM2 A;  1UW1 A;  2A2S A;  1AUC A;  2FGX A;  4DSS B;  2OOV A;  4HZB B;  2B3S A;  3RGA A;  1GSD A;  1Z7R A;  1W89 A;  4TR4 A;  5B6M A;  1HZ1 A;  4HM6 B;  2C0F A;  4KFF A;  1RW1 A;  3ZVJ D;  2GQM A;  3LOR A;  3NQZ A;  2W6J H;  3HII A;  2GGT A;  5G5F A;  1GNE A;  4MZC A;  1EV9 A;  3IPT A;  2GTU A;  3FZ4 A;  4KCE A;  1YJN 3;  2F51 A;  2X49 A;  3WMD A;  1BG5 A;  1F2E A;  1W4V A;  1KWI A;  1S3A A;  2YAN A;  4GLT A;  3CC7 3;  3IDV A;  1X1U A;  4KND A;  1XW6 A;  1LJR A;  12GS A;  2JSZ A;  1UDI I;  3SBC A;  5INY A;  1SK2 A;  1XWA A;  1OHP A;  1TW9 A;  2LJR A;  2MMA A;  4Q53 A;  3A2V A;  3DVX A;  5F8B A;  2NVL A;  4ECB A;  2VCT A;  3LYG A;  5D93 A;  1XWG A;  1X1W A;  1YVB I;  3CD6 3;  2KF3 A;  1USB A;  3VK9 A;  2IA7 A;  4Q5R A;  3FZ9 A;  2OWP A;  3D6I A;  1B9Y C;  5ECM B;  2XFT A;  1BNG A;  3WDG B;  3H93 A;  2QIY A;  5J3R A;  3EC3 A;  1PN9 A;  5DCH A;  1JBT A;  5CF2 A;  1RGL A;  2HRN A;  4AKY A;  2DJK A;  1MGW A;  3JUO A;  1NDO B;  4HM7 B;  5G2G A;  4HM5 B;  1OPY A;  1PY3 A;  1RCL A;  3G7Y A;  2VO4 A;  1FUW A;  3UAP A;  1T2I A;  3IBH A;  3FSD A;  5J9B A;  3LTD A;  1VQ8 3;  1IVW A;  1VQQ A;  2QGV A;  2CFK A;  1RGK A;  5E4W A;  3KJY A;  3TKP A;  4RI6 A;  5LC7 A;  3SOA A;  4WBR D;  4O3V A;  4LMI A;  1SJW A;  3G7J A;  2YJH A;  3IC8 A;  4HJM A;  5IMC A;  1UA5 A;  2X8C A;  5B6N A;  4KX4 A;  1KEB A;  2D1W A;  4U13 A;  4CPK A;  4WXT A;  1V9W A;  4PQI A;  3HK4 A;  4RUV A;  3UIW A;  5HR0 A;  1SKS B;  1PX7 A;  3A5W A;  1JN5 A;  3EF8 A;  6GSV A;  3ERG A;  4K61 A;  3ZG0 A;  3FZA A;  1RN4 A;  5FHI A;  2XGL A;  1YZX A;  1EUI C;  2ZNM A;  2C80 A;  1PL1 A;  1N5P A;  4HQZ A;  2XSO B;  4DSQ A;  4MJE A;  4PEJ A;  3VWU A;  1X9W B;  4ICY A;  3H8Q A;  3FY7 A;  2H76 A;  4YKF A;  2GSS A;  3A2W A;  4EV5 A;  2F8A A;  2ZDJ A;  1GLP A;  2KHP A;  3H79 A;  3LGC A;  4J57 E;  2F86 B;  5GZZ B;  5JWO B;  2O8V B;  2I9H A;  2GZY A;  4OCF A;  2K0M A;  1JV2 B;  4BTX A;  1S3R A;  4TVE A;  3VWX A;  1SEN A;  4BVY A;  1R7H A;  1I5G A;  4ECI A;  3CNM A; 
#chains in the Genus database with same CATH homology
