1G0YR

Il-1 receptor type 1 complexed with antagonist peptide af10847
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
310
structure length
310
Chain Sequence
CKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 RECEPTOR, TYPE I
publication title X-ray crystal structure of a small antagonist peptide bound to interleukin-1 receptor type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 53
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2000-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF13895 Ig_2 Immunoglobulin domain
R PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g0yR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g0yR03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g0yR01
2I25N 1MJ8L 1BLNB 3MTRA 4NQEA 3GMOA 5CLTA 1NAKH 3HE7C 3ZT6A 1LO5B 5FV2A 4OLWH 1CK0L 4JVUA 5DDHB 3F6IA 4OLZH 1RZ8B 4XWGL 5CEYA 3OGOE 3RDTC 5DJDA 4NYLA 1BJ1H 5HHNB 4HSQA 1E6OH 1Y18A 4ONOA 3D39B 2PYFA 4LP4A 2D03H 4J3TA 2B2XL 1FAKT 2UWEB 4F9LA 1JTOA 2YBRA 3I9GH 1XR8B 3QXUA 4EEEA 3GO1H 5IWLA 3MUY1 3IXTB 4JO4L 4GKZA 3ZT5A 2F54A 5HJ3B 5C0FB 1OAXL 4JKMA 4NNYA 4S1DC 4C56B 2JLLA 1C12A 3MSPA 3TP4A 4FXGB 2QQNH 4XVTL 2PYED 3L95A 2AS5M 1MJ7L 3LN5A 4AMKL 5CIPA 1OARH 2FLRT 5EC2B 2FBJL 3HI6H 5EU3A 3SJVA 3MMEA 5ITBL 2B1HL 5FCUH 3Q5OA 4DZBB 3RTQB 3FRUA 3HG1B 1JL8A 2F5AH 1TQCC 2ILLA 4KGJA 1Q9KB 4HKXB 3AMLA 3FT2A 4X6EB 1N0XH 1MNUL 3BI9X 6FABH 4GRLC 4HUUB 5FK9B 5J7CC 5GS0D 4I0CC 1U9KA 2YD7A 2EICA 4OSUL 3F62A 3FO1A 2HAZA 3MV7D 3REWB 3MRIB 3U9UB 5DD3L 3AS0A 1GPOL 3VG9C 4X0KA 1Q9LB 1P84J 4QOKB 3HZMB 4PBWD 3I75B 3AUVA 3WBDA 2CRZA 3KPPB 3QT2A 4NN7B 3DUUB 1G9MH 1CZ8L 1MUJA 4KI1A 3AS2A 5B39B 2ID5A 3PGDB 4DK3A 4PG9A 1CU4L 1R5WA 2KL6A 3ARVA 3WLWD 2OTWA 4KJWC 2ZCKH 1N5YH 2OSLB 5DMGC 1SY6L 1A7RL 1CFNA 5EFIB 3VGAC 2WAHA 3VXSE 3ESVF 3CSYB 5TQ2L 1MFCL 3T3PF 2R1XB 3MJGX 4FN0A 1VADA 4NKDB 2HFGL 2GT9A 5FA4B 2A0LD 3HNSL 4WY7L 4JR9L 5KSBF 3GMMB 1VKXA 5F9OL 1ZHBA 4ZUVA 4M6OH 4OCYL 3CZJA 4L8DA 3CMGA 3A6BL 5F88A 4PGDB 3BDBA 3H6JA 5I19L 1QEWA 1D5MB 3IKCB 1ZLUH 2GJ6E 3OB0H 5IIEB 4WW2A 3O41B 1S7WA 1UB5B 2IMNA 3DIFB 4PG2A 1YEGL 3C5ZD 2C3VB 3VFOB 1MI5A 3OXSB 4X9GA 4G8FB 1FNFA 3NGBB 3BN9C 4KV5F 5I1CL 2BX5A 2RJMA 1DBKH 1I8IB 4X8JA 1IM3B 2VLJB 3D9AH 1QLFB 5IQ7L 5AZEH 5CWSA 4X80H 2D7TH 1ES0A 1Q0YH 1UCBH 1SJXA 3BUYB 4K23H 3D3VA 4OKVA 4XBEL 4N9GB 5KG9B 3HKFA 3QG7H 2VXSL 1XF4A 5E2VL 4HEPG 1NBZA 4B50A 5CEXA 3DVIA 3RUGF 2B1AL 4RFEA 4M6ML 4NQDD 4RBPK 3TBSA 3W82A 3VXSA 4ODUA 1MCSA 4YR6A 4KKAD 4M43L 1V3MA 4GMSL 4J6RL 4MD5A 3V6ZA 3C2AH 4FHBD 4LHUG 5DQ9A 4D0DB 4P5KB 3QIWD 1RUAL 1DQJA 2ZNXA 4PJ8B 4NKQB 4N5ED 1IAMA 3L5HA 1ODAA 5E1HB 3LPWA 4NWUL 5FO8A 3SY0A 4PJ5D 2OTUB 3G6DL 2E7BA 1R3JB 5EO1B 4G6AC 2GJZB 2Z8SA 3QHFL 1A21A 1GGBL 5EOTA 1XF5B 2GJ6A 3ULUE 2NW3B 1KULA 3MXVL 4Q58C 5GXBB 3DUSA 3OKNB 1CICD 4R2GC 3V52H 3L6FB 1VPOH 2MPAH 3TJEL 1ZSDB 25C8H 1UXSA 5HVWA 4JY6B 3I02B 4X98B 1YYLL 4U6XA 1IGMH 5EPMB 3T77A 3IVKB 1AH1A 2PR4L 1LO4L 1VACA 1OSZA 1MFBH 1SYSB 1X9QA 1J1XH 5D1ZA 4RQQB 4Y5XB 2ZG2A 5CHNA 3QJHB 3GZKA 1HQ4A 4DZ8B 3BMVA 2QR0B 3AVEA 5IUSA 4N8PA 4AH2B 4D2NA 4H1LG 3TO4C 15C8H 4JFEB 3BKJL 4MWFA 3VWJB 1CDHA 3HC4H 8FABB 5C0JB 5D1XD 1XGQB 4XCEB 1IAKA 3SO3C 3BPNC 4J4PC 3VWKB 3TIDB 3VXUD 2NZIA 3GI9L 3OQ3B 1NANH 2JK5A 1BOGA 3RY6A 4DTGH 5A40E 3O3AB 2ESVE 1YN6B 3RGHA 3UTSB 2KH2B 4Y5YB 1EEYB 1QYGL 4UDUA 2QADC 3STLA 2W9DL 5IOPB 4HKBA 1NMCB 4UV4H 2VE6A 2WLZA 1T03H 3MV11 4P2RB 2JB5H 5DI8B 3SDDC 4FXKB 4WFFE 5BVJA 2OP4H 3HE7A 5C0BD 3RWEB 4O02H 4HKZB 3RZCC 4OD1H 4RISL 4JPVL 3PQYD 4MDIA 5FHBH 4QKXB 2JCCE 2ZCLL 3QIBB 3I85A 3ALWA 4HFUL 1S5IH 5DXWA 4NZJA 3ISWA 1PKOA 3GJEB 5AD0A 4LDOB 5DRWA 3MRNA 2CPCA 1U8LB 12E8L 1OF2B 3G5ZB 3O3BB 4K55A 4YC2C 5SWSD 4D0BA 2UVFA 3OKMA 2H2PD 5MEOB 1CXHA 4ERSL 4JG0H 1HHGA 4R96B 3BJ91 1XR9A 3VXTA 4LKCB 4FQIL 1W0WB 2LTQB 1G7PB 4R7NB 2DJSA 3BQUA 5DJZA 1KTDB 1HHJB 1SM3H 1WBXB 5C9JB 3DHMA 1A7PL 4QHNB 5F7WC 2DS4A 1KCVL 3EO0A 4FQ1H 3RKDC 4ODWA 4IRJD 4KKCC 1KEML 5DK2B 1UM4L 1WTGT 3HA0A 4G9DA 4I4WB 1YC7A 3L5XL 3CJJA 4KTDH 3FTGB 1RQ5A 2ESVA 1HSAB 3UTPE 3S97C 3AREB 1KELH 1S7TB 3GK8H 4IMKA 3NVQA 3ZE0F 2DQEL 4OZIA 2EE2A 2R29H 1J05B 2NXYD 4HBQA 2QHRL 4QRSB 3V7MA 1GOHA 5I8KL 1U0QA 3OKYA 4R9HA 3KYNB 3FAWA 5TF0A 2CKBA 3F65A 1G9NH 2IWGA 3MBED 3DWTA 5B38G 5C0IA 3TT1H 4XHQA 3QFJB 3CX5K 5DJYA 1FN4A 1FNEA 1BIIB 2Q7YA 2FB4L 2XPGB 3AU1B 1I9RL 3VE0A 5HHOB 4NFDA 1KIQA 5AYUL 3B43A 1EDQA 1JV5A 4HS6A 4N5UA 4P2OB 1JF1B 1I8MB 5F7DA 1MIML 3QI9A 4DKAA 4EN3D 2EDEA 4U6VH 5I17B 1EBPA 1UM5H 3UTZB 5I73C 3O9WB 4NHUA 4Y4HB 2HT4D 1M71A 2J88L 2J8UA 4IMLB 3VD7A 5JQ6H 3E2HC 2C4XA 1CXEA 4NQXB 1XCQA 4JFQB 1EIBA 2N7AA 3O6KH 1R3LA 3CXDL 5DLMH 4R0LA 3EKCA 3GIZL 2NX5E 3ALXA 2FX8H 2VDKH 4EUPH 4GQ9H 3Q6GL 4M93C 3C5JB 3T0ED 4MX7B 2BSRB 3L5WB 3NMEA 5KW9H 2YPLA 1I7TA 4APQC 3T4YA 1FPTL 1U93B 1MQKL 2XQYK 4XBPB 1T3FA 4TTGA 4JHBA 2P7TA 4P4KC 3DV6A 5DA4A 4KAQH 4CNIB 2A73B 2VIRA 5DFVD 3P0GB 2G75A 2HJLB 4YPGB 1PGRB 5D72H 1BWWA 3ARGD 2XQBH 2BVQB 4YBQD 4L8SC 4PJCE 4X6BA 3PG2A 4DN3H 3U9PH 4JG1H 1YEKH 2HTLC 5F9JB 3NFPB 3C60D 2IAMD 3DO3A 3GMRA 4HF5H 