 1VF2 A;  4IBP A;  1GSE A;  1B8X A;  1GTI A;  3GX0 A;  2REM A;  3IHG A;  3HYP A;  3ZL5 A;  2H72 A;  7GSS A;  3Q6O A;  4IHU A;  4KDY A;  2N5A A;  3EUR A;  2PVQ A;  3GYK A;  3UL3 A;  2WCI A;  3KP9 A;  1TI1 A;  3E0U A;  3FRC A;  2GT5 A;  2J9H A;  5G1K A;  5HR3 A;  4FYU A;  1XW5 A;  3WT1 A;  2L4Q A;  2HSM A;  2PUK C;  4ZB8 A;  3ISO A;  3KMN A;  1ON4 A;  1ML6 A;  5IQY A;  1K0B A;  4XTS A;  4ZL8 A;  2HT9 A;  5IMA A;  4BA7 A;  3GN3 A;  4ZL7 A;  5F0G A;  2D2Z A;  4MH2 A;  3IC4 A;  2CX4 A;  4QL9 A;  3TJG A;  4EE0 A;  1TK5 B;  2CZ3 A;  5IIZ A;  4FO5 A;  1DBY A;  2YV7 A;  3MWH A;  3GKX A;  2WS2 A;  1HYU A;  1A24 A;  3LSZ A;  1GSY A;  5IO2 A;  3PPU A;  3MDK A;  4KGI A;  5ECH B;  3FR3 A;  2E2M A;  3CXG A;  1FAA A;  5D9V A;  2YCD A;  4I2U A;  5ECP B;  1XOB A;  2G2Q A;  2V6K A;  3GH6 A;  5KOX A;  4TR0 A;  2DC5 A;  10GS A;  4KF9 A;  1X5E A;  3D4M A;  3KTL A;  3RHB A;  2R4V A;  1O6J A;  1KTE A;  4I6X A;  3G7I A;  4OO5 A;  2H1G A;  3F3Q A;  4DSR A;  4TXV A;  3U6V A;  2B5Y A;  1PKZ A;  4GRF A;  3VFI A;  2NDO A;  3IK7 A;  3VLN A;  4TR1 B;  1ERV A;  1NM3 A;  2H6Y A;  1ERT A;  3UBL A;  2X64 A;  4V1A p;  4KSO A;  4MJA A;  2MBS A;  3EWL A;  1UN2 A;  5F05 A;  1MDK A;  3GHA A;  2V41 A;  4JRR A;  2H75 A;  3Q19 A;  5F06 A;  4MPF A;  1YF0 A;  5KN1 A;  5IMV A;  3M0F A;  3GKN A;  4QL7 A;  1YF1 A;  1QXH A;  2HRF A;  3O6T A;  1UC7 A;  3WD6 A;  1BQ7 A;  5EY6 A;  2FA4 A;  2LEG A;  2B6M A;  2H1A A;  4K2X A;  4G2E A;  4J56 E;  5A4V A;  3IOS A;  5H5Q A;  2UZ8 A;  4MA9 A;  5HFG A;  2DKI A;  2I1U A;  2GSQ A;  1BJX A;  1TK0 B;  3APO A;  3WGX A;  2C3Q A;  1URM A;  3NIV A;  3S9F A;  6GSU A;  3HHV A;  1B9X C;  2R3X A;  1H75 A;  2IFQ A;  3ZFL A;  5JCU A;  3APS A;  3D22 A;  2EIQ A;  1SL0 B;  4XIH A;  3DIE A;  3C1S A;  1HNC A;  6GSY A;  3TRP A;  2L5O A;  3KH7 A;  1OE7 A;  1I9D A;  2YN1 A;  1XCC A;  3L9U A;  2VL2 C;  4K9Z A;  4TXO B;  3H4K A;  4MH3 A;  3IV4 A;  1V57 A;  2GDR A;  4BVX B;  3OR5 A;  5J9C A;  2V1M A;  3KCM A;  6GSW A;  5BRT A;  1F3A A;  4ACS A;  2L6C A;  4WKW A;  5B7C A;  5A4U A;  1R5P A;  4ID0 A;  1YKA A;  3KEB A;  5DAK B;  3ZMK A;  3TJJ A;  4KH7 A;  3KMO