4AY0A 3SQOH 1EMTL 2CH8A 4K7FA 4PGCA 1QVOA 2X6MA 4XVJL 4F15B 3PWNA 5F97E 5INDA 4TUJA 3FN0L 2Z0BA 5F9WB 3MLXH 1MWAL 4A6YH 1KTLB 1OGAD 4NHCH 5GGUB 3GBML 5C8JA 4ZTOL 5I1GH 1IEBA 4OF7A 3UROR 5KSAB 1EERB 3O45A 2AXFA 3HB3D 1YEDB 2K1MA 3ULSA 1MLBA 3JTTB 4YXHH 4YO0B 2JCCB 4KZDL 5T5NG 2E7LC 4XCCH 2JKXA 1S7SB 3W9DA 3V0VB 4ZPTA 1TTUA 5FOBB 1G7LA 3WIIL 1BFOB 5CJQH 3BIKA 1GSMA 2FX7H 1HEZB 4URTB 5F1KC 3BH8B 1TXKA 1KB5A 2IPUG 3N1PC 2X4SB 2K7PA 3PGCB 4BSVB 1I3VA 5D7LE 2PF6A 1H0DB 4PJBB 3KR3L 1PKQA 4MD0B 2VDML 4HV8B 3UJIL 4Y16A 2H45A 4HEME 1D5XB 2XTLA 1B4JH 2R2HA 3UYRH 3O11A 3TH2T 3QA3A 5C1MB 2WBJD 3MV9E 4I3GA 4M7ZC 1LP9F 3QXAB 5K9QI 2JIXD 2R1WA 2ADGB 2GIYA 1IAIM 2PN5A 3KYOB 2COQA 1I8KB 1B3JA 3TF7C 5C0CA 4JZJC 5KSVA 1I3RB 1O5DT 1F2XK 1LNUA 1RULH 2P1YA 4WUUD 1FZOA 4HDIA 1ACZA 1WC7A 4HQQH 1G7JA 3ZDYE 3PWJA 4XGZA 1F8TH 3V5KB 3WNPA 4NGHH 2DIBA 3AXLA 4TSAL 4KI5F 4Y2DC 4NZRH 5E9DE 1W8OA 3RVXC 2JJSA 3T2PA 3P0YL 3I6GB 4WHTA 4ZFFA 1NFDF 5BO1H 2Q8BL 2EYTA 4Z6AT 1MAJA 4Y1AA 1MRCH 2FZ3B 3BN3B 3UBXB 5I1LA 3C2SA 4OD2A 1KF9B 1KGCE 3CU7A 2I9TA 2VQUA 3K3QA 2EXYC 2QQLL 1QFWM 4OF8A 1BBJA 1C7SA 4NRYB 4I5BA 3SGEH 3ZDXF 4U1GC 2ZUQC 5H2BB 3SQBA 4RFOH 2AI0H 4XX1E 4G3YH 2D31A 2IPKA 4TNVF 4LLQB 3ET9F 1WITA 3SN6N 1E4JA 5MERB 5ID1A 2GUOA 1D5IH 3TCXA 3MV9A 3LKSA 4YLQT 3D0LB 4WCYH 5T3XL 4EZMA 5HYQB 4U1JB 1IGIH 5LXGL 1CBVH 4IDJL 4TULH 4IHOA 5BZDB 1OB1B 2Z35B 5D7JB 4XMPL 3VGFA 4JFZH 1BFVL 1A6UL 5GS2H 5D9SB 4PJ9A 3KPSA 4NQCB 2R4SH 3K1KC 5HHXL 2R1YB 2Y23A 3BH9A 2HKHH 2ARJB 1A5FH 2JF1A 1RURL 1MAKA 1QTYT 4C58B 4JM2D 5CJ5A 2AJVL 3IJYA 3MCKB 5MHSD 1JRHI 1G6VK 1Y0LB 4TUKH 2DQUL 3MLRL 5I18H 3QDMA 3N1MC 3EYSH 1WQVT 5FO9A 1FE8L 1GC1C 1WWWX 1S7VB 1EHAA 2EDTA 3V5HA 4RAUA 3W11D 2PO6D 4Z7VE 4KJYB 4YWGL 5ETUA 1KIPA 1RZIA 1IT9L 2Z92A 5J1TC 2WBWB 4ONGH 3IFPB 1UXWA 5IVNA 1MRFL 3BGMB 3IKKA 4NSKA 5D1QB 2X9YA 3B6SA 5HPMB 2FWOB 2AK1L 1WT5C 2XKSA 1RUQH 3BEVA 3MRCB 3VG0H 3LKNB 4ALAH 1QBLL 4N90D 5JDSA 1WIOA 2DYPD 1C5BL 5B4MC 2ZG1A 2VXQL 1C7TA 3SDXF 3U0PA 4QRTA 1RSFA 2P5WE 3E6HA 4P2QB 1WWAX 3QBTB 4Q2ZB 5I8OL 1WISA 1ZGLA 1UT9A 3QEQD 3RKPA 2AABH 4E41A 2EDJA 4MA1B 4NPYB 5DEFB 1T4KA 1C08A 3D2UA 2WINB 4Y4FB 3U82B 2P4AB 1HCFX 3KDMA 4LKXB 4GRWB 5D7LB 1JZ5A 3QUYB 3DX8B 3QEGL 2AQ1A 1F58H 1U8QA 3NIDE 3RTQC 1NMBH 3WNOA 2VQ1B 3KPLB 1U8PA 5MEQB 3BXNB 4P4KA 5EUOB 2XN9D 3EJYD 5K9QG 2NY2D 5IR1B 1ZEAH 1MEXH 2ICWI 3U6RB 3RWGB 1KG0A 4POYA 3TVMA 4XNYH 5CKAA 5E6ID 4Q9BA 3JTSA 3WJLC 4GAGH 2R0ZL 3SKOB 2ZJSH 3HLAB 4N1CA 4K7PY 5FYLH 3DLQR 3KS0H 2VLRA 4MQXC 3WIHH 5JXAH 2XWTA 4TVPL 5EBGA 3HC0B 5CD5C 1TCRB 1IQDA 5CIPH 3N50A 4E5XA 1CR9H 3CDYA 3VD3A 3EJZD 4KI5D 3BO8B 2E6JA 1G7QA 3U1SH 5E9DB 1N5AB 5I74B 4XMKL 4QXGH 1MJJB 2P5EB 2P5WA 1S9XB 5EBLA 3ETBF 4UB0H 2AXGA 5SX5K 2YR3A 2VN4A 2X89D 1ZHNA 4K71B 1AC0A 3RGVD 1N59A 1CIUA 4XNUL 4OF3A 3ZE1F 5IK3A 1J0HA 5EU6E 1BD2D 3N1GC 4X8XA 5DJ8A 2V5RA 4GKNB 3VFNA 4M5ZH 5D2NE 1FZJA 1JNHB 3V7AE 1EFXA 1S9YB 2IMMA 1QR4A 3NIFE 1EHLH 3FRPA 3FQRA 3KPTA 1IQWL 4FTVA 2NTFA 5IF0B 4FQLH 3PIQA 5ICZA 1DBML 3ZMRA 5AWNH 2F9BT 2E27H 3TWCL 3BD5A 2VKWA 2DTSA 2RFXA 1X5ZA 4QT5A 2OMBA 1T66D 4X9HA 1OW0A 5HGBB 4MJ4A 3JXAA 4ODTH 3NN8A 2FEEI 1XGPB 3NGBC 4M6AA 3ZE2E 5CD3A 2GTWA 2Q6WB 4D94A 4X7SH 5E03A 3DETD 5DA0B 1A22B 4K8RH 4WI6A 4PRIB 5ISZD 1N3NA 4GMTH 3GHBH 2A6JB 3DXAD 5GS0L 4DKEL 1KYOJ 3QIUD 4IS6A 3IXAB 3ARTA 4I9WE 4HUVA 3MGOA 5IG7B 1WSST 1ZAGA 4JZJA 3QSKB 2APTA 4JKLA 1EO5A 5IB3A 2UYLB 3C9NB 4KGLA 3EFFA 1HHIA 5F7HA 1IGJA 4JVPA 2E9IA 1JWMA 2EC8A 3ILPB 1YYMH 1FYTA 5DJAB 5I71C 4Z7VB 2A9ML 3SDAB 1ZT7A 4Y2DA 2XZQL 1YUHA 3KPOA 1YMHA 2DQDL 1P4BH 2VXVH 4PJIA 1OPGL 3MJ9A 4HGKC 4B7IA 5DJXB 5JW4Q 4G6KH 5J56B 3H2WA 3W0WB 2OR8A 1FZMB 3P4OB 4PJ8C 2J6EA 3VD4A 3TC9A 2IG2H 2MJWA 1OAQH 4OLXH 4S1QL 5CSZB 3EYOA 4G5ZH 5C2BL 5T1LA 4Y19D 1FVEB 5EZOH 1J1OL 4I8DA 3ZHKA 5EC1B 2WW8A 5C6PB 1DQDH 1NGWB 2YD4A 5DD6B 1G6RB 4N8VA 2EYRA 2JJTC 4OGYH 3PUCA 2ICEA 2CIIB 3IT8D 3OKDA 5FDWB 4QXTB 3IFNH 3AGVA 4JCMA 3UYOD 4G6FD 4IRSD 4ISVB 3QYCA 2APBA 3BP6A 2PXYD 2BVOA 4WW2F 3EFDH 2MQCA 5MP6L 4QTHB 1RUKH 5I66B 2YUZA 3NH7H 3NCJH 4JFYB 4Y5XC 4L4TB 3WFCH 4OI8A 3H0TB 4OD3H 3VD9A 1G9EA 4J3WA 3NAAH 1WZ1H 3IGAB 3UPAA 2B5IB 2B4CH 1EX0A 3VWJC 3KLDA 2VITB 3CH1A 4JB9L 5F3HA 1OHQA 1VFBB 4NBZB 3QUZB 1OAKH 3BVNA 3VWKC 1SBSH 4K3DL 4PJ7B 4L4VB 3DMMD 3O2DL 5DZOA 3WD5H 4KK8C 3RZWA 4Y5YC 3MGTB 5D2LE 3IS0X 4QGTA 4XH2B 2OL3L 5D7IB 5BRZD 1LD9B 1MHCA 1NMCC 4HLZH 1BLNA 1ADQL 5I9QB 2QSCH 3MBXL 5GRVK 5B38B 2EDFA 4PV9A 1OAZL 3BKYH 1HKLH 3RVWD 1RZ8A 5JHDD 1DCLA 5J9PA 3QR2A 1X5AA 2GJJA 2FJGA 4AJ0A 5EWIL 1QLRB 5BMFH 5E70A 3O81A 3QCUL 5GRXG 5L6YL 2HP4A 2ITDB 4CDHA 1U91B 4YFDB 3NABL 3TT3H 1AGDB 5EU6B 1XR8A 4YAQB 1TLKA 1IEAA 5D2NB 1MF2H 5GGRA 4LSSL 4M48H 4C56A 2LTQC 3LN9A 3P40A 5IB5B 4B0MM 5DGRA 2YSSB 1H3WM 1TVBA 1XIWB 5I6XB 3FOLA 4CU8A 3U2SB 1TTGA 1I1AA 3WDJA 5HHQB 1FO0B 4G7YH 4YHIA 2O61A 4S1RL 5CKGA 1RU9H 4OGXH 4OM1H 2HH0H 4DQOL 3ULUH 2DBJA 3HG1A 1NJ9B 4FXLA 1S8DB 3F7YB 3WFBH 3AREC 5D2LA 1J8KA 1R0AL 5C3LD 5C70A 4OFDA 1I9JL 2G9HB 4X6EA 1I9IH 1M4KA 1FL5B 4JDZA 2CMRL 1YMME 1JN6A 4PS4H 3ZKMC 1MJUH 2P8PA 1T21B 