A;  2OBK A;  5CYY A;  5C04 A;  4AGS A;  3HCZ A;  1GNW A;  2FUG 2;  5DAL B;  3GMF A;  1PRX A;  2JZS A;  4OFM A;  1TRS A;  4L5L A;  4PX1 A;  2ALB A;  2DML A;  4HJ2 A;  2P5Q A;  2H0I A;  1B4P A;  2HSH A;  5GAN D;  4KAE A;  1ST9 A;  2FWH A;  1M99 A;  3HXS A;  2GS3 A;  3BBY A;  1Y6E A;  4E8H A;  1JLV A;  3TOU A;  1FVJ A;  1ZGN A;  2TRC P;  4D73 A;  2HFD A;  1NW2 A;  5AIS A;  2E7P A;  1VF3 A;  4AF2 A;  4MLY A;  4EKZ A;  3ME8 A;  3HKR A;  4OFN A;  4NHW A;  1OC3 A;  13GS A;  1O81 A;  2MMZ A;  4ZB9 A;  1OKD A;  1ZYP A;  3C1R A;  2VL2 A;  3A2X A;  5GAP D;  5D9T A;  5AN1 A;  4ILF A;  2RUE A;  1G0T A;  1TDI A;  4EUY A;  1PGT A;  1FOH A;  4WBJ A;  1GTA A;  3Q74 A;  2XBQ A;  4EVM A;  2BTO T;  4CY6 A;  1FW1 A;  3EE2 A;  2GSR A;  2FD3 A;  1BYE A;  1Z3E A;  1AQX A;  4HI7 A;  2P5R A;  1U87 A;  4X43 A;  4DSS A;  2JL4 A;  2RUF A;  5G30 A;  3LWA A;  1NHY A;  3LW9 A;  4ZBD A;  3P7X A;  2AUV A;  2OE0 A;  4MF7 A;  2IY2 A;  3KTB A;  2R0C A;  4LL4 B;  1VF4 A;  3IE3 A;  1QQ2 A;  1O73 A;  3VWW A;  1GSS A;  2E2G A;  2HZE A;  2HNL A;  2MMN A;  1O7U A;  1ILO A;  1XZO A;  3TKQ A;  1AQW A;  3CTG A;  2GST A;  1T3B A;  2YP6 A;  2H0H A;  1B4Q A;  4GST A;  3I43 A;  3SWL A;  4KDU A;  2PN8 A;  3EMP A;  4EO3 A;  4EXJ A;  4GQF A;  2N5F A;  1V98 A;  2VL3 A;  3RPP A;  3VUR A;  1E2Y A;  3WGE A;  3HJM A;  4ML6 A;  2R0P A;  3O76 A;  3QFA C;  1Z6M A;  3RAZ A;  3R2Q A;  4FYB A;  1F6M C;  2YWN A;  2B5X A;  2DJ3 A;  4PQ1 A;  3CSH A;  4K5S A;  5H5R A;  2DJ2 A;  4GSS A;  2JSY A;  2JAC A;  3LQ7 A;  3VWV A;  2NTO A;  2L57 A;  4LMV A;  2CVD A;  4AJ8 A;  3LEF A;  2CQ9 A;  4WR5 A;  5EL8 A;  3HJO A;  3L9S A;  5ECS A;  1JZW A;  1A0F A;  2DBC A;  1JZR A;  5ELG A;  3QPM A;  2X99 A;  3F8U A;  2LRN A;  2HZE B;  2P0G A;  4O5U A;  4ISD A;  5IO0 A;  1JZD A;  4K1F A;  1Z9H A;  4LLR A;  3N5O A;  1B48 A;  4IP1 A;  2O89 A;  1XWK A;  4JR4 A;  1MEK A;  4WEY A;  3P90 A;  4USS A;  1WPI A;  5DCG A;  4IKH A;  5L71 A;  2KOK A;  5F07 A;  2OAD A;  3CRU A;  1FOV A;  2VCX A;  1XPV A;  1YDK A;  1X9M B;  2P31 A;  3ZRD A;  2RLI A;  3M9J A;  5ECL B;  2H1B A;  3HD5 A;  