4FP8H 2R0KL 1I7UA 4J1UB 1RJYB 3WMSA 2AJSH 4JANB 5KN5A 3WJLA 2DJ4A 5CZXD 2W0KA 3REWA 2HFEB 1T80A 1T7YA 4PRBA 3JUYA 1EBAA 4F7TA 3E8UL 4XNMB 1DSFH 3KPPA 5F6HI 2YPKA 2DKMA 1AGCA 3NZ8A 5B39A 1A4KA 5DJ0B 5D5MB 2AEWA 4AEIH 4P2OC 3WNKA 4MNQE 1HYRC 3U7YH 1S9WB 1D5BB 2OSLA 4Y4KA 3O9WC 5DJCB 3FOMB 4Y4HC 5C08D 1A1MA 1MCOL 1BEYH 3SCMD 3QWRA 4KRPB 1YEHL 3C87A 2VJXA 1K4DA 4KWUA 3CSYA 1YZZA 1FORH 3VXME 3WS3B 2R1XA 3C08H 3PWVA 1A7QL 1BAFH 1LO3L 3SE9L 5JR1H 3K8KA 4WJ5A 3LQAL 1G1YA 5GGTL 4JCLA 2X4RB 1RZJH 2ADJB 1KTRL 3V6OC 3DSFH 2CK2A 3GMMA 4JFPA 1OP9A 4R7DA 1CLZL 2CRIA 3FJTA 3N1FC 4KMTH 4OCXL 4X9IA 3SE4C 3WKNA 1F4YH 1I9EA 3KG5A 3L3HB 1AKJB 1FJ1B 1JNJA 1KCRH 2BNQD 4LLDA 2EEDA 1IBGL 3GGWB 1L0YA 4UQ3B 5D4QA 5IBUG 1FG2B 4OCSH 3V6FA 3I6LE 1IILE 1QPXA 4F58H 1AXSB 2NY1B 1OTSC 1AFVH 3EHBD 1XGTA 2EKJA 4JO2H 4F3FB 5JW5B 4Z0XB 2VAJA 3QQ9D 4LBEB 1EJ6A 3U30B 4MNHA 3HC3L 1RIVL 5ALBH 5DO2D 5GGVL 3GIVB 4PY7A 4N0CD 4OZIF 1TJHL 4N0FA 2VLJA 5F1IB 3O4LB 2KZ1B 2D2OA 5ENWB 1MCEA 1IGCH 3D87B 4U1NB 1NCCL 4LLYA 1A6VL 2OJZH 4H26A 1IAOB 2B7DT 5KG9A 5EOQL 4QRUA 3QO0A 2NXZB 4NJAH 3WFHA 5I1IH 5F9WC 4W6WB 4MNQA 4OUUB 5GGRY 5ALCL 3EGSA 4M8QB 4ZS7L 4LRNH 4EOWH 4A2LA 5KSAC 2F5BH 3SO5A 3SDCB 3S34L 4GW5B 1A7OH 4L9LC 4HWZA 1QBAA 2FJHA 3TV3L 1JNLH 4WO4D 1YNLH 3QPXH 2F15A 3MRPB 4HH9A 3EW3B 1N8ZA 4HXBL 2XZZA 2RBLA 4MZ2A 4PJ8A 5JOPD 5FUCE 4JE4B 1QSFE 4WWKC 1DFBL 1AXTH 1DN2A 5LG1A 5HYSB 2DDQL 3A6OA 4LAJH 4KJPD 2NY7L 3S9DB 3RAJH 4HJ0C 5EO1A 2GJZA 1FYHB 2HJFB 4PRAB 4K2UH 2X4QA 4LVOB 2VL5B 2NW3A 1HYSC 4Z78A 5JIHA 4HWUA 3OKNA 2XWJA 3MLYL 4UI2A 2P47B 5B8CB 1D6VH 1ZSDA 2VC2L 2V17L 4BH8A 4O5LH 5GGQL 4JPIB 4NNXB 1PJ9A 4U6HA 4XP6L 4R4ND 4YUEH 3K4ZA 1JWSB 5IFAL 2NY5H 2ZCHH 4K3JH 3EO1A 1NGYB 5TE7H 5A3IC 5D1ZD 1DQQB 1IM9B 2DMBA 1FDLH 2Z8WC 4WI7A 1FL3B 1AGEB 3I2CH 5DR5H 2DQGL 5JIKA 3X3GH 3NPSB 4LEOB 4QXUL 2Q3ZA 2J7LA 5C0GA 3MLTA 1YMMB 5IKCB 5A1AA 2P44B 4KKNA 1U58B 4PGEB 4GSDL 4CMHC 4DGYH 1ERNA 5L2KD 1RIUL 2WIIB 3STZA 2BFVL 3ZHLA 4EDXA 4O2FA 1U95B 4J3XA 3WNMA 1QSFA 5DD0H 2E6QA 4P2RA 4Z76B 4Z7OF 2VDOL 4FXKA 1OQXA 5ADOL 2FECL 4RWYH 4XPTH 3RDTD 1CF8L 3BP7A 3BWAA 5KVEH 1JI1A 3GSOB 3QUKB 2O5ZH 3FT4A 3VI3E 3HAEA 2E7HA 2MMXA 2EDDA 3NTCL 1LEIA 3QUXA 1ZE3C 5LGJA 3TZVB 3B2VH 3VXMB 3O3BA 1HINL 1LDPH 4WHYG 2FYYA 1QBBA 2EC9T 1K8DA 3BZ4A 3ZYZA 4OI9A 4YHNA 4S1DD 4TN9A 3W2DL 1GHFH 2BVPB 2GK0B 3GMNA 1NLDL 1XF3B 5D7JC 4IIQC 2LU3A 1K4CB 2CUHA 2AK4E 5DUBB 2FD6L 4RMUA 5KS9B 3FONB 3HR5A 1UFUA 4ZPVB 2LV4A 1EEZA 2P43B 3O8XD 3UYPA 1ONQB 2M1KA 3ARXA 4MMZC 1EHNA 2VLKD 1AO7E 3FTGA 3RL1B 4PRPA 1MY5A 1A1NB 3FFCB 2VDRH 4YQXH 2WP3O 1ETZA 4GRLD 4FNLL 4ZQKA 3MPCA 1L4IA 4LPWA 3BPOB 4QRSA 3S5LG 5DT1L 4YDKH 1J8HE 1JYWA 2KDGA 3MA9H 5GRYA 1NEZG 1VA9A 3DX7B 3C6LB 3RI5K 4JFFD 5JW3L 1JPSH 3BDXA 2DBLL 4RAVA 5JHLH 3LRGA 3QDGB 4JFXB 3KYKH 3TYGH 4KUCF 5D1QC 4RZCA 1JPTH 1JZ2A 3RWFB 3KPRD 5ESVA 4YZFE 3CFCL 2PW2A 4MLIA 1BIIA 3G5YA 2IGFL 1MVUA 1RUMH 5EZIH 1HNFA 4NM8L 4XC3L 3TBVB 1FHGA 5LJYH 1JNNL 1KJMB 2KBGA 2LVEA 4NQUA 1IC4H 6CGTA 2IALA 1CDYA 4RX4D 1MQ8A 5J8OA 1T1YB 4KJWD 1I8MA 3MLWH 5FYJU 4CRPA 1K6QH 2R56H 5DMGD 1IKNC 3MXWH 4NUJB 7FABL 3NCMA 1NBYA 1J11A 1JRHL 1R3KB 1FAIL 2OBGA 3H7LA 1CGYA 4KFZC 5DMKB 1REIA 3QQ4B 1UWGH 3MV8B 4P5TD 3P4NA 2ADIB 4S0TD 1O0VA 4XP5L 3OGCB 3QUYC 3C5JA 3V6OA 4MX7A 2GITB 1TVDA 1XZ0B 4Z8FL 2YPLD 1NGPH 2BSRA 1FRGH 2E5EA 3B9EA 3A6CH 3LSOB 3R06B 5HYFA 3L7EA 2CDGA 3LIZH 2NY6B 3AS1A 5DRZA 1F4XH 3OKLB 1E6JH 1FG9C 4AG4H 4X6DB 3ROLA 4YHPB 2VDNL 3O6LL 1DLFL 4LARH 5DTFB 2MHAB 2PTTA 2RCSH 1S3KH 4RBPH 5EO0B 1LE9B 1INDH 3ORJA 3ECBB 1LO2H 3BN9D 4DCQA 1URLA 2C1PA 5E94B 3CVHL 5C07D 3S4SA 3VFGH 4WW1B 1LDSA 3JWDH 1NEUA 2J3SA 3FB8B 3QZWG 3VXNB 3LEYH 1AE6H 1B0GA 4G9FE 3E6FA 3H3BC 4PJFE 5BJTA 3HS0A 4LEXL 3G5XA 4P9HC 4RDQG 1P9MC 2ATPA 5F7KC 2GY7B 2O26U 4WI3A 5I74C 3LB6C 4HHAB 4UOJA 1JP5A 4S10A 4BELD 3GSNB 5E7FA 3RX5A 2XTJE 3SE8H 4D8PA 1U6AL 1F5WA 3U4AA 1KSRA 4KDTC 4K71C 4XPGL 1YEDA 1DTUA 4L9LA 1L6ZA 4LCUB 1F13A 1KB9K 1UJ3C 5FYJE 4YXLH 2HRPH 1NUDA 3KPNB 1NCTA 1A7NL 3VXRE 1QBML 4AT6B 4WWKA 2R23B 1S7SA 3V0VA 2IJ0C 3D18B 3RQ3A 3LMJL 4G6AD 4PJGA 4X6CE 2MCPH 2WBKA 3DTXA 5ESQA 2GCYB 4DOHE 2VR5A 2D4DA 4MD4B 1Y6NR 4PBVC 4R2GD 4ODVH 1RIHH 4KRMB 1NCAL 3WJJC 3MLSL 5DUML 1YEEL 4Q6YA 5KVGL 2QL1A 4OM0H 1G6RH 2AK4B 5EZLB 1WFOA 5DUPH 3ZHDA 2ADFH 2Y06L 2Q86A 2VXTH 3LEVL 2EH7H 4M7LT 2F58H 2DLTA 5EUKA 4XPAH 2E6PA 1Q9OA 4HC1L 1CFQB 4XPHL 3LAFA 4CUCA 2BP3A 1CT8A 4M5YL 2LVCA 4G9FA 1AO7B 4PJFA 1I8KA 1MCDA 1UVQB 4UUJB 3QRGH 1T20A 3TO4D 3MCLL 2XRAL 4U1IA 2FATH 1Z3GH 4J3UA 3UXFA 4KTEL 4XXCC 1A47A 3PDGA 1WBZB 1XGRB 4J4PD 3K4DA 4GUPB 3O2VH 2LAGB 3OPZH 2H3NB 2YA0A 2DM4A 1HHHA 4D0CB 1JHTB 4NCC2 1KCSL 3G04A 3TN0B 1T04A 1ZV5A 3SDAC 3FO0L 5EU4B 4EXPX 2W9EL 2QADD 1ZT1B 4PYHA 4HXAL 2A77H 5I8CB 1E27B 4JM4L 1YJDL 2ZOKB 3SDDD 1WCQA 4PJEB 3TA3A 4WTXA 5ABDE 3RZCD 5FGCE 4I48B 5EORL 3LVEA 2FEEL 2X4NA 1PG7L 4TUOB 3T0VA 4ZO7A 4X6CA 1EEQA 2JJUA 2WSKA 1A9EB 1AHWA 1KJ2L 1Y6KR 4ZS6C 2I26N 4U1SA 3TCLB 5IQ9A 1RFDL 2GHWB 4LFHD 4KK5C 5CINH 1S7UA 5DEGB 4JFDE 1QO3B 1V5JA 4FQCL 4RNRB 4KJQC 1UWEH 3QDJB 4HKJB 4TOYL 