6GST A;  3NZN A;  4I97 A;  1XFL A;  2MZC A;  2AV4 A;  3IR4 A;  1EV4 A;  4TN8 A;  1GLQ A;  3EU3 A;  2CAI A;  3UBK A;  1F3B A;  3EPT A;  4Q5N A;  4O5Q A;  2K8S A;  1HNA A;  1DE2 A;  1JZO A;  2VIM A;  4IQ1 A;  3TRX A;  5ENU A;  4JZQ A;  1T7P B;  3TJF A;  3GV1 A;  4K7O A;  2VOC A;  3KD0 A;  3KXO A;  2FA8 A;  3QFB C;  3UJ1 A;  3HVX A;  5DVB A;  3I9V 2;  4IN0 A;  1CQG A;  4PQH A;  4WR4 A;  4F0C A;  4MJB A;  2I81 A;  4L0W A;  4K0N A;  3KM6 A;  5KN0 A;  4O5R A;  1MD4 A;  2VCW A;  3GX8 A;  3FW2 A;  3VI5 A;  1SK0 A;  3DGQ A;  3FR6 A;  4JE1 A;  3HZ8 A;  1T4Z A;  4GXZ A;  4YQV A;  3ZZX A;  4F9Z A;  2YJ7 A;  3ERF A;  2RM5 A;  1PL2 A;  5A4W A;  1SYR A;  2AB6 A;  4O92 A;  3V1W A;  2ES7 A;  1JHB A;  2QC7 A;  4I2T A;  2LQO A;  2J23 A;  2PWJ A;  4CHS A;  2LJA A;  3DVW A;  4HZ4 A;  1FG4 A;  2PPT A;  4QQ7 A;  1ZYE A;  5DJM A;  2HYX A;  2DJJ A;  2DJ0 A;  5IMZ A;  2HRA A;  1K3O A;  3DRN A;  3GFK A;  2HXK A;  4IEL A;  5ID2 B;  3TDG A;  3RHC A;  1SKW B;  4A5P A;  1YKC A;  1THX A;  2LQQ A;  3QD9 A;  1GH2 A;  1M9B A;  14GS A;  1M2A A;  1VGL A;  1M2B A;  5GST A;  3QOU A;  2CZ2 A;  1XVW A;  3ZYW A;  4NWY A;  2VAF A;  2IN3 A;  2IIY A;  3BD2 A;  3M3M A;  2ON5 A;  2H0G A;  3APQ A;  3FR9 A;  2XPE A;  4YKG A;  1KNG A;  4NMU A;  4MAB A;  4TR1 A;  1GSU A;  2M46 A;  5CRE A;  4F0B A;  1TXX A;  3JCM L;  1R5A A;  1SJZ A;  5JWR B;  1K0M A;  4ML1 A;  3WYW A;  1SYX A;  2VLV A;  3O3T A;  3TCO A;  3ZIT A;  2I3Y A;  2V6O A;  1WRY A;  3J7Y k;  1FO5 A;  4JU5 A;  2B5E A;  5A5K A;  4EDZ A;  3ZFB A;  4ZIL A;  3GIX A;  3C73 A;  4NPB A;  5ECN B;  2H74 A;  3KZQ A;  3N9J A;  4GF0 A;  1OKT A;  4POM A;  3LFL A;  4PGT A;  1OVN A;  2XBI A;  5D96 A;  1QFN A;  3A5I A;  4TR3 A;  3ZIV A;  3J7Y b;  2WFC A;  1ZZY A;  3H1N A;  3BJ5 A;  4EIP A;  4WF5 A;  5G2Z A;  3DEX A;  1ACV A;  2HLS A;  4NXI A;  1TKD B;  4KB3 A;  1G7E A;  4GWR A;  2QA1 A;  3GKM A;  1M0U A;  5LCZ A;  4KW6 A;  2YZU A;  20GS A;  3HVS A;  4IP6 A;  1JFU A;  4RQR A;  4TXO A;  4PNF A;  2GQK A;  3W6G A;  1Y25 A;  3CSJ A;  5ECR B;  4Z2U A;  4IVF A;  4BVX A;  4HQS A;  1LBK A;  3ZIJ A;  2YNX A;  