1YN7A 3WNLA 5MERA 4WFGD 4XXDB 2DM2A 3MO1B 4OCWH 5BS0E 3H9HA 4DVBA 1N2RB 2CLZA 4OZGF 2HG5B 4UQ2B 1YEJL 2OR9H 3MRMB 4U1JA 2BC4B 3MJ9H 2DLFL 4I0KA 1JWUB 1B6DA 1MAML 1RJLA 2J5LB 2Z35A 4IIQA 5KAQF 3MNWA 3HRZA 4NO2A 4AK1A 3TBTB 4LAQL 2J6EH 2ATKB 4X5WA 3BHBB 2VR9A 4JRYE 3RKDD 2R1YA 4MCZB 4P9MH 1JGDB 3IDNB 4KKCD 4PV8A 2MNUA 2ARJA 2B5IC 4CADB 2A1WL 1X4XA 3QUZC 4M1CC 1ZHLA 5SV3A 3QDMD 2F53B 4UIKL 3OAZK 1QRNB 3IS1X 5SWQB 2YUWA 3LKOA 1CDIA 3UC0H 3EYFA 2AW2A 1L7IH 1T6VN 5HHPA 4UDTA 5ICXB 1JIBA 5TDOB 2DLHA 1DQLL 4N1HB 2XG5A 5F7NC 5GRZA 1P7QB 4XRCB 3RWCA 4PJIF 4NJ9H 4MJIA 4WV1A 3T2NH 4NN6B 3QNYB 3O6ML 4IRZH 1RHHB 2VL4A 5J1AB 2X10A 4F2MB 4MCYB 4QGYA 2EDKA 2BNRB 5T1MB 3H7BB 3JV4B 3C5ZC 1TVHB 3RWIA 2A6KB 3LH2L 2X4PA 1IKNA 3MACL 4P2QA 5D2NC 2Q8AH 3VXRB 3V8OA 2EDRA 5FXCH 3CFDB 4LLUA 3ARBA 3VA6A 2X4UA 4XVSH 1J0KA 2ZSVA 4F9PA 4XP1L 1EAPB 1XIWC 5I6XC 3KYMA 3QCVL 3QHZL 4FABL 1UZ8B 3Q6FA 1H15B 3T08A 3PE9A 1HZHH 4X4YA 4PJDF 3DX8A 4CGTA 3MFGB 4APQD 5INCA 1FH5L 3UDWC 3ZSTA 4QHKJ 4P4RB 3JWNC 3VFTB 4BA8A 2DOCA 5I1DA 5MEQA 5IBUB 1H3PH 1EZVY 3IU3B 1E4WH 4KPHH 3WFDL 4NRZB 1H3XA 3G6JE 3NIGE 1QKZH 4IJ3B 3U6RA 3WO4B 4TVPE 4QNPE 5KZCD 4GG6A 4PJAF 3ROOA 1KIRB 1EXUB 3CFEA 3GMQB 1WAAA 4X4ME 4KTYA 3CPLA 3V4UH 1MCHA 2D0HA 3VMNA 1KT2B 2EYSB 1XCTB 1MREH 5L88H 3JV6B 4Y7MA 1DUYA 3HC0A 1B88A 4PLJC 1Q9WA 5E1AB 5ID0B 4L3EE 3C09B 1X6NA 5FYKD 1MJ8H 2XKUA 1P9MA 3W9EB 4U6YA 2FIKB 2P5EA 3UPRA 1LE5B 1T6WA 3QEUB 4NOFA 1U3HB 1CK0H 2IANE 2QHLA 1QSEA 1OTUC 3BAEH 4E0RB 5EG6C 2ZWLT 5EIVA 1KN4L 4KRPC 5FGCB 4FQHB 3C8KB 4JHWL 4PRHA 3U0TB 1KPRB 1UJ3A 4M61B 4NM4L 1ORSB 1G0XA 1LEGB 4U3HA 4LHUA 2Z91B 2B2XH 5M95B 3BDYL 5E8EB 3ZKNC 5FO7B 2BHUA 1S9YA 2V9QA 4FFVC 1KN2H 4JFDB 4JO4H 3LKRB 2SEBA 1FLRH 3F8UB 1DE4B 1OAXH 2BOCB 1Q1JL 1IGFL 1T7ZA 4YFLF 4LVEA 4E42B 2CQVA 1U3ZA 3ARDB 3ARWA 3G6JA 4LPYA 4R4FL 4Z7QF 1S7RB 3NACH 3M45A 1XEDA 1A3RL 2FJFB 2L7JA 1XGYH 2NY1C 4RGOL 3O6FB 5H35A 1MJ7H 1I7RB 2B39A 4XAKD 2BVYA 3VRJA 4AMKH 5DMJB 3THML 2A83B 5E8OA 3U30C 1ND0B 3JWOL 5ITBH 4G8IB 1XGPA 3VU2A 4OLVL 3MV7E 3HPLB 3DVNB 3MUZ1 3MJ7B 1Z0NA 3W5NA 4UTAL 3HI5L 4MHHI 1KC5L 1MNUH 1G7HB 3QO1A 1PLGL 5BOPA 3KAAA 3NFSL 1KXQE 2NXZC 4H1LA 4G8GB 5GS1B 4U7SA 1JPGA 4Y2DD 5DD3H 3RVXD 3SDAA 3SDCC 1BQSA 3FQUB 2PYEA 1CDBA 3PHQA 1I4FA 1CZ8H 3W0WA 5JA9A 3P4OA 4CMMB 4HCRL 4L8CB 4L29B 5I1EL 3CFBB 3GM8A 5T1LD 3MRLB 1JTTA 5TF1H 4X99A 1SY6H 2I9LB 2H6PA 3L3OB 1C1EL 4FZEL 1VEOA 2EDBA 3FB6B 4X6FA 4GW1A 5EC1A 5TQ2H 1MFCH 1VCAA 2BSTA 4LVOC 4C55A 2IFFL 2UY7A 4LSPL 5DD6A 2Z31B 4K94C 1FC2D 2GFBB 4ZFOB 2ZUWA 5B8CC 3FL7A 5FDWA 1M7IA 4JR9H 3BP4B 4QXTA 4WY7H 3H3PL 4LF3B 5H37H 2E8YA 2GSIA 5F9OH 3MV7A 2NY3B 4ZOAA 4ISVA 1NL0L 3MBEC 4OCYH 1B2WL 1ZS8A 1CVSC 3B8YA 3A6BH 1VDGA 1JGEB 1MCIA 3AY4A 2PCPA 1MCWM 4QTHA 5I19H 4KXZH 1MFEL 4FQ2L 4LCCA 5GJSL 2IEPA 4L4TA 3VFRB 4XZUB 5C6WH 4ZUUB 3H0TA 4I2XB 2Z93B 2VITA 5I1CH 5E8PA 3WE6B 2R8SL 2ZNWA 5IP4A 4PJ7A 5IQ7H 5AEAA 3V2AR 4F57L 4ODSL 4RIRB 1UB6A 2CKNA 3MRKA 4OIAA 1HKFA 3ARFB 3MGTA 1B0RB 2OI9B 2YD3A 3D85D 4XH2A 1HSBB 2R2BA 2LFGA 4XBEH 3S5LB 3DROB 3GSUA 1NEZB 4G6JL 5E2VH 1UQSA 2WWMC 4EVNA 1OM3L 1YDPA 1KLFA 4XC1L 1H3GA 3T0EC 4AENA 1CFTB 1FFOB 4K9EL 5SWZB 2B1AH 4L3EB 1UYWL 4M6MH 5IVXB 4PJ5E 5SX4H 3IFLL 4CJ0A 1AIFB 1JJUA 2V7HA 2EDXA 4M02A 1H5BB 3WFEL 1AD0A 3D39D 1TJIL 4GMSH 2IANB 5B4MD 3GNML 3VDAA 3SGKC 1OLLA 1NLBL 1RUAH 4RRPA 3C5ZA 5IEHA 3EDJA 2C7UB 4NWUH 2HLAB 3CLFH 5CFHA 5EU5B 2AQ3A 4W4OA 3G5VA 4UINH 3G6DH 4U33A 4C56D 2YXMA 5GS2D 5IB2B 3QHFH 5IFJA 1GGBH 2VOTA 3S37H 2C4FT 5IB5A 3OKOB 3ULVC 3DECA 3HNVL 3MXVH 3O2DA 3U2SA 5D6CB 1K5NA 4F7EB 2OL3A 3TJEH 5MENB 5FA3A 3R4DA 4OIIL 3RTQD 1Q94A 2NLJB 3HG1D 4HUWA 4NQDA 1YYLH 1OL0A 4PUBL 4NQVB 3HAEH 5EA0L 5CJXC 5E5RB 4MA3B 2PR4H 5TDPB 1AI1L 1LO4H 3CC5A 1DVFB 1B4RA 5IB1A 4HFWB 2W59A 1V7ML 4HUXB 4ZFGL 3ZL4L 3IETB 5C0AB 4ZDHB 3QIWA 5EO9A 3BPOC 1WK0A 2Y5EA 3TBYA 1NAMB 3I6KA 4MHHG 3C6LC 4LP5A 3BKJH 5FOJA 3NBNA 1EO8L 3HPJA 5C0BE 4MQXD 5J6GB 4PJ5A 4PLKC 5E0QA 3GI9H 5CD5D 1WEJL 2H1PL 2X1OA 4QOKD 2NZ9C 4HIIB 2BSSA 1E4XI 1CICA 2W9DH 5DHYA 3Q3GB 1AR2A 3RPKA 5KAQG 2C3HA 3RU8L 3BSZH 3T3PE 3QPQC 1QD0A 3LQZA 1A14L 3ARYA 1P4IL 2XYCA 4TSBH 4RISH 1NC4B 4JPVH 4F8TA 4YHLH 5DK0A 2BRRL 4PD4J 3GSNH 2ZCLH 5JO5A 5KSBE 2VRAA 3WHXA 4BSWB 3DVGB 3QUMA 1P2CA 3RNQB 5JXEC 1Z5LA 4QHUA 5E2UL 2ZOLB 4Q0XL 1I7ZA 2FNBA 5KVDL 2XZCL 2CDFB 3ESUF 1EHXA 4JQVA 1G0YR 3SKNA 3VW3L 5E8NB 4QRPE 1J0IA 1U8MA 1BVLB 5D1XA 3PL6B 4XCYB 1AGBB 4H5SB 1OP3H 4ERSH 1HH9A 1AKJA 1I85A 3VXUA 4HIHA 5BQ7B 4OZ4B 2EIBA 2AKRB 2ITCB 4MQ7B 4KV5E 2NY6C 3OKKB 1FG2A 4MDJA 1RZFL 1QR1B 5JUEL 2H26B 1FZKA 4NQSB 3U36A 1A7PH 2V9TA 3R1GL 1UM6L 2DQJL 3VFVB 4PRDA 3BZFB 4YNYA 3O4OB 4LBEA 1XMWA 3FQNA 3QG6B 5C0BA 1KEMH 1T0NB 3MREB 1UM4H 3GIVA 3L5XH 1SVCP 3O3DB 2VLJD 3PQYA 2AEQL 4PR5A 5E2TH 4R8WH 4CVWA 4OCMC 2KQNA 3RUGE 5CZVH 1WZMA 1CFSA 3WO3B 2DQEH 3PDOA 2CKBL 2ERJB 2QHRH 2UZXB 4YGVA 4ORGB 4CDGC 3IDJA 5FM5O 3SBWC 4AEHL 3OAUL 1E6OL 2EH8L 5SWSA 1G7IA 4K07A 2X4TA 1Z0MA 2AV1B 4YK4B 3P9LB 3T0AA 1OWRM 2X7LA 1U8KA 3EDKA 2DJUA 1TFHA 3I9GL 5DHXB 2YA1A 3MJ6A 5E4EB 3VDBA 2FB4H 3BIBX 3VDCA 