3PR8 A;  1U3I A;  4YAV A;  2IMK A;  4ZL9 A;  3GNJ A;  5DAK A;  3GSS A;  1FVK A;  1AAZ A;  2HE3 A;  3TKS C;  1SKR B;  3LXZ A;  5DAL A;  1AXD A;  1RK4 A;  1TOF A;  1WMJ A;  3FYG A;  4EC0 A;  1TU8 A;  4KCA A;  3P2A A;  4EDY A;  2ZCT A;  2IME A;  3P8W A;  1EP7 A;  1OYJ A;  4PTS A;  1S3C A;  3CSI A;  3D21 A;  3TKS E;  2F8F A;  4POK A;  2N5B A;  4EF0 A;  2H8L A;  2H6X A;  3VI7 A;  2OE3 A;  1A0R P;  1A2J A;  3DXB A;  4IQA A;  2DJ1 A;  5IMD A;  5LD0 A;  4PUF C;  3GKK A;  3HA9 A;  2RM6 A;  1C72 A;  1XWC A;  3D4T A;  3BCI A;  1K3Y A;  4MJC A;  3EIN A;  2FHE A;  2JZR A;  4CW9 A;  4PXO A;  3W8S A;  1V2A A;  5ELA A;  1OE8 A;  4CY8 A;  2DIY A;  3FK8 A;  1GSQ A;  5CRG A;  4I5Q A;  1HQO A;  5ABR A;  5D9X A;  1EGO A;  2L6D A;  2QSI A;  4NAX A;  1PN0 A;  1TU7 A;  2A4V A;  4GSN A;  4K5R A;  3IK9 A;  2VLU A;  3QMX A;  5FWG A;  4HEA 2;  1V58 A;  2PBJ A;  3TKS A;  2LJK A;  4KUN A;  1GUL A;  4BWS A;  2VM1 A;  1EP8 A;  5AIV A;  5H5S A;  4TKY A;  5E59 A;  4DEJ A;  5DJL A;  2YWM A;  2FLS A;  4KSM A;  1HNB A;  5DBQ A;  3GL3 A;  3F4S A;  1X5C A;  4XRA A;  3K8N A;  4K6X A;  1EOH A;  5D73 A;  5CRW A;  2LST A;  2CX3 A;  5CO3 A;  2FNO A;  4MZW A;  5JWQ B;  1M2D A;  1BED A;  5AIX A;  4P3Y B;  4E8E A;  4Q5F A;  3MNG A;  5G1L A;  2FWG A;  4HUA A;  3RBT A;  4HU7 A;  2A4H A;  1AIU A;  1G7O A;  1PKW A;  1U88 A;  1G6W A;  2R37 A;  4FQU A;  1V40 A;  1X0R A;  3L4N A;  4BL7 B;  3DWV A;  1YEP A;  2C0G A;  5COH A;  4IS0 A;  1PD2 1;  1BX9 A;  2JU5 A;  3TRQ A;  2DMM A;  3KIJ A;  1XOA A;  1SJI A;  1T1V A;  3IA1 A;  5CRH A;  2YOI A;  2M72 A;  1Z7P A;  2DLX A;  4JED A;  1ZYQ B;  3TKR A;  3CRT A;  4YH2 A;  5HFK A;  4V2L A;  1GSF A;  2B7J A;  3GST A;  3ED3 A;  3QCP A;  5EPF A;  2GVP A;  2VCZ A;  3ERW A;  4ECC A;  3M9K A;  4PNG A;  1O8W A;  4AJ6 A;  3TGZ A;  2VCV A;  4G19 A;  5B8B A;  3ZVJ A;  1K3L A;  2WJU A;  4XS6 A;  4MPG A;  2CT6 A;  4WF4 A;  2GZP A;  4RQX A;  3U5R E;  4GTU A;  2QKE A;  5DQS A;  3GH9 A;  1PA3 A;  3PGT A;  3L9V A;  1SK1 A;  2ON7 A;  2QA2 A;  2IMI A;  2IYJ A;  2YV9 A;  3AY8 A;  1QK8 A;  1YY7 A;  4N10 A;  1XXU A;  1J08 