1I9RH 5IV2A 4PJ8D 5ANMB 5AYUH 4LOUC 5CSBA 4MNGE 3P9MB 7CGTA 1OAUL 5EOCJ 1A4JA 3EUUA 1MIMH 2Y5TB 2W38A 3L5JA 4IRJA 2VLLA 1I1YB 1JGLL 2EDOA 5F8RC 2AV7A 4JM2C 2FH6A 2CD0A 4XCFL 2J88H 3OJ2C 1T1ZB 1ZVSA 5I76A 2HJFA 3KPQB 4OV5A 1TITA 1BFSA 1QLEH 3CXDH 3W39B 1JUFA 5C6TL 3GIZH 3IB4A 1N0XL 4HS8L 1W72L 4L5FH 3Q6GH 1HXYB 5J1SC 2BNUA 1CD0A 3LHPL 4JPIA 5IVZB 1UEMA 3LKPB 5ERWB 3WIFB 4MYWB 4CAGA 3MBEA 4NO0B 1FPTH 1IGYB 1NGYA 2EZ0C 3RUGA 5L8KB 1MFDL 1MQKH 3V5DB 4LPCA 4QTIL 5C09B 1DQQA 4JJHA 4JJ5B 1CD1B 2AJUL 1Z9OA 3VFMB 3F12B 4N8CL 5EOCL 4JFED 3VWJD 3EDFA 4LSVL 5C2UB 3U79A 2LU7A 4HK3J 3VWKD 1PY4A 3H9YA 5IKCA 5DVNA 1T1WB 1HILB 1U58A 4R4BB 1II4E 3UTSD 3VMOA 4JY4B 1TNNA 2ZCKL 2WIIA 1EMTH 1F90H 5CUSL 2P42B 3PWLA 3UJTH 4XVJH 4MNGA 4PRNB 4P2RD 3BYTA 3PJSA 1SJHA 2P24A 4MMXC 4Y5VB 1MWAH 1G0DA 3T0EA 4ZG1A 2FX9L 3SGJC 4NN5B 3GBMH 2BVUA 4ZTOH 3HE6B 2VABB 2P8LA 3QIBD 1TZHB 4K3HA 1F3JB 2XA8L 2YS4A 4QRRE 4ZYKB 3REVB 1VFOA 3PWPE 4JVWA 3QDAA 4HT1L 1WBYA 4ZSOB 1EH9A 1WFUA 4BQBA 3EOBA 5KSBB 4KZDH 2CXGA 3WS6A 1JGUL 4PJGF 4JAMA 3RVVC 1KB5L 2P8MB 2B8OT 3BP5B 1S9VA 4YDJA 3ARGA 4JHAH 2RIKA 3B9AA 3RWJB 4UT6H 5BV7B 1SEBA 2CLRB 4PJBF 4KZEL 4GAYB 4QHLB 3MOBL 4JN2B 2GK0A 5KJRL 3C60A 2IAMA 4QRPB 5ACZB 2J5LC 2BMKB 1DBKL 3K2UH 2J1KA 4JQXC 4X7EC 4WU7B 1T1XA 2YD2A 5J57B 5DUBA 5E00B 3MX0A 5AZEL 2BRQA 1F45A 3S37X 2F74A 3UJIH 3DRQA 1KPUA 3OKEA 1JHLL 3TO2B 1OGAA 2DQFA 5AUMB 2YRPA 4EIZC 5K9OB 3P9WB 4WUUE 5IJKA 5FGSA 1AP2A 3ARED 3RL1A 1XF2B 5CJXA 1C5CH 3UTQB 1FBIL 4ONHB 1U8HA 4G7VH 4F80A 3UEZA 3RBSA 4BM7A 3P77B 3ZKMD 5GRWA 1BWMA 3FB7B 1YY8A 5CZKA 1HDMB 1U2HA 3DX6A 3C6LA 5GGVY 4KY1H 4QYOB 3WUZA 3QDGA 1F4HA 1RJZB 4MSWB 5F72S 4HIJB 1XT5A 2VZUA 3QFJD 4CL7A 5GIRB 4NN6C 4TSAH 4KDVA 3V4VL 4P46B 4EN3B 1ZVHA 3P0YH 5HHOD 1S7QB 1NKOA 3EBAA 4X4XB 2Q8BH 5DJ6B 4P2OD 3GKWL 1T66C 1M7DA 4O9HL 1FP5A 2F8XC 4Z7WB 3HZVA 1Q72L 4M3JA 1PD6A 1DL7H 1ZHKB 5F7EL 2NNAA 3O9WD 4UNUA 3L3JA 3V52L 4OZHE 4NUJA 4Y4HD 2QQLH 2JIXA 1BOYA 25C8L 3F6LA 4HPYL 4GAFB 5DURB 5FF6B 2NMSA 1MCBA 2ZPKL 4D9QD 4Q6IA 3QQ4A 1CL7I 3F5WA 3MV8A 2ADIA 4BKLB 3IDIB 3R8QA 4U1KA 2XFXA 1OTTC 3MNZA 43C9A 4HK0B 5IB4A 2RQ8A 3ZT7A 4OF0A 5A16B 3MJ8A 5LXGH 4IDJH 2F19L 3LCYA 3DRTB 3DURA 3TPUB 2X05A 5CEZD 2WV3A 4XMPH 5F1OB 1OTSD 3OKLA 4Z5RA 1BFVH 4RGMB 4X6DA 2H8PA 1FL6A 4TPRH 4IJ3C 2I60L 5HI3D 5HHXH 1HNGA 4ZOCA 3QQ3B 5EO0A 3LDBB 4PJHB 5FGBC 3VFPB 1DBBH 2V7NB 3T09A 1J10A 3OR6B 3LN4B 4UV4L 4JY5L 1RURH 1NBVL 3LY6A 1YEFL 2AJVH 4I77L 5IGXL 5TGBB 2EEBA 4R3SB 3L9RB 2DQUH 3MLRH 5LQBL 4R26L 3VXNA 5I2IA 5FHBL 4HZLA 4OF5A 1VFAB 3V6BR 1FE8H 5CBEA 3FKUS 3C09C 2G5RA 3MCG1 1YPZA 4HHAA 2DWDA 2LABA 5KSAD 1X5LA 4CVXB 2DQCL 1IT9H 1U3HC 1MRFH 4WFFD 3V0AC 5HGGS 3T8XB 1UWXK 4FFYH 3A67L 5DSCA 1QBLH 4JG0L 2YRZA 2H41A 1BP3B 5BXFA 1RK1B 3KPNA 2GTZA 2ZSWA 1RZKC 4OAWB 4WWKD 4QRRB 4M03A 4U6TA 3PWPB 4NDMA 5CP3A 1SYVA 5K33A 4RGNE 4AIOA 5C92A 3FO2A 4J3VA 5I8OH 5EU7E 4DJMA 4HJ0D 3KPMA 4JM2A 4JGMA 1FGVL 3VJ6A 3CVHA 2GCYA 5IMOB 4OLUL 5EBWB 1WZLA 1HYSD 4GRWF 2J8HA 1BX2B 4LCWE 1CCZA 2DQHL 1LP9E 4MA7H 3MUJA 4MJ6B 3ARDC 3HZKA 4LLMA 3TEUA 3ES6A 3HZYA 1KELL 5JPMA 3O6FC 4U2ZA 1LO0L 5F8QC 3N1QC 2PO6A 4XPBH 4CN4A 4P3DA 1PZUB 1F4AA 3DV4B 4X7TB 3QEGH 5EUOF 1INQA 4JZNB 3UO1L 1NCDL 5KOMC 4NKIL 5GPRA 5A3ID 1L6XA 3QP3A 4GG6F 4F7PB 4P2CG 1WAAF 2AJZB 5I16B 4WUUB 3UTPD 2DYPA 1ED3B 2H9GB 2WLYA 2DWEB 1UVQA 4UUJA 4KI5E 2EXWC 1MHEB 1J87A 2DAVA 2CXKA 1NFDE 2ICWA 2CJUL 2R0ZH 3WL9B 2H3NA 3QEQA 4I13B 4YDLB 1UM5L 4TVPH 1KXTB 4U1HB 5FYKL 3DYPA 4JDVA 1UC6A 5DQDL 1JMZA 4NO5A 4HX1A 5KTEL 4PJEA 2FSEA 4XMKH 3ZDXE 4UU9B 5GSVB 3TNMA 1MIEL 4PY8J 3CIQA 2HN7B 4KRLB 5HGHA 1AGFB 1T7WA 3JVGC 3RP1A 1FNHA 1T5WB 1N26A 1SMAA 4UBDC 1CE1L 2ED8A 3TCLA 1LP9A 3FQTA 4OZHB 4P5MA 4XNUH 4HLZG 4J23A 4V1DE 2XN9A 5KOVC 5KW9L 3WKML 1QQDB 4H1LH 4M00A 2HJKA 4ZOEA 1ZWIA 2Z31C 1MH5B 4OLYL 1HHKB 4LIQL 1CN4A 4KAQL 4HKJA 4BSJA 5KSUB 3O0RH 4ODHH 4AIZA 3MRBB 2HG5A 2NY3C 1IQWH 3RPIB 4Z77B 4POZC 1ORQA 3L3DB 5D72L 1LHZA 3ALPA 5D7JD 3TYFA 3UBXI 5ISZE 3CSBA 2XOTA 3DXAE 4KH2A 1EJOH 3TWCH 3VA2C 4NQCD 4DN3L 3GJFH 4JG1L 5C0RL 3TJHC 2ATKA 3STBA 1H8OA 3AS3A 1JGDA 4WDIB 4O2CA 1R24B 2FL5A 1BVKA 3CX5J 1JPFB 4CADA 1QNZL 2PTUA 4A6YL 2X89A 1FC1A 1QZ1A 2F53A 3RGVA 1BVZA 2X4OA 5ITFB 3C6SB 4EUPB 4DKEH 2Y6SC 3ARFC 5GS0H 1FFPA 2I07A 3MRFB 1J0JA 1BD2A 2OI9C 4ZUWA 2QKIA 3GSWB 4X5XA 1K8IA 2P46B 5ICXA 3HCVA 2H32A 4GKSA 3MODL 1T22B 5JW4N 2CO7B 5D1QD 3N85L 3FO9A 1JVKA 4LSQL 5MEPA 2WANA 2V2TA 4Y19E 2A9MH 4RWHA 5C0DB 3EJJX 3BEWB 2XZQH 1H5BC 4B7LA 4L3CB 3RI5F 1S7XB 4J8RA 3MNVA 1OPGH 2EO1A 5IMLA 5C3TA 5FCSH 2BNRA 4ZXBB 4NP4L 4FQJL 3EHBC 4BFIA 1TVHA 1V8HA 2FEDC 4P2QD 5GRJL 2R15A 3MRGA 5I1AA 2HYMA 2A9NL 4UOW1 1NDGB 4PGBA 1UGNA 4S1QH 3L3GA 4NBYB 4ODXB 5JPNA 1CWVA 1UA6H 5ISZA 4OGAD 3MRDB 3KXFE 4RGNB 1AJ7L 4Z7NF 4YDVB 1J1OH 3QIUA 4ONFH 1R5VB 3PNWB 3DHJA 4Y4FD 1EAPA 5EIIA 4MXWL 4UT9L 3CX2A 4RAHA 4P23B 5D7LD 1V3LA 3QUYD 3CDGB 4BQ6A 1CGXA 4JN1L 4LCWB 5K9KB 4J2XA 1R6VA 1PDKA 3ZTNL 2LQRA 2HKFL 4R90L 1NCWL 3VFSB 3NIDF 4YE4H 2X70B 1OAYL 2YXFA 5E6IB 4IOFC 4M9OA 5MP6H 1DVFC 4GBXB 3IU3A 4XNZB 1GGIH 1YC8A 4NGHL 