A;  2HI7 A;  4NV2 A;  3D5J A;  3EYT A;  4EL1 A;  1A8L A;  3TUE A;  2G0F A;  2AYT A;  3GTU B;  3F6D A;  3ZTL A;  5FT3 A;  5KEJ A;  16GS A;  2JZT A;  4YAP A;  1EOG A;  4EIQ A;  2CVB A;  4GCI A;  1WOU A;  2KLX A;  1ZYN A;  2MBT A;  2TIR A;  1PQN A;  3FMW A;  2WGR A;  4XCS A;  1SJ6 A;  3VPQ A;  1PMT A;  4LA1 A;  4ZXG A;  1M7T A;  1CQH A;  5J4U A;  1QMV A;  4L5O A;  3FKF A;  2R5G A;  2YWI A;  4F03 A;  1K0A A;  2C0E A;  1GWC A;  1IYH A;  2XPD A;  4OO4 A;  2IJY A;  4G10 A;  3IXR A;  5EVO A;  3WT2 A;  2OE1 A;  4FIW A;  5DQY A;  4K2D A;  1H4O A;  2AJQ B;  1GL8 A;  19GS A;  3DYR A;  2R6K A;  11GS A;  4GQC A;  4PUA A;  3BOA A;  3PIN A;  1F9M A;  4K7N A;  1NHO A;  4JBB A;  3Q18 A;  3I6A A;  3UMA A;  2O85 A;  2MMO A;  4X0X A;  1MDJ A;  2HZF A;  2X8H A;  1Z5Y E;  5D9W A;  2Z9S A;  2B7K A;  3GRX A;  4KE3 A;  1XVQ A;  4O7H A;  3C71 A;  3MSZ A;  5ID2 A;  1OC9 B;  3M8N A;  2KUC A;  2KP2 A;  1MTC A;  4Q5Q A;  22GS A;  2K9F A;  3FZ5 A;  1K0N A;  2IWT A;  9GSS A;  4JR6 A;  2FWE A;  2H01 A;  4IGJ A;  18GS A;  3C7M A;  2LNT A;  5CP1 A;  3PH9 A;  2VD0 A;  2PGT A;  3ZML A;  1DUG A;  1G6Y A;  2WUL A;  5IM9 A;  4MCU A;  1SL1 B;  2CV4 A;  2F9S A;  1Z6N A;  2VM2 A;  4O32 A;  2CVK A;  3EU4 A;  1PX6 A;  2LTK A;  5IOX A;  5LNK e;  2L59 A;  2H30 A;  4TW5 A;  2V2G A;  2IMF A;  2LRC A;  4YQU A;  4Z7X A;  2C3T A;  4MP4 A;  3M1G A;  5GSS A;  1J9B A;  1LU4 A;  1ZMA A;  4AJ7 A;  3UEM A;  4XS1 A;  3QR6 A;  3HY2 A;  2PU9 C;  3LYP A;  3EVI A;  4V1A g;  2CA8 A;  2MYG A;  1U3A A;  3RDW A;  4G0L A;  1NSW A;  3RPN A;  4POL A;  6GSS A;  1WP0 A;  4RI7 A;  5ECK B;  2BJX A;  1T4Y A;  1YJ6 A;  4J2F A;  1UVZ A;  5DDL A;  2KP1 A;  3EMX A;  2EIO A;  1AW9 A;  2AAW A;  3CYN A;  2O87 A;  4K7I A;  3E9J B;  1TRU A;  4K0G A;  4N30 A;  4G0K A;  1EEM A;  4LL1 B;  3FHK A;  1DE1 A;  1PSQ A;  1ZOF A;  1SD8 A;  2LS5 A;  1T00 A;  1YQ1 A;  4LMW A;  1VF1 A;  4F82 A;  4OCE A;  2PMT A;  2OKA A;  1EWX A;  4ZBA A;  1GRX A;  4YQM A;  1A2L A;  1N8J A;  1J0F A;  1EGR A;  2GZZ A;  3HDC A;  2VCQ A;  5HR1 A;  5CNW A;  1SU9 A;  4DVC A;  3UAR A;  1A8Y A;  1BAY A;  