5JNYB 4LCIL 2W0PA 4S2SB 4NZRL 2Y72A 1F00I 3CSGA 4AM0B 4KVCL 3UAJC 1KIRA 5LAXB 2DF3A 4PJ7F 4CVZA 3P4MA 1CE6B 1BQHB 1NBQA 4OUOA 3FQXA 3EAKA 4H8WC 3L3KB 2ZUVA 2DIAA 3OAYH 3SDXA 5D7IF 4Y19A 1MCLA 1TDQA 1GC1L 4K3DH 3DI2B 4OJFL 3O2DH 1I3GL 2QSQA 5ILTL 4OI7A 1NDMA 3CFJA 2OL3H 3OJDA 5E9DD 3VXQB 5GJTL 4GW4A 4XB7A 4O51B 3LB6D 2AEPL 2P5ED 3W9EA 4H25A 2XT1B 2D7QA 2V2WA 5TDNA 4RFOL 5J11B 1ADQH 4WNQA 3AM8A 5F7FA 3C5SA 4IRSA 3MBXH 3QEUA 1QSED 2F54E 4MJ5B 1U3HA 3NFNA 3UTTB 4ZNCD 1OAZH 1KJVB 1KGCD 5JLZB 1D5IL 4FG6C 3WHE1 4N0UB 5EWIH 4LHUD 4ZAKB 1FCGA 4HGWB 3RNKB 4QCIA 2D7MA 4CJ1A 2KZWA 1T89C 1UG9A 4V1DB 4XCNA 3NABH 1A3LL 4JLRA 4IOIA 3EYVA 3ZYJA 3PL6C 1NCBH 1FFNB 2EIZA 1VESA 4EI5B 1KCKA 3WUWA 1KJ3H 4LSSH 2FR4B 3B9KB 3OX8A 2HVKB 3IJHB 1FV1B 1E4XL 5BRZA 1FNGA 4W6XB 3UZVB 3MRJB 3M8OL 4WU5B 4PJXB 3UBXG 3Q5TA 1N4XH 1I7RA 3EYSL 4FQXB 5FKPB 4OCLC 3QRFM 2A83A 1JF5A 3O4OC 1CIDA 3FMGH 3SKUD 5DRNB 1J1PL 4PRID 4DQOH 1NFIA 5JHDA 1BZ9A 4GXVH 5JQHC 3OB0K 4QRQA 4XNQA 4XTRC 1R0AH 2X1XR 1CGWA 2XNAB 4DW2H 2PW1A 4Z7UB 4JHZA 3TNNB 4YXKL 5ICYA 3PP3H 3GSXA 2C1OB 2R0KH 2YC1B 3G6AB 2JB6B 4V2BA 2L7UA 2LAAA 4WUKH 1A6ZA 4YK4C 4OFPA 3SDAD 1A2YA 1U8IA 5GGSA 1YQVH 3RJQB 5CS7A 5D5MF 5KVFL 4NOBA 3OMZA 5E4EC 5DC0A 1P6FA 3W0WD 2VDPL 2AABL 3RVUC 1NC2B 2A74A 2O93L 5I0ZA 4KKLC 2Y7QA 3VH8B 3O8XC 4HS3A 2M26A 1DLHB 4ZS6D 3RY5A 5T5NF 4HWEL 3PGFL 3IU4H 1IAII 4QWWC 3T0DA 2N1KA 5DVOA 1MCOH 3D0VB 1NGXB 4HUNB 2OYPA 1BF8A 1YEHH 4KK5D 3FB6A 4LLVB 5J12B 1X7QA 4G6FB 3QWQB 4U31A 3BMWA 2MWCA 4KJQD 5K93A 2Z31A 1A7QH 4JEGB 3CCHB 1LO3H 4ZD3L 3SE9H 3KXFB 3LQAH 1CGVA 5GGTH 2IH3A 3MV01 1MI5E 2BOBA 1KENL 3OAZH 1CLZH 4OCXH 3JZ7A 3IDXL 1QFUL 4XB8A 4BYHA 1MCWW 3B5TA 3VFUB 5FECA 5BV7H 5D7KD 4U1MB 4ZUTB 1DN0A 1CLOH 5IHUL 3CXHK 3D3VE 1FFQA 3QFDB 3RVTC 5EH1A 1GZPA 3WIHL 4L4TD 4TRPL 1SJEB 3P73A 4DVRL 1X44A 4JRXB 3VFRA 2AJYL 4NFBA 4DWHA 2Z93A 2IH1A 3HC3H 2AJ3B 2R39A 3OR7B 5GGVH 3QUZD 4M1CD 1QFWI 3INUH 4HCRA 4L4VD 4R97B 3BUTA 5HY9A 4NQEB 3N9GH 5C08A 1ZMYA 1QSVA 1TJHH 3SCMA 3BWUC 1CGSH 1D9KB 4I3SL 2VMFA 3ARFA 4UB0L 1OT2A 4ELMB 1A6VH 1PYWA 4P5TC 5DJDB 5EOQH 1EEUA 2FGWL 1MRDH 1NEZA 2DL2A 3KYAA 3VXOA 1Y18B 5TE6L 5ACMA 2ZUYA 4G80B 5ALCH 2PYFB 1CFTA 4ZS7H 3HUJB 4NN5C 3HE6C 4FMKA 4WI9A 3D69A 5IVXA 3GUTA 2YBRB 2CK0H 2I24N 2BNQA 2DKUA 1EHLL 3S34H 3OB8A 5CMAA 4GKZB 1I1FA 4YHZH 2F54B 3TV3H 3OHXA 4BK5A 2NW2A 1MVFA 2X1WL 2Z4QB 1F6AA 4NNYB 5AWNL 1C12B 2E27L 3H9SB 3H8NA 3T4AA 1JYXA 4HXBH 5EU6D 3BT2L 2BCKA 3WXVL 5HGDA 3L95B 1JI2A 3BOVA 1DFBH 4F7CA 4H0GA 5HYJB 5L7XL 2DDQH 3LN5B 5EU5A 5CIPB 1EFQA 3I3EA 2NY7H 4ODTL 1G9MC 4KQ4L 3MMEB 1MHHA 5EU3B 3SJVB 4EDWL 1XIWD 3FRUB 3MFFA 2A6IA 4I1NB 3T65A 5IW1B 3T3MF 1L0QA 2DQTL 3FT2B 4F7EA 3TBWB 3EDDA 1IL1A 2VC2H 2V17H 1K9TA 4L8BA 4TYUA 5GGSY 5GGQH 5TQ0H 5JW4M 1MFAL 4XP6H 2GEEA 2OM5A 1V05A 4HWBH 3MROA 2BERA 2IQAA 3EOYG 2PETA 3FO1B 1AD9A 5EB9A 4HUXA 1YYML 4WO4A 3ZYOA 5T1KA 4FMFA 3UCRA 4X0KB 1P4BL 4JPKH 2FO1A 4QXUH 1M05A 1MUJB 1ULVA 3CUPB 5J6GA 2D7NA 3BPCA 3MOAL 1ZVYA 1PSKL 1R5WB 3MYJA 4GSDH 3S36L 4PLJD 2ZKHH 4ZTPH 5IESH 3QZWA 4OLXL 4P46C 3U46A 1NGZB 4M9PA 3LKQB 1CFNB 1KLGA 5L9DH 1KXVC 1PX4A 1ZA6A 3X17A 1VADB 3WDHA 2VDOH 1P69B 2DLGA 5ADOH 2GT9B 4G6ML 3OBAA 1OTUD 1CF8H 1S9KC 4KRPD 1A6WL 5GSRA 3IFNL 1VKXB 4G42A 1ZHBB 4ZUVB 4KQ3L 3R0MA 4WFHE 4O4YL 2ZOLA 4L8DB 3LD8B 3ZKND 5F88B 1QEWB 4XP4L 4FFVD 3NH7L 5KANI 5CILH 5FHAL 3FN3A 3U48A 5E8NA 3EO9L 4WW2B 1AKJD 1S7WB 4NO3B 5E5MA 1DDHA 4XCYA 3ULVF 4OD3L 3G08B 4Y8AA 2VLKE 1MI5B 1S5HB 3W2DH 5KS9F 5L2KA 2AEIT 2VDQL 1NLDH 5BZWA 2EE3A 1U8JA 4OZIE 1OAKL 3NCCB 3KNBA 4H0HB 1SBSL 2NY1D 4X8JB 4KUZL 5CBAA 2FD6H 4RGMC 3WD5L 5CCKL 2QLVB 5CWSB 4LASL 1ES0B 5TPWL 3BZEB 3D3VB 3LDBC 1JZ7A 4UV7L 4JFFE 3RDTA 5F9AC 1KACB 5LGKA 5J6HA 4PB0L 3O4LD 3WSQL 1RVFL 5CEXB 3KLAA 4RFEB 4C57C 1QHPA 3T0BA 3PWUA 1G1CA 3TBSB 3VXSB 1HKLL 1CL7L 2NXZD 4FNLH 3X11B 4YR6B 4LRIC 1HXMA 4MD5B 3V6ZB 4Q9QH 1IC5H 3LZFH 5DQ9B 5IMMB 1DQJB 3SDCD 1D6EA 2J8UE 1C5DA 5LWYL 5IBTH 5LVEA 4HPOL 32C2B 5FO8B 1ZOXA 3CFCH 3NOIA 1MF2L 3ARZA 2NCMA 4NM8H 4XC3H 1GOFA 3GMLA 1JNNH 2MTPA 4MXVF 5ANMA 5EOTB 2VAAA 2GJ6B 3P9MA 3DUSB 3GSQA 3O8XA 4HIXH 7FABH 3S96A 2YPLE 4JFOB 2VLKA 1ZXQA 1UXSB 1T1ZA 5F3BA 1YECH 4JREB 4OGXL 5D8JL 5HVHC 4OM1L 1FAIH 3KPQA 3MRQB 4TQEL 4LPUA 4GRLA 4U6XB 5J4MA 3R0NA 3T77B 2UUDK 3BKCL 4I18B 5FEBA 1VACB 1OSZB 2XY2A 2JJVA 2JE8A 4P3WA 4KHXH 4GG8A 4XP5H 5D1ZB 1TZGL 3ILQC 4JFFA 5CHNB 1YEIL 4CBPA 3CFKA 4Z8FH 5ERWA 5CEZL 4FP8L 5EZJA 5SV4A 4X6DF 3KPRA 1W0VA 4MWFB 4OBRA 1RZ7H 1IM9D 1EO7A 2A6DB 5EIQA 5AAWA 4O00A 2DM3A 1KPVA 3VFWA 5CP3H 2JK5B 3HR6A 1BOGB 1EGJH 2VDNH 1DLFH 2VDLL 4RX4A 4UDUB 2EIEA 1YMMD 1RZGB 3STLB 4LSRL 3MYZA 3ZO0A 3CVHH 3V7AG 2VE6B 1SEQH 1GIGL 2ORBL 1FVCA 1FQ9C 4Z7OE 1CVRA 5BVJB 3HE7B 4YDLC 2CRMA 3TIEA 2CUIA 4JO3L 1YPZF 3QJFA 1X5GA 1N6VA 1A0QL 4MDIB 3DX9A 3T1FA 3DPBA 1KLUA 1JHKL 4P5TA 1T7XA 1YNTA 2WWMD 4LEXH 2D4FA 5AD0B 3C08L 1ZKAA 2IADA 4HH8A 5DRWB 3MRNB 1UH4A 4N8VG 5E4IA 2VABA 4DEPB 1W72A 2VERN 1RZJL 4EQ3A 2V6HA 2EDHA 3DSFL 4D0BB 1R3IL 4K3GA 3OKMB 4XPGH 1F4YL 1EPFA 2VISA 3D25A 1LK2A 1WCBA 5GRVL 1HI6B 1XR9B 1PKQE 4HD9A 3VXTB 1A7NH 4JM2F 3VXMD 1G9NC 5F6IB 4UIMB 3BQUB 5HGAA 5DJZB 4NZTL 1I3UA 4LSUL 5C07A 3CLEL 4O58L 3LMJH 5KANG 5KBNC 3EO0B 4GAYA 2OZ4H 1F11A 3NZHL 4ODWB 5ALBL 4G9DB 3ULVD 2VWEC 2YEZA 3PABB 1JMXA 3MA7A 4M3KB 2ESVB 2CLVA 1BGXL 3MGAA 5C0CE 2DIJA 3RL2A 1NCAH 3OXRA 4R6UA 1IGCL 3MLSH 5DUMH 1YEEH 5KVGH 4OZIB 5I1HL 4OFKA 4NJAL 4OZFA 2X09A 3OJVC 3LEVH 3VXPA 3FFCD 4HWNA 4LNRA 3UTQA 4HC1H 1G7MA 4LRNL 5FUOL 4EOWL 4XPHH 1MPAH 2F5BL 3P77A 3LQMA 4M5YH 5C0IB 4J3SA 4Y1AE 5DJYB 1DBJL 1FN4B 3MCLH 2XRAH 3C6LD 2NR6C 1HDMA 1NGQL 3VGGA 2Q7YB 3QDGD 3NA4A 3VE0B 4PLKD 4A2MA 1OWWA 1KIQB 2V5TA 1JV5B 4MSWA 4HS6B 2HFFA 4HIJA 3IF1A 2GAZA 3QXDB 2R2EA 5F7DB 3BESR 3QI9B 3IDMA 1AXTL 2NZ9D 4YZFF 3FO0H 4PJEF 2W9EH 4P46A 1HE7A 4HXAH 4C4KO 2NPLX 1M71B 2J8UB 4ZXBC 4JM4H 1YJDH 3I84A 3QPQD 3T0WA 4Z7WA 1XCQB 5EORH 3GMPA 1R3LB 4WFGE 4R0LB 2YKLL 1PG7H 4FZ8L 4F8QA 1KJ2H 1A6AA 2WM0A 3J8F7 5FF6A 5JXED 4RGNC 1RFDH 1I7TB 2ZCHL 5EU7C 5SX4I 3T4YB 1RAMA 2CGRL 3MV8D 2H32H 3KPSE 4RA3A 1ACYH 5FM5M 1T3FB 2MKWA 4P23C 3TO4A 4ENEC 2P7TB 3M07A 4NWTL 5IJVB 4JKPL 2VIRB 4HK0A 1VGEH 4J4PA 1IFHL 2G75B 1PEWA 2K9UA 5JORB 1YEJH 2DQIL 2DLFH 1ZA3A 2NY6D 1MAMH 5B21A 3MLVL 3QDME 4EI6A 4S1SL 4X6BB 4YX2H 4GBXC 1BIHA 5T5FH 1J5OL 3E1F1 4XNZC 3QWOB 1TZIA 3VCLA 2PUQT 3SDDA 4DN4L 4PGCB 5L8JB 5HYSG 1QVOB 3KJ4B 4PJHA 3VFPA 3RZCA 4XPFL 1KOAA 4OCRL 4TUJB 5INDB 4AQ1B 4W6YB 2Y36L 3FHAA 5GQBA 2G2RA 1C16A 5C8JB 1IEBB 1AQKL 2VUOA 2OQJB 4Z0BL 1J86A 3O45B 2AXFB 1WFTA 3RWHA 4ODBD 4BQCA 4DKDC 5FB8A 3HMXL 5F7MC 4M1GL 3ULSB 4E9LA 4C83A 1MLBB 4IM8A 2O5ZL 1E4KC 5KVMC 5GS3A 5J11C 2NX5B 4U49A 4CVXA 1PQZA 1DBAL 3U83A 1LDPL 4HMCA 4E41E 3W9DB 4ZPTB 1G7LB 2EDQA 3SPVA 1ZANL 3BIKB 4ZAKC 5FIEA 2Y9RT 1UCTA 4LOUD 4MJ2A 4OAWA 4UTBH 3R8BB 3DNKA 3FFDA 1U8OB 3MRRA 3LH2H 3MACH 4R2GB 1Z9LA 1B90A 5F89A 4Y16B 4G8EA 4MB5A 2R2HB 5J89A 5HDLA 3O11B 4EI5C 4PJCB 2CSPA 3QA3B 3B9KC 5IEKA 4XP1H 3WNNA 2IPTL 3M1BB 2R1WB 3QCVH 3QHZH 4FRWA 2VDRL 3HNTL 4YQXL 3DGGA 2AK4D 4G43A 4FQXC 1F2QA 5C0CB 3KGRA 5D7SL 4JZNA 1FH5H 3MA9L 2EZ0D 5D6DC 3EOAB 2VLRE 2C3WA 4XBGA 1LNUB 43CAA 1XH3A 4M1DL 1FZOB 3MZTA 4HDIB 1WC7B 1AO7D 1G7JB 4WI4A 2AJZA 4XGZB 3TYGL 5H37G 3AXLB 2O5YL 5EN2A 4YPJA 3WFDH 4OB5L 3IDGA 1RUML 3RRQA 4ZFFB 1BJMA 3QAZB 4WI5A 4Y1AB 3VGBA 4BZ2L 3TN0D 3QISA 5HSFA 5I1LB 4HUKB 35C8L 5T33L 4OD2B 3MLWL 5HHVH 1K6QL 4P9HL 2I9TB 3BYYA 1U8NA 2YD5A 1CDGA 4I5BB 5I1KH 1K85A 2ED7A 5DMYA 2D31B 3MUGA 2IPKB 4APQA 1VSCA 5K9JH 4PYGA 4LDLB 4FFZL 4FTVE 4NT6A 1RJCA 5ID1B 2GUOB 5DHVA 2BJML 3MV9B 1KN4H 3LKSB 4OZGE 4YDIL 1XGUA 4NM4H 4UAOB 2G5BA 4IHOB 4AYFA 3QDJD 4IBLT 3GBNL 3RVVD 3BDYH 4XAKE 4L8SA 4PJ9B 3KPSB 1KFAL 3VGDA 3RPIA 3FHQA 3BH9B 4Z77A 1Q1JH 3SE3C 3WEXA 1IGFH 4Q97A 4NN7C 4PP2A 4LK4A 3IJYB 2BDNL 3GSRA 4RGOH 4LVHB 3SKJL 5IHZA 1LGVA 5FO9B 2M2DA 3THMH 1R24A 2A2QT 5DQJB 1BZ7A 2VZOA 3JWOH 4OLVH 3NCYS 1FYTE 4RAUB 2F53D 4F37K 1UJTA 2W0FA 4ZO9A 3X14A 1IAIL 1QRND 5ETUB 1KIPB 1RZIB 1D9KC 2Z92B 4PJIE 5ITFA 4UTAH 1UXWB 3HI5H 3MRFA 4NSKB 5IW6B 5L2JB 2E7LA 4PTTB 2J4WL 1KC5H 3B6SB 3GSWA 4MVBC 3F7RA 3BEVB 1PLGH 3NFSH 1UACL 3AAZA 1NH6A 3QEHA 1P7QD 5JDSB 1ZT4B 3HAEG 3NA9L 1EAJA 3QHTC 3BW9A 4GRMA 1OGTB 2QBWA 4HLJA 4BFGA 4XMLL 2ENSA 3U0PB 4FFWC 3CZFA 4MXQC 4F9LC 1GYAA 4QRTB 5C7XL 4OZGA 3E6HB 5C0DA 4F33A 4PREB 3SOBL 3KWWA 2V5SA 1CFBA 2BNRD 4RMVA 4E41B 4ZXBA 3B8SA 2QV2A 1N6QL 5FYJD 1T4KB 4HCRH 3GB7A 1C08B 3D2UB 1RIHL 5I1EH 2OJEA 5I75B 3VXRD 3T04D 1QFWL 1F6LL 3F7VA 2HVJA 2XWBA 2W1NA 4OM0L 4ODXA 1G6RL 4FZEH 4XWOC 5DUPL 4HG4K 5GISL 4OF6A 1U8QB 1IGTA 5E08L 4A6YA 3FQWB 2F58L 3QCTL 3QULA 2IFFH 4LSPH 1KCUL 3K2MC 1OTTD 4P4KB 1HQRA 1IC7L 3H3PH 1PEZA 3QRGL 1AQDA 3VFSA 1Z3GL 3Q48A 4PJAE 3TVMB 1NL0H 1ROWA 2DL9A 2CDEA 3JTSB 1A6TA 2MQ0A 3P3YA 4ZO6A 3IDYB 3OPZL 4FQ2H 2VLRB 5JNYA 1P5UA 3GDBA 2XWTB 4CU7A 5HXMA 5F1NA 4AM0A 4UZGA 3IFOB 1D7FA 1CG9A 1H8SA 1IQDB 1CE6A 3H42L 4E5XB 5IT2H 5IM7A 2DN7A 3OF6D 1LEKA 1G7QB 4DAGL 1KB9J 2R8SH 1NSNL 5TH2A 2P5WB 4LQFL 3WXWH 3BGFB 3ZZ1A 4UILL 2FIRT 4U0QB 4ODSH 5EBLB 4I3RL 4Q7DA 2AXGB 4XHJC 3D39E 1N59B 4O51A 5IVXF 3QNZA 4G6JH 5IK3B 3WDIA 1E4KA 4K8RC 3RWDA 4XC1H 3VFNB 1U3HD 4K9EH 1GJIA 1HH6A 4MJ5A 2YD1A 5BVPH 1EFXB 3MRHA 5H94B 4PJDA 4XT1C 4KHTL 1X5FA 3IFLH 4C56E 1L7TL 4OCWL 1GXEA 1MLCA 2HLFC 2W65B 3LEXA 3SKMA 1EUTA 4FTVB 2NTFB 5C0EB 3PIQB 1IRAY 5ICZB 3GNMH 1VB9A 4L3AA 3LD8C 5IMKA 5E6YA 1NLBH 4MQSB 4X83A 4JFDD 2RFXB 1P1ZA 4Z7QE 4WW2C 4PJAA 4QT5B 1GZQA 3HG1E 3PF2A 4PG2C 1P6AB 1T83C 3QH3A 4YHYB 4YIQA 1FO0L 3ARDD 4HIEA 2GTWB 3D85A 1HN1A 1GAFH 3IAQA 3HNVH 3O6FD 1N3NB 4JDTL 1UKQA 4PJXA 4L9DA 5BOZG 2HRLA 2O5XL 4IS6B 3P0VL 4PB9L 5FKPA 3UC0L 3MGOB 1LO5A 4HUVB 4KMQA 5DDHA 4OIIH 4JZJB 4U1LB 2XKNB 2D7OA 5D6DA 1WLHA 5IB3B 1WT5A 3QIBC 5JOFB 3PV6B 5DMIL 1HHIB 3H3KA 1B9ZA 5HHNA 1IGJB 4LPVA 5EA0H 4Q9RH 3K8LA 4QOKE 3D39A 1V7MH 1FYTB 4ZFGH 3ZL4H 1CXKA 2EXWD 1ZT7B 2UWEA 4Y2DB 4Z7UA 1YUHB 3KPOB 4G8GD 3CMOL 1YMHB 3PP4L 1X5JA 4S11A 5HBBA 4PJIB 3IXTA 1Y6MR 4XVUC 1HIML 3GEWB 5HJ3A 5C0FA 1EO8H 2BZDA 3L5IA 4FXGA 4RDQF 4Y2OA 1WEJH 2H1PH 2HTKC 1EUUA 2B4CC 5D70H 4XVSL 5EC2A 2UZYB 1OSPL 2D7PA 3RU8H 2CUMA 3BZDA 4DZBA 1Z2KA 