5ECI B;  1GUH A;  1Q4J A;  2FWF A;  2XC2 A;  4BVY B;  1FB0 A;  2VUP A;  2OAC A;  2PER A;  3UVT A;  2X8G A;  3L78 A;  4Z2T A;  3D0Z A;  1GP1 A;  3C8E A;  1X9S B;  5D8I A;  3CTF A;  2X4A A;  1THO A;  4HOJ A;  5JCW A;  2FY6 A;  2VD1 A;  1TJD A;  1OC8 A;  2HRK A;  1MDI A;  4HU9 A;  4TOP A;  2L5L A;  2DIZ A;  1TI3 A;  3DKS A;  3F0I A;  5AGY A;  3MAK A;  1MD3 A;  3GA4 A;  5IOW A;  4XHM A;  4L0U A;  3ZRE A;  4XS4 A;  3IAS 2;  4NV5 A;  1TTZ A;  2NPB A;  3F4T A;  4KA0 A;  4XRD A;  3BCK A;  2K6V A;  2EIR A;  1U6T A;  1JLW A;  3GUS A;  4MMM A;  1ERW A;  1N2A A;  4H86 A;  4FH8 A;  4KDX A;  3VPT A;  1M9A A;  3DD3 A;  3MYD A;  1FHE A;  2L4C A;  4POB A;  1AC1 A;  3CMI A;  1QGV A;  4ECJ A;  4IW9 A;  1YEX A;  4G0I A;  1TK8 B;  4WET A;  2LUS A;  4HS1 A;  2WB9 A;  5HQP A;  2WDU A;  3F9U A;  1K0C A;  4MZB A;  3US3 A;  1RQM A;  4BWQ A;  5J41 A;  1GUK A;  1R4W A;  1S3D A;  2H6Z A;  2VL9 A;  2GT6 A;  2NBS A;  4PUR A;  1X5D A;  4OWY A;  2I4A A;  3F3R A;  2C3N A;  3I69 A;  4CDO A;  4MK3 A;  4OD7 A;  1ABA A;  5KOW A;  2GLR A;  1TRV A;  4XS4 B;  2H73 A;  1WIK A;  1Q98 A;  1TRW A;  2LRT A;  2K8V A;  2YWO A;  3KP8 A;  2B1L A;  4IJI A;  4OFT A;  4BL7 A;  2H1D A;  4OMV A;  3GUR A;  5ECO B;  4Z2R A;  2OA7 A;  2ZUP A;  2H71 A;  1A23 A;  5ECQ B;  5KN2 A;  3IPZ A;  5J5N A;  1XWB A;  1WJK A;  2IL3 A;  1KBN A;  2YZH A;  1VRS D;  3A3T A;  2C8U A;  1SD9 A;  1DSB A;  2IPA A;  3W8J A;  1F37 A;  2LKU A;  3HVV A;  3QAV A;  3QAG A;  1QUW A;  1HD2 A;  1R26 A;  5KN3 A;  1WWJ A;  4F2I A;  3TJK A;  3HZ4 A;  2C0D A;  3F4R A;  1EEJ A;  3UVH A;  4ULX A;  1XW9 A;  3TB2 A;  1WE0 A;  3LJR A;  2R0G A;  3ME7 A;  2A2P A;  4K8M A;  2PVO C;  3TJB A;  2DKH A;  5C00 A;  4ZBB A;  4V2N A;  2IFQ B;  4TRX A;  4MNN A;  5CRD A;  2C4J A;  2K18 A;  4HDE A;  4X4J A;  4I8B A;  4NHZ A;  1K0D A;  1GTU A;  2AHE A;  1TP9 A;  3FEU A;  4X1U A;  2XHF A;  4G9H A;  3ZLP A;  3UOM A;  3L0H A;  2GQL A;  17GS A;  1ZCP A;  1EZK A;  3GTU A;  2H19 A;  3IRA A;  3LYK A;  2LV3 A;  1O85 A;  4FYC A;  2TRX A;  4MDC A;  4IJ3 A;  5IMF A;  5BMU A;  1A2M A;  3CBU A;  2BMX A;  2JAD A;  