4N8VB 3QUML 2EYRB 3RTQA 1A14H 4ELKB 1EVTC 2VQTA 3IRZA 2AAVA 2YPVL 3OKDB 3GHEL 4UBDD 2BRRH 5C0NC 1Q9KA 4HKXA 3LPFA 1NGXA 4LMQE 4JREC 5LGHL 5DJ2B 3BP6B 2Z31D 4HUUA 2BVOB 5FK9A 5E2UH 5C9KA 4I18C 3U4BL 3RFZC 1R3HB 4Q0XH 2D0FA 2XZCH 3CNKA 5D93B 3VW3H 4GKOA 2NY3D 1QKZL 3MRIA 3U9UA 4BQ8A 3PHOB 4POZD 1F97A 2VLJE 5E99H 1Q9LA 3ZLQC 3TGXA 3V4UL 4QOKA 3VFUA 3HZMA 3I75A 3SDYL 3CH1B 2YMXL 1X3DA 5F3HB 3TJHD 3DUUA 3BVNB 1RZFH 4KVNL 5JUEH 3PGDA 3RY6C 3R1GH 4CN6A 1UM6H 2DQJH 3UP1A 3V9FA 1T0MB 2V2XB 1MHCB 4XP9L 2R69L 5EFIA 2AEQH 4PLOB 1JZ3A 3FCTB 4OLEA 3JSSA 2Y6SD 3ARFD 3DARA 1D9KA 5HDBF 4ORZC 4NKDA 4PV9B 3LV3B 4H20L 4ELMA 3BAEL 5FA4A 5J9PB 2CKBH 2FH8A 1V3KA 4WRLA 3UJJL 2FJGB 3ULUC 4AEHH 3OAUH 1TNMA 4ESKA 1CXFA 2EH8H 5SWZD 2CR3A 4G80A 4L3ED 1FNSL 3HUJA 1A3QA 4DEPC 4CVUA 4PGDA 1V7NL 1BECA 2VO5A 1D5MA 1KN2L 3IKCA 2IAND 1IEAB 1FLRL 1L9MA 3QXVA 3ZTJH 5IIEA 5GGRB 5DD1L 3O41A 4LGRB 1UB5A 1RD6A 3DIFA 2WIMA 2Z4QA 2L4OA 2E8ZA 2C3VA 2LE9A 2FEDD 3H9SA 1AR1C 5HI3C 3VFOA 5F6IC 3BQUC 3OXSA 4G8FA 1TVBB 1OAUH 2P45B 3K80A 3FOLB 3WIHA 2XG4A 3MQIA 3NACL 3ZKXB 5HYJA 1XGYL 1I8IA 1I1AB 4JQIL 1IM3A 1JGLH 1QLFA 1U3JA 4K94L 3NPZB 4U2YA 4YHIB 4XCFH 2O61B 3BUYA 1IC1A 2HWZL 4N9GA 4F15C 4MQTB 1J0YA 5F93C 3X13B 5D2LB 3E3QE 5MEND 5C6TH 5IW1A 1OY3B 4IMKC 1HWGB 3TBWA 4JFEE 1VEPA 4HS8H 1W72H 4JDZB 1BMGA 1JN6B 3LHPH 4U7MA 2P8PB 5AZ2L 1I7UB 4IOFD 5KN5B 4Y8DC 1DVFD 3I50L 1MFDH 3UTSE 5DFWH 1WV7T 2IQ9L 4QTIH 5T1KD 4GO6B 1RZJC 5C0AD 4D0DA 4P5KA 4PRBB 4QY8B 2AJUH 4F7TB 1FIGL 4GXUN 3UAJD 5DVLA 4N8CH 5EOCH 1A1OB 4WVRA 4P2RE 4WHCA 3DVFA 2Y07L 4LSVH 3K46A 3CD4A 2OTUA 2YPKB 3CUPA 1AGCB 3NZ8B 5J3HC 1A4KB 3X3FL 1R3JA 3QI9C 1XF5A 2AJXH 1MHPL 5TF1L 4Y4KB 3ZSSA 1NGZA 2JJTA 3L6FA 5CUSH 3LKQA 1A1MB 1WJ3A 1K4DB 2E9JA 1I1RA 4JY6A 4OZFH 1TIUA 3I02A 4X98A 2EDLA 3PWVB 2FX9H 1D5ZB 1NC4D 4R0LC 4WJ5B 2X9XA 4OFYD 5EPMA 3IVKA 4FG6D 2XI9A 4LSTH 2BHZA 4JFPB 4R7DB 1SYSA 2XA8H 4RQQA 4Y5XA 3QJHA 4DZ8A 4HT1H 2QR0A 2ICES 4LLDB 4AH2A 3D5OF 5LBSL 4JFEA 1HOCB 1JGUH 3VWJA 8FABA 3L1OL 5C0JA 1W0YT 1KB5H 3V6FB 1XGQA 4XCEA 3PL6D 3VWKA 3EZJB 4NO3A 3TIDA 1GRWA 3ULVL 1XGTB 3IDUA 2Q1EA 5T1DL 3G08A 4PRPE 3O3AA 1YN6A 4KZEH 3UTSA 4Y5YA 1T83A 3MOBH 1EEYA 1S5HA 4MNHB 5KJRH 3QDHA 2ED9A 3GM0A 4NC2B 4PY7B 5IOPA 4IEFB 4N0FB 5B3JF 3T0XA 5T3ZD 4BH7B 4M4RA 5DI8A 4P59H 3S35H 3BZEA 3RWEA 1JHLH 3K8MA 4LLYB 2ZZUT 4HKZA 4H26B 3KJ4C 5GHWH 4QRUB 3QO0B 3WFHB 3QIBA 4MNQB 4HJJL 3QFJE 5DZLA 1KV3A 3EGSB 4XTRD 3GJEA 2OMNA 1FBIH 4YHML 4LCYB 5I71B 4NC1E 1U8LA 5HHOE 3X11A 1QHOA 1OF2A 3G5ZA 3K74B 4WEBL 2NY5C 4HWZB 2FJHB 1MELA 3IRPX 5MEOA 4C59B 1PW3A 4HH9B 2WWKO 4R96A 5IMMA 1N8ZB 3S3JA 1UENA 1KEGL 4LKCA 1T2XA 1W0WA 3CK0L 1G7PA 4R7NA 3HFML 1KTDA 3V4VH 1HHJA 32C2A 3CLFL 4Z7WF 1WBXA 4WENB 5C9JA 4UINL 1I1CA 4QEGA 3Q1SL 3RVUD 4D9QE 4QHNA 5HD8C 4DKFL 4KKLD 3S37L 3GKWH 5HI4C 2X4QB 4O9HH 2H2SC 4GLRH 5DK2A 3V6OE 4I4WA 4Z78B 1Q72H 2JJWA 5F7EH 2Q76B 2XWJB 4K7PH 4QWWD 1HSAA 4JFOA 4Y16C 3AREA 3CVIH 1WICA 1S7TA 2KQMA 4HPYH 4BH8B 4D9LL 4ZODA 4KROB 3O3EB 4U6HB 4B41A 3MRQA 1J05A 5CEZE 2ZPKH 3EO1B 3MLPA 3KVQA 5IFHL 3WCYA 4I18A 2YUXA 4UT7L 2QTEA 4FS0A 1QFOA 3OG6B 3KYNA 4B53A 4OV6F 4N0YH 2NY4B 4NO0D 3QFJA 2OK0L 5C0GB 2F19H 3MLTB 5C09D 2YK1L 2XPGA 3RVTD 5DRXB 4RCAA 2A6DA 1IEHA 3AU1A 4PJHF 4GS7B 5HHOA 2YOCA 4JGJA 1JCKA 3EIFA 5E8DL 1QG3A 1P7HL 4P2OA 3STZB 1JF1A 4EDXB 2I60H 1DQML 2JJSC 3MC0A 4XNXL 4U7KA 4O2FB 1YY9C 5I17A 3KLHC 1RZGA 3UTZA 3OJMB 4TSCL 3O9WA 3QAZC 1E0OB 4Y4HA 1U2CA 4JY5H 1QSFB 4IMLA 1NBVH 3BSZL 4OFIA 4HZAA 1YEFH 4MA1C 4I77H 5IGXH 4OGAC 4NQXA 4JFQA 5LQBH 4TSBL 4R26H 4Y4FC 4YHLL 3LRHA 3GSNL 2XA3A 5EULV 3BP7B 4FQPA 3BWAB 3GRWL 2WUBH 3FT4B 2WNGA 4JPWL 3HAEB 3SE4A 1LEIB 3L5WA 2R0WL 3HE6D 3QUXB 5F44A 1SVZA 5LGJB 2DQCH 2Y1VA 1U93A 3X12B 2VLMD 4PJGE 4XBPA 1FVDB 2FYYB 5LKNA 1K8DB 4CNIA 5DEZA 2A73A 2IBBA 3BZ4B 3VGEA 5CAYB 3A67H 4YHNB 4PJBE 1HI6A 4UAOC 4EIGB 2ICWJ 5TJWK 3W5MA 2HJLA 3GMNB 3IJSB 4YPGA 3LS5H 2QJDA 3NCFB 4UIMA 1INEH 2DD8L 1Q0XL 1BFTA 2BVQA 4PJ9C 1YA5A 2BXZA 2APXA 3HR5B 4M6NL 5F9JA 3NFPA 5HHME 1FGVH 4QRPD 3ZDZF 1EEZB 4OLUH 3JV0A 3PABA 4HMDA 4M7LL 2DQHH 4DGIL 5E2TL 4R8WL 1J9CT 4PRPB 2YD9A 4GAJL 4LVHC 5CZVL 5ECJE 3C8HA 1LO0H 1KTLA 5GGUA 1ETZB 5LCVL 4ZQKB 4AL8L 5KSAA 5DHVH 2ZG3A 3UO1H 1NCDH 4WI2A 1CFVL 4NKIH 4BUHA 3JTTA 3AFLA 4RAVB 4LSDA 2ICCA 4YO0A 4MAYB 3BPLB 1TETH 4WIQA 2JCCA 1KCLA 1TJGL 1BBDL 3CU1A 4RZCB 3MLZL 1RMFL 5ESVB 2PW2B 2VH5L 3G5YB 1VENA 1MVUB 3GFUA 1QSZA 5FOBA 1BFOA 5E2JA 2CJUH 1NUGA 3U0WH 2IALB 1HEZA 3BH8A 4RRPG 3QXDA 2X4SA 3PGCA 4BSVA 4P46D 5FKAB 3ME0A 1H0DA 4PJBA 5FYKH 4HUMB 4MD0A 4HV8A 5DQDH 1NBYB 4DFHA 1D5XA 2MCG1 5KTEH 3K0WA 4PGZA 3JWDC 1RUPL 1QLEL 1MIEH 3QXAA 4OZHF 5I75C 3P4NB 2Q3AA 4UNVA 1O7VA 2ADGA 2XY1A 5DURD 1MOEA 1F4WL 3KYOA 4L5FL 1ZLWK 4WHDA 3ZKQD 1JZ6A 2X1QA 3O2WH 1CE1H 5DS8B 3WKMH 5D71H 1I3RA 4NQCE 3L7EB 3FAXA 2CDGB 4X5LA 4GXUM 4OLYH 4LIQH 3P30L 5DRZB 5IJVA 1J8HB 3ROLB 4MB4A 3V5KA 4GT7A 2PTTB 3TVMC 1KBGH 1SHMA 5JORA 4DCQB 2C1PB 3BRDA 3I6GA 3WV0A 2DICA 3S4SB 1NPUA 3IDYC 3F58H 3UZQA 2FZ3A 3QWOA 5C0RH 3UBXA 5K59F 5FUZL 3G9VA 3VI4F 2X9WA 1F90L 1K2DB 2VNCA