5IPG A;  3KGK A;  5G5E A;  2M80 A;  3LXT A;  2DSA A;  2H70 A;  1O8X A;  2CAQ A;  3DML A;  3HJP A;  4N0V A;  1E6B A;  4MF5 A;  3G9B A;  1SL2 B;  2VLT A;  3IAM 2;  2YPM A;  4MF6 A;  4BPY A;  3NOF A;  1ZL9 A;  3R3E A;  3KH9 A;  1AQV A;  1OAZ A;  2H66 A;  5JCG A;  5G31 A;  3E3E A;  2HSY A;  2R2J A;  4D73 B;  3QAW A;  4ZB6 A;  1IYI A;  2E0Q A;  2F3M A;  4ZIJ A;  8GSS A;  1K0O A;  2O7K A;  1GUM A;  2FCH A;  6GSX A;  2B1K A;  3GL5 A;  3MIX A;  2OBI A;  3F6F A;  2OJL A;  4V2M A;  5HFI A;  1GTB A;  2LNS A;  5HR2 A;  5CAX A;  2EC4 A;  3QDN A;  1ERU A;  1FB6 A;  3TOT A;  1XBS A;  4N11 A;  2V32 A;  2WZ9 A;  1XIY A;  3LG6 A;  2RII A;  2A2R A;  3F63 A;  5IPH A;  2IMD A;  5B8A A;  1T8E B;  2WRT A;  3IHQ A;  3WGD A;  2C1Y A;  1OC9 A;  4N0Z A;  4HZ2 A;  2A2S A;  1AUC A;  2FGX A;  4DSS B;  2B3S A;  1GSD A;  1Z7R A;  1W89 A;  4TR4 A;  5B6M A;  2C0F A;  1RW1 A;  3ZVJ D;  2GQM A;  3LOR A;  2GGT A;  5G5F A;  1GNE A;  4MZC A;  1EV9 A;  2GTU A;  3FZ4 A;  4KCE A;  2F51 A;  2X49 A;  1BG5 A;  1F2E A;  1W4V A;  2YAN A;  1S3A A;  4GLT A;  3IDV A;  4KND A;  1XW6 A;  1LJR A;  12GS A;  2JSZ A;  3SBC A;  5INY A;  1SK2 A;  1XWA A;  1TW9 A;  2LJR A;  2MMA A;  3A2V A;  3DVX A;  5F8B A;  2NVL A;  4ECB A;  2VCT A;  5D93 A;  1XWG A;  1USB A;  3VK9 A;  4Q5R A;  3FZ9 A;  3D6I A;  1B9Y C;  5ECM B;  3H93 A;  5J3R A;  3EC3 A;  1PN9 A;  5DCH A;  2HRN A;  2DJK A;  3G7Y A;  2VO4 A;  3UAP A;  3IBH A;  5J9B A;  2QGV A;  5E4W A;  3KJY A;  3TKP A;  4RI6 A;  4WBR D;  3G7J A;  2YJH A;  3IC8 A;  4HJM A;  5IMC A;  1UA5 A;  2X8C A;  5B6N A;  4KX4 A;  1KEB A;  4WXT A;  1V9W A;  4PQI A;  4RUV A;  3UIW A;  5HR0 A;  1SKS B;  1PX7 A;  3A5W A;  6GSV A;  3ERG A;  3FZA A;  5FHI A;  1YZX A;  2ZNM A;  2C80 A;  1PL1 A;  4HQZ A;  4DSQ A;  4MJE A;  3VWU A;  1X9W B;  4ICY A;  3H8Q A;  3FY7 A;  2H76 A;  4YKF A;  2GSS A;  3A2W A;  2F8A A;  1GLP A;  2KHP A;  3H79 A;  3LGC A;  4J57 E;  5GZZ B;  5JWO B;  2O8V B;  2I9H A;  2GZY A;  4OCF A;  4TVE A;  3VWX A;  1SEN A;  4BVY A;  1R7H A;  1I5G A;